Symbol:
Ppia
Name:
peptidylprolyl isomerase A
RGD ID:
3372
Description:
Enables cyclosporin A binding activity. Involved in negative regulation of calcineurin-mediated signaling. Predicted to be located in cytosol; extracellular space; and nucleus. Predicted to be part of protein-containing complex. Predicted to be active in cytoplasm. Used to study epilepsy. Human ortholog(s) of this gene implicated in cholangiocarcinoma and human immunodeficiency virus infectious disease. Orthologous to human PPIA (peptidylprolyl isomerase A); INTERACTS WITH (R,R,R)-alpha-tocopherol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CYCA; cyclophilin A; cyclosporin A-binding protein; CyP-A; MGC72881; p1B15; p31; peptidyl-prolyl cis-trans isomerase A; peptidylprolyl isomerase A (cyclophilin A); PPIase A; rotamase A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Ppia-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 85,491,223 - 85,496,884 (+) NCBI GRCr8 mRatBN7.2 14 81,279,292 - 81,282,960 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 81,275,091 - 81,299,601 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 85,680,216 - 85,683,897 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 86,920,016 - 86,923,697 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 83,369,616 - 83,373,297 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 86,673,775 - 86,677,443 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 86,673,775 - 86,677,443 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 80,306,923 - 80,310,652 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 87,165,998 - 87,169,995 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 87,185,142 - 87,189,140 (+) NCBI Celera 14 80,161,152 - 80,164,810 (+) NCBI Celera Cytogenetic Map 14 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ppia Rat (+)-catechin multiple interactions ISO PPIA (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of PPIA mRNA CTD PMID:24763279 Ppia Rat (1->4)-beta-D-glucan multiple interactions ISO Ppia (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PPIA mRNA CTD PMID:36331819 Ppia Rat (R,R,R)-alpha-tocopherol increases expression EXP 6480464 alpha-Tocopherol results in increased expression of PPIA mRNA CTD PMID:16908007 Ppia Rat 1,2-dimethylhydrazine multiple interactions ISO Ppia (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PPIA mRNA CTD PMID:22206623 Ppia Rat 17beta-estradiol multiple interactions ISO PPIA (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of PPIA mRNA CTD PMID:20823114 Ppia Rat 17beta-estradiol decreases expression ISO Ppia (Mus musculus) 6480464 Estradiol results in decreased expression of PPIA mRNA CTD PMID:39298647 Ppia Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PPIA mRNA CTD PMID:32145629 Ppia Rat 1H-pyrazole increases expression ISO Ppia (Mus musculus) 6480464 pyrazole results in increased expression of PPIA mRNA CTD PMID:17945193 Ppia Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Ppia (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Ppia Rat 2,2,2-tetramine multiple interactions ISO Ppia (Mus musculus) 6480464 Trientine inhibits the reaction [Copper results in decreased secretion of PPIA protein] CTD PMID:19635393 Ppia Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Ppia (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Ppia Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ppia (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PPIA mRNA CTD PMID:21570461 Ppia Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PPIA mRNA CTD PMID:32109520 Ppia Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Ppia Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2 more ... CTD PMID:19954255 Ppia Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:19954255 Ppia Rat 2,6-dimethoxyphenol multiple interactions ISO PPIA (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of PPIA protein CTD PMID:38598786 Ppia Rat 2-amino-2-deoxy-D-galactopyranose decreases expression EXP 6480464 Galactosamine results in decreased expression of CYCA mRNA CTD PMID:22563491 Ppia Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PPIA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PPIA mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PPIA mRNA CTD PMID:28628672 Ppia Rat 4,4'-sulfonyldiphenol increases expression ISO Ppia (Mus musculus) 6480464 bisphenol S results in increased expression of PPIA mRNA CTD PMID:39298647 Ppia Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PPIA mRNA CTD PMID:36041667 Ppia Rat 5-aza-2'-deoxycytidine multiple interactions ISO PPIA (Homo sapiens) 6480464 [trichostatin A co-treated with Decitabine] results in decreased expression of PPIA protein CTD PMID:19294695 Ppia Rat 5-aza-2'-deoxycytidine decreases expression ISO PPIA (Homo sapiens) 6480464 Decitabine results in decreased expression of PPIA protein CTD PMID:19294695 Ppia Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PPIA mRNA CTD PMID:30047161 Ppia Rat acrylamide affects expression EXP 6480464 Acrylamide affects the expression of PPIA mRNA CTD PMID:28959563 Ppia Rat actinomycin D multiple interactions ISO PPIA (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PPIA protein CTD PMID:38460933 Ppia Rat all-trans-retinoic acid multiple interactions ISO PPIA (Homo sapiens) 6480464 [Tretinoin co-treated with Tamoxifen] results in decreased expression of PPIA protein CTD PMID:17098229 Ppia Rat all-trans-retinoic acid decreases expression ISO PPIA (Homo sapiens) 6480464 Tretinoin results in decreased expression of PPIA protein CTD PMID:17098229 Ppia Rat alprazolam increases hydroxylation ISO PPIA (Homo sapiens) 6480464 PPIA protein results in increased hydroxylation of Alprazolam CTD PMID:15806426 Ppia Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PPIA mRNA CTD PMID:16483693 Ppia Rat arsenite(3-) multiple interactions ISO PPIA (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to PPIA mRNA] and arsenite promotes the reaction [G3BP1 protein binds to PPIA protein] CTD PMID:32406909 Ppia Rat arsenous acid increases expression ISO PPIA (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PPIA mRNA CTD PMID:20458559 and PMID:22521957 Ppia Rat Bandrowski's base affects expression ISO PPIA (Homo sapiens) 6480464 Bandrowski's base affects the expression of PPIA mRNA CTD PMID:18202158 Ppia Rat benzo[a]pyrene increases expression ISO PPIA (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PPIA protein CTD PMID:17292933 Ppia Rat benzo[a]pyrene increases expression ISO Ppia (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PPIA mRNA CTD PMID:20127859 and PMID:22228805 Ppia Rat benzo[a]pyrene diol epoxide I increases expression ISO PPIA (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Ppia Rat beta-lapachone increases expression ISO PPIA (Homo sapiens) 6480464 beta-lapachone results in increased expression of PPIA mRNA CTD PMID:38218311 Ppia Rat bis(2-ethylhexyl) phthalate increases expression ISO Ppia (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PPIA protein CTD PMID:28934723 Ppia Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PPIA mRNA CTD PMID:25181051 and PMID:32145629 Ppia Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PPIA mRNA CTD PMID:36041667 Ppia Rat bisphenol A increases methylation ISO PPIA (Homo sapiens) 6480464 bisphenol A results in increased methylation of PPIA gene CTD PMID:31601247 Ppia Rat bisphenol A decreases expression ISO PPIA (Homo sapiens) 6480464 bisphenol A results in decreased expression of PPIA mRNA CTD PMID:33670352 Ppia Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PPIA protein CTD PMID:32145629 Ppia Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PPIA mRNA CTD PMID:30903817 Ppia Rat bisphenol A affects expression ISO PPIA (Homo sapiens) 6480464 bisphenol A affects the expression of PPIA mRNA CTD PMID:30903817 Ppia Rat bisphenol A multiple interactions ISO PPIA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PPIA mRNA CTD PMID:28628672 Ppia Rat bisphenol A decreases expression ISO Ppia (Mus musculus) 6480464 bisphenol A results in decreased expression of PPIA protein CTD PMID:24909818 and PMID:35999755 Ppia Rat bisphenol AF increases expression ISO PPIA (Homo sapiens) 6480464 bisphenol AF results in increased expression of PPIA protein CTD PMID:34186270 Ppia Rat Bisphenol B increases expression ISO PPIA (Homo sapiens) 6480464 bisphenol B results in increased expression of PPIA protein CTD PMID:34186270 Ppia Rat bisphenol F multiple interactions ISO PPIA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PPIA mRNA CTD PMID:28628672 Ppia Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PPIA mRNA CTD PMID:36041667 Ppia Rat bleomycin A2 increases expression EXP 6480464 Bleomycin results in increased expression of PPIA protein CTD PMID:25933445 Ppia Rat bucladesine multiple interactions ISO PPIA (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of PPIA mRNA CTD PMID:20823114 Ppia Rat cadmium atom increases expression ISO PPIA (Homo sapiens) 6480464 Cadmium results in increased expression of PPIA protein CTD PMID:16440303 Ppia Rat cadmium dichloride increases expression ISO PPIA (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PPIA protein CTD PMID:16440303 Ppia Rat carbamazepine affects expression ISO PPIA (Homo sapiens) 6480464 Carbamazepine affects the expression of PPIA mRNA CTD PMID:25979313 Ppia Rat carbon nanotube decreases expression ISO Ppia (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of PPIA mRNA CTD PMID:25620056 Ppia Rat chlorophyllin increases expression ISO PPIA (Homo sapiens) 6480464 chlorophyllin analog results in increased expression of PPIA protein CTD PMID:22852132 Ppia Rat chromium(6+) affects expression ISO Ppia (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PPIA mRNA CTD PMID:28472532 Ppia Rat chromium(6+) multiple interactions ISO PPIA (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of PPIA mRNA CTD PMID:38479592 Ppia Rat cisplatin increases expression ISO PPIA (Homo sapiens) 6480464 Cisplatin results in increased expression of PPIA mRNA and Cisplatin results in increased expression of PPIA protein CTD PMID:21924258 and PMID:27392435 Ppia Rat cisplatin multiple interactions ISO PPIA (Homo sapiens) 6480464 [[BSG binds to PPIA] which results in decreased susceptibility to Cisplatin] which results in increased expression of MMP9 and [BSG binds to PPIA] which results in decreased susceptibility to Cisplatin CTD PMID:21956400 Ppia Rat cobalt dichloride increases expression ISO PPIA (Homo sapiens) 6480464 cobaltous chloride results in increased expression of PPIA mRNA CTD PMID:17553155 Ppia Rat copper atom decreases expression ISO Ppia (Mus musculus) 6480464 Copper results in decreased expression of PPIA protein CTD PMID:23882024 Ppia Rat copper atom multiple interactions ISO Ppia (Mus musculus) 6480464 Trientine inhibits the reaction [Copper results in decreased secretion of PPIA protein] CTD PMID:19635393 Ppia Rat copper atom decreases secretion ISO Ppia (Mus musculus) 6480464 Copper results in decreased secretion of PPIA protein CTD PMID:19635393 Ppia Rat copper atom affects binding ISO PPIA (Homo sapiens) 6480464 PPIA protein binds to Copper CTD PMID:15359738 Ppia Rat copper atom increases expression ISO Ppia (Mus musculus) 6480464 Copper results in increased expression of PPIA protein CTD PMID:21146535 Ppia Rat copper atom multiple interactions ISO PPIA (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of PPIA mRNA and [NSC 689534 binds to Copper] which results in decreased expression of PPIA mRNA CTD PMID:20971185 and PMID:24690739 Ppia Rat copper(0) decreases expression ISO Ppia (Mus musculus) 6480464 Copper results in decreased expression of PPIA protein CTD PMID:23882024 Ppia Rat copper(0) multiple interactions ISO Ppia (Mus musculus) 6480464 Trientine inhibits the reaction [Copper results in decreased secretion of PPIA protein] CTD PMID:19635393 Ppia Rat copper(0) decreases secretion ISO Ppia (Mus musculus) 6480464 Copper results in decreased secretion of PPIA protein CTD PMID:19635393 Ppia Rat copper(0) affects binding ISO PPIA (Homo sapiens) 6480464 PPIA protein binds to Copper CTD PMID:15359738 Ppia Rat copper(0) increases expression ISO Ppia (Mus musculus) 6480464 Copper results in increased expression of PPIA protein CTD PMID:21146535 Ppia Rat copper(0) multiple interactions ISO PPIA (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of PPIA mRNA and [NSC 689534 binds to Copper] which results in decreased expression of PPIA mRNA CTD PMID:20971185 and PMID:24690739 Ppia Rat copper(II) sulfate decreases expression ISO PPIA (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PPIA mRNA CTD PMID:19549813 Ppia Rat crocidolite asbestos increases expression ISO PPIA (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of PPIA protein CTD PMID:29553831 Ppia Rat CU-O LINKAGE decreases expression ISO Ppia (Mus musculus) 6480464 cupric oxide analog results in decreased expression of PPIA protein CTD PMID:23882024 Ppia Rat cumene hydroperoxide decreases response to substance EXP 6480464 PPIA protein results in decreased susceptibility to cumene hydroperoxide CTD PMID:17011206 Ppia Rat cyclosporin A decreases expression ISO PPIA (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PPIA mRNA CTD PMID:20106945 and PMID:25562108 Ppia Rat cyclosporin A increases expression ISO PPIA (Homo sapiens) 6480464 Cyclosporine results in increased expression of PPIA mRNA CTD PMID:27989131 Ppia Rat desferrioxamine B multiple interactions ISO PPIA (Homo sapiens) 6480464 ferric ammonium citrate inhibits the reaction [Deferoxamine results in increased expression of PPIA protein] CTD PMID:19515424 Ppia Rat desferrioxamine B decreases expression ISO PPIA (Homo sapiens) 6480464 Deferoxamine results in decreased expression of PPIA protein CTD PMID:19515424 Ppia Rat dexamethasone decreases expression ISO Ppia (Mus musculus) 6480464 Dexamethasone results in decreased expression of PPIA protein CTD PMID:33567340 Ppia Rat dexamethasone multiple interactions ISO PPIA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PPIA mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PPIA mRNA CTD PMID:28628672 Ppia Rat dextran sulfate decreases expression ISO Ppia (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of PPIA protein CTD PMID:35999755 Ppia Rat diarsenic trioxide increases expression ISO PPIA (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PPIA mRNA CTD PMID:20458559 and PMID:22521957 Ppia Rat dihydroartemisinin affects binding ISO PPIA (Homo sapiens) 6480464 artenimol analog binds to PPIA protein CTD PMID:26340163 Ppia Rat disulfiram multiple interactions ISO PPIA (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of PPIA mRNA CTD PMID:24690739 Ppia Rat diuron decreases expression ISO PPIA (Homo sapiens) 6480464 Diuron results in decreased expression of PPIA mRNA CTD PMID:35967413 Ppia Rat doxorubicin increases oxidation EXP 6480464 Doxorubicin results in increased oxidation of PPIA protein CTD PMID:28818578 Ppia Rat doxorubicin increases expression ISO PPIA (Homo sapiens) 6480464 Doxorubicin results in increased expression of PPIA mRNA CTD PMID:29803840 Ppia Rat enzyme inhibitor multiple interactions ISO PPIA (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PPIA protein CTD PMID:23301498 Ppia Rat ethanol increases expression ISO Ppia (Mus musculus) 6480464 Ethanol results in increased expression of PPIA mRNA CTD PMID:30319688 Ppia Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of PPIA protein CTD PMID:33656234 Ppia Rat ferric ammonium citrate multiple interactions ISO PPIA (Homo sapiens) 6480464 ferric ammonium citrate inhibits the reaction [Deferoxamine results in increased expression of PPIA protein] CTD PMID:19515424 Ppia Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of PPIA mRNA CTD PMID:34044035 Ppia Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PPIA mRNA CTD PMID:18035473 Ppia Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PPIA mRNA CTD PMID:24136188 Ppia Rat folic acid multiple interactions ISO Ppia (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PPIA mRNA CTD PMID:22206623 Ppia Rat fumonisin B1 increases expression ISO Ppia (Mus musculus) 6480464 fumonisin B1 results in increased expression of PPIA mRNA CTD PMID:16221962 Ppia Rat furfural multiple interactions ISO PPIA (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PPIA protein CTD PMID:38598786 Ppia Rat genistein increases methylation EXP 6480464 Genistein results in increased methylation of PPIA gene CTD PMID:28505145 Ppia Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PPIA mRNA CTD PMID:22061828 Ppia Rat glyphosate decreases expression ISO Ppia (Mus musculus) 6480464 Glyphosate results in decreased expression of PPIA protein CTD PMID:37208198 Ppia Rat hyaluronic acid multiple interactions EXP 6480464 [Hyaluronic Acid analog co-treated with Hydrogen Peroxide] results in decreased expression of PPIA protein CTD PMID:23178681 Ppia Rat hyaluronic acid decreases expression EXP 6480464 Hyaluronic Acid analog results in decreased expression of PPIA protein CTD PMID:23178681 Ppia Rat hydrogen peroxide multiple interactions EXP 6480464 [Hyaluronic Acid analog co-treated with Hydrogen Peroxide] results in decreased expression of PPIA protein CTD PMID:23178681 Ppia Rat hydrogen peroxide decreases expression ISO PPIA (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of PPIA protein CTD PMID:34581912 Ppia Rat ibuprofen affects expression ISO PPIA (Homo sapiens) 6480464 Ibuprofen affects the expression of PPIA protein CTD PMID:18351690 Ppia Rat indometacin multiple interactions ISO PPIA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PPIA mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PPIA mRNA CTD PMID:28628672 Ppia Rat iodide salt decreases expression EXP 6480464 Iodides deficiency results in decreased expression of PPIA protein CTD PMID:26795019 Ppia Rat iron(III) nitrilotriacetate increases expression EXP 6480464 ferric nitrilotriacetate results in increased expression of PPIA protein CTD PMID:16908007 Ppia Rat ivermectin decreases expression ISO PPIA (Homo sapiens) 6480464 Ivermectin results in decreased expression of PPIA protein CTD PMID:32959892 Ppia Rat L-glutamic acid decreases expression EXP 6480464 Glutamic Acid results in decreased expression of PPIA mRNA CTD PMID:25797319 Ppia Rat limonene increases expression EXP 6480464 limonene results in increased expression of PPIA mRNA CTD PMID:12815608 Ppia Rat lipopolysaccharide multiple interactions ISO PPIA (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of PPIA mRNA CTD PMID:35877022 Ppia Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of PPIA protein CTD PMID:18296634 Ppia Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of PPIA protein CTD PMID:18296634 Ppia Rat medroxyprogesterone acetate multiple interactions ISO PPIA (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of PPIA mRNA CTD PMID:20823114 Ppia Rat megestrol acetate decreases expression ISO PPIA (Homo sapiens) 6480464 Megestrol Acetate results in decreased expression of PPIA protein CTD PMID:16939895 Ppia Rat mercury atom increases expression ISO PPIA (Homo sapiens) 6480464 Mercury results in increased expression of PPIA mRNA CTD PMID:16823088 Ppia Rat mercury(0) increases expression ISO PPIA (Homo sapiens) 6480464 Mercury results in increased expression of PPIA mRNA CTD PMID:16823088 Ppia Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of PPIA mRNA CTD PMID:15644446 Ppia Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PPIA mRNA CTD PMID:30047161 Ppia Rat methotrexate decreases expression ISO PPIA (Homo sapiens) 6480464 Methotrexate results in decreased expression of PPIA mRNA CTD PMID:24449571 Ppia Rat methyl methanesulfonate decreases expression ISO PPIA (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of PPIA mRNA CTD PMID:23649840 Ppia Rat morphine increases expression EXP 6480464 Morphine results in increased expression of PPIA protein CTD PMID:23056601 Ppia Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO PPIA (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of PPIA mRNA CTD PMID:15857753 Ppia Rat N-ethyl-N-nitrosourea increases expression EXP 6480464 Ethylnitrosourea results in increased expression of PPIA mRNA CTD PMID:15954086 Ppia Rat N-methyl-4-phenylpyridinium increases expression ISO PPIA (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PPIA protein CTD PMID:24675778 Ppia Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of PPIA mRNA CTD PMID:14965361 Ppia Rat nickel sulfate affects expression ISO PPIA (Homo sapiens) 6480464 nickel sulfate affects the expression of PPIA mRNA CTD PMID:18202158 Ppia Rat nitrates multiple interactions ISO Ppia (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PPIA mRNA CTD PMID:35964746 Ppia Rat Nutlin-3 multiple interactions ISO PPIA (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PPIA protein CTD PMID:38460933 Ppia Rat okadaic acid decreases expression ISO PPIA (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of PPIA protein CTD PMID:19397276 Ppia Rat okadaic acid increases expression ISO PPIA (Homo sapiens) 6480464 Okadaic Acid results in increased expression of PPIA mRNA CTD PMID:28939011 Ppia Rat ozone multiple interactions ISO Ppia (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PPIA mRNA CTD PMID:34911549 Ppia Rat paracetamol affects expression ISO Ppia (Mus musculus) 6480464 Acetaminophen affects the expression of PPIA mRNA CTD PMID:17562736 Ppia Rat paracetamol increases secretion ISO Ppia (Mus musculus) 6480464 Acetaminophen results in increased secretion of PPIA protein CTD PMID:24038040 Ppia Rat paraquat increases expression ISO PPIA (Homo sapiens) 6480464 Paraquat results in increased expression of PPIA protein CTD PMID:34064677 Ppia Rat perfluorohexanesulfonic acid increases expression ISO Ppia (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of PPIA mRNA CTD PMID:37995155 Ppia Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ppia (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PPIA mRNA CTD PMID:36331819 Ppia Rat picoxystrobin increases expression ISO PPIA (Homo sapiens) 6480464 picoxystrobin results in increased expression of PPIA mRNA CTD PMID:33512557 Ppia Rat potassium dichromate increases expression EXP 6480464 Potassium Dichromate results in increased expression of PPIA protein CTD PMID:18563748 Ppia Rat Propiverine affects binding EXP 6480464 propiverine binds to PPIA protein CTD PMID:29273565 Ppia Rat quercetin increases expression ISO PPIA (Homo sapiens) 6480464 Quercetin results in increased expression of PPIA mRNA and Quercetin results in increased expression of PPIA protein CTD PMID:17292933 and PMID:21632981 Ppia Rat Rebamipide increases expression EXP 6480464 rebamipide results in increased expression of PPIA mRNA CTD PMID:18299717 Ppia Rat rotenone increases expression ISO PPIA (Homo sapiens) 6480464 Rotenone results in increased expression of PPIA mRNA CTD PMID:33512557 Ppia Rat silicon dioxide affects secretion ISO PPIA (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of PPIA protein CTD PMID:25895662 Ppia Rat sodium arsenite increases expression ISO PPIA (Homo sapiens) 6480464 sodium arsenite results in increased expression of PPIA mRNA CTD PMID:28595984 and PMID:34032870 Ppia Rat sodium arsenite decreases expression ISO PPIA (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PPIA mRNA CTD PMID:38568856 Ppia Rat sodium chloride multiple interactions ISO PPIA (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PPIA protein more ... CTD PMID:38598786 Ppia Rat sodium fluoride decreases expression ISO Ppia (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of PPIA protein CTD PMID:27548804 Ppia Rat sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of PPIA protein CTD PMID:29653260 Ppia Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PPIA mRNA CTD PMID:30047161 Ppia Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of PPIA protein CTD PMID:26141394 Ppia Rat tamoxifen decreases expression ISO PPIA (Homo sapiens) 6480464 Tamoxifen results in decreased expression of PPIA protein CTD PMID:17098229 Ppia Rat tamoxifen multiple interactions ISO PPIA (Homo sapiens) 6480464 [Tretinoin co-treated with Tamoxifen] results in decreased expression of PPIA protein CTD PMID:17098229 Ppia Rat temozolomide decreases expression ISO PPIA (Homo sapiens) 6480464 Temozolomide results in decreased expression of PPIA mRNA CTD PMID:31758290 Ppia Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of CYCA mRNA CTD PMID:22563491 Ppia Rat thimerosal decreases expression ISO PPIA (Homo sapiens) 6480464 Thimerosal results in decreased expression of PPIA mRNA CTD PMID:27188386 Ppia Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PPIA mRNA CTD PMID:34492290 Ppia Rat thiram decreases expression ISO PPIA (Homo sapiens) 6480464 Thiram results in decreased expression of PPIA mRNA CTD PMID:38568856 Ppia Rat titanium dioxide increases methylation ISO Ppia (Mus musculus) 6480464 titanium dioxide results in increased methylation of PPIA gene CTD PMID:35295148 Ppia Rat titanium dioxide decreases methylation ISO Ppia (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PPIA promoter CTD PMID:35295148 Ppia Rat torcetrapib increases expression ISO PPIA (Homo sapiens) 6480464 torcetrapib results in increased expression of PPIA mRNA CTD PMID:19164467 and PMID:23228038 Ppia Rat trichostatin A multiple interactions ISO PPIA (Homo sapiens) 6480464 [trichostatin A co-treated with decitabine] results in decreased expression of PPIA protein CTD PMID:19294695 Ppia Rat uranium atom affects expression ISO PPIA (Homo sapiens) 6480464 Uranium affects the expression of PPIA mRNA CTD PMID:15672453 Ppia Rat valproic acid affects expression ISO PPIA (Homo sapiens) 6480464 Valproic Acid affects the expression of PPIA mRNA CTD PMID:25979313 Ppia Rat valproic acid decreases expression ISO PPIA (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PPIA mRNA CTD PMID:29154799 Ppia Rat vorinostat increases expression ISO PPIA (Homo sapiens) 6480464 vorinostat results in increased expression of PPIA protein CTD PMID:20543569 Ppia Rat zinc atom decreases expression ISO PPIA (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of PPIA mRNA CTD PMID:18356318 and PMID:22171008 Ppia Rat zinc(0) decreases expression ISO PPIA (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of PPIA mRNA CTD PMID:18356318 and PMID:22171008
(+)-catechin (ISO) (1->4)-beta-D-glucan (ISO) (R,R,R)-alpha-tocopherol (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2,2-tetramine (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,6-dimethoxyphenol (ISO) 2-amino-2-deoxy-D-galactopyranose (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) actinomycin D (ISO) all-trans-retinoic acid (ISO) alprazolam (ISO) ammonium chloride (EXP) arsenite(3-) (ISO) arsenous acid (ISO) Bandrowski's base (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) bleomycin A2 (EXP) bucladesine (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbamazepine (ISO) carbon nanotube (ISO) chlorophyllin (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) cumene hydroperoxide (EXP) cyclosporin A (ISO) desferrioxamine B (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dihydroartemisinin (ISO) disulfiram (ISO) diuron (ISO) doxorubicin (EXP,ISO) enzyme inhibitor (ISO) ethanol (ISO) fenvalerate (EXP) ferric ammonium citrate (ISO) fipronil (EXP) flavonoids (EXP) flutamide (EXP) folic acid (ISO) fumonisin B1 (ISO) furfural (ISO) genistein (EXP) gentamycin (EXP) glyphosate (ISO) hyaluronic acid (EXP) hydrogen peroxide (EXP,ISO) ibuprofen (ISO) indometacin (ISO) iodide salt (EXP) iron(III) nitrilotriacetate (EXP) ivermectin (ISO) L-glutamic acid (EXP) limonene (EXP) lipopolysaccharide (ISO) lithium atom (EXP) lithium hydride (EXP) medroxyprogesterone acetate (ISO) megestrol acetate (ISO) mercury atom (ISO) mercury(0) (ISO) methamphetamine (EXP) methimazole (EXP) methotrexate (ISO) methyl methanesulfonate (ISO) morphine (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-ethyl-N-nitrosourea (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) nickel sulfate (ISO) nitrates (ISO) Nutlin-3 (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (ISO) paraquat (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) picoxystrobin (ISO) potassium dichromate (EXP) Propiverine (EXP) quercetin (ISO) Rebamipide (EXP) rotenone (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium fluoride (EXP,ISO) sulfadimethoxine (EXP) T-2 toxin (EXP) tamoxifen (ISO) temozolomide (ISO) tetrachloromethane (EXP) thimerosal (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) torcetrapib (ISO) trichostatin A (ISO) uranium atom (ISO) valproic acid (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
activation of protein kinase B activity (ISO,ISS) apoptotic process (IEA,ISO,ISS) cell adhesion molecule production (ISO,ISS) cellular response to oxidative stress (ISO,ISS) endothelial cell activation (ISO,ISS) leukocyte chemotaxis (ISO,ISS) lipid droplet organization (ISO) negative regulation of calcineurin-mediated signaling (IDA) negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway (ISO,ISS) negative regulation of protein K48-linked ubiquitination (ISO,ISS) negative regulation of protein kinase activity (ISO,ISS) negative regulation of protein phosphorylation (ISO,ISS) negative regulation of stress-activated MAPK cascade (ISO,ISS) negative regulation of viral life cycle (ISO) neuron differentiation (ISO) neutrophil chemotaxis (ISO,ISS) platelet activation (ISO,ISS) platelet aggregation (ISO,ISS) positive regulation of MAPK cascade (ISO,ISS) positive regulation of NF-kappaB transcription factor activity (ISO,ISS) positive regulation of protein phosphorylation (ISO,ISS) positive regulation of protein secretion (ISO) positive regulation of viral genome replication (ISO) protein folding (IBA,IEA) protein peptidyl-prolyl isomerization (ISO,ISS) regulation of apoptotic signaling pathway (ISO,ISS) regulation of viral genome replication (ISO,ISS)
1.
Regulatory polymorphisms in the cyclophilin A gene, PPIA, accelerate progression to AIDS.
An P, etal., PLoS Pathog. 2007 Jun;3(6):e88. doi: 10.1371/journal.ppat.0030088.
2.
Cyclophillin A deficiency accelerates RML-induced prion disease.
Bouybayoune I, etal., Neurobiol Dis. 2019 Oct;130:104498. doi: 10.1016/j.nbd.2019.104498. Epub 2019 Jun 8.
3.
p1B15: a cDNA clone of the rat mRNA encoding cyclophilin.
Danielson PE, etal., DNA 1988 May;7(4):261-7.
4.
Concentrations of Serum Cyclophilin A in Patients With Bell Palsy.
Demir B, etal., J Craniofac Surg. 2020 Jun;31(4):e368-e370. doi: 10.1097/SCS.0000000000006308.
5.
Completion of the entire hepatitis C virus life cycle in genetically humanized mice.
Dorner M, etal., Nature. 2013 Sep 12;501(7466):237-41. doi: 10.1038/nature12427. Epub 2013 Jul 31.
6.
Evaluation of gingival crevicular fluid cyclophilin a and extracellular matrix metalloproteinase inducer levels in different periodontal diseases.
Eren G, etal., Arch Oral Biol. 2016 Aug;68:162-6. doi: 10.1016/j.archoralbio.2016.05.004. Epub 2016 May 4.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Clonorchis sinensis cyclophilin A immunization protected mice from CLP-induced sepsis.
Jiang J, etal., Int Immunopharmacol. 2018 Jun;59:347-353. doi: 10.1016/j.intimp.2018.03.039. Epub 2018 Apr 19.
9.
Cyclophilin A protects mice against infection by influenza A virus.
Li J, etal., Sci Rep. 2016 Jun 29;6:28978. doi: 10.1038/srep28978.
10.
Exosomal cyclophilin A as a novel noninvasive biomarker for Epstein-Barr virus associated nasopharyngeal carcinoma.
Liu L, etal., Cancer Med. 2019 Jun;8(6):3142-3151. doi: 10.1002/cam4.2185. Epub 2019 May 7.
11.
Cyclophilin A-regulated ubiquitination is critical for RIG-I-mediated antiviral immune responses.
Liu W, etal., Elife. 2017 Jun 8;6. doi: 10.7554/eLife.24425.
12.
Uncaria rhynchophylla upregulates the expression of MIF and cyclophilin A in kainic acid-induced epilepsy rats: A proteomic analysis.
Lo WY, etal., Am J Chin Med. 2010;38(4):745-59.
13.
Mitochondrial targeting of cyclosporin A enables selective inhibition of cyclophilin-D and enhanced cytoprotection after glucose and oxygen deprivation.
Malouitre S, etal., Biochem J. 2009 Dec 14;425(1):137-48. doi: 10.1042/BJ20090332.
14.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
15.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.
Cyclophilin A enhances cell proliferation and tumor growth of liver fluke-associated cholangiocarcinoma.
Obchoei S, etal., Mol Cancer. 2011 Aug 26;10:102. doi: 10.1186/1476-4598-10-102.
17.
GOA pipeline
RGD automated data pipeline
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
Cyclophilin A affects inflammation, virus elimination and myocardial fibrosis in coxsackievirus B3-induced myocarditis.
Seizer P, etal., J Mol Cell Cardiol. 2012 Jul;53(1):6-14. doi: 10.1016/j.yjmcc.2012.03.004. Epub 2012 Mar 15.
20.
P31, a mammalian housekeeping protein encoded by a multigene family containing a high proportion of pseudogenes.
Theodor L, etal., Biochim Biophys Acta 1985 Nov 13;826(2-3):137-46.
Ppia Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 85,491,223 - 85,496,884 (+) NCBI GRCr8 mRatBN7.2 14 81,279,292 - 81,282,960 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 81,275,091 - 81,299,601 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 85,680,216 - 85,683,897 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 86,920,016 - 86,923,697 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 83,369,616 - 83,373,297 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 86,673,775 - 86,677,443 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 86,673,775 - 86,677,443 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 80,306,923 - 80,310,652 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 87,165,998 - 87,169,995 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 87,185,142 - 87,189,140 (+) NCBI Celera 14 80,161,152 - 80,164,810 (+) NCBI Celera Cytogenetic Map 14 q21 NCBI
PPIA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 44,796,681 - 44,803,117 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 44,796,680 - 44,824,564 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 44,836,280 - 44,842,716 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 44,802,766 - 44,809,241 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 44,609,504 - 44,615,343 NCBI Celera 7 44,935,095 - 44,941,571 (+) NCBI Celera Cytogenetic Map 7 p13 NCBI HuRef 7 44,721,292 - 44,727,768 (+) NCBI HuRef CHM1_1 7 44,840,586 - 44,847,069 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 44,957,232 - 44,963,670 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 44,875,748 - 44,882,224 (+) NCBI
Ppia Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 6,365,867 - 6,369,817 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 6,365,443 - 6,369,817 (+) Ensembl GRCm39 Ensembl GRCm38 11 6,415,867 - 6,419,817 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 6,415,443 - 6,419,817 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 6,315,873 - 6,319,813 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 6,315,873 - 6,319,813 (+) NCBI MGSCv36 mm8 Celera 11 6,899,520 - 6,903,460 (+) NCBI Celera Cytogenetic Map 11 A1 NCBI cM Map 11 3.97 NCBI
Ppia Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955456 7,381,923 - 7,383,203 (-) NCBI ChiLan1.0 ChiLan1.0
PPIA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 49,708,848 - 49,714,864 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 98,034,551 - 98,039,602 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 45,510,450 - 45,515,448 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 45,578,764 - 45,583,516 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 45,578,765 - 45,605,545 (+) Ensembl panpan1.1 panPan2
LOC403581 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 80,937,433 - 80,938,175 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 7 81,027,063 - 81,027,805 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 7 80,741,873 - 80,742,615 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 64,379,529 - 64,380,271 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 81,058,591 - 81,059,333 (-) NCBI UU_Cfam_GSD_1.0
Ppia Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 100,457,966 - 100,461,621 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936478 19,669,506 - 19,673,398 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936478 19,669,727 - 19,673,355 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PPIA
PPIA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 13,876,099 - 13,883,546 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 13,876,099 - 13,883,462 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666062 8,652,515 - 8,658,073 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ppia
.
Predicted Target Of
Count of predictions: 26 Count of miRNA genes: 22 Interacting mature miRNAs: 26 Transcripts: ENSRNOT00000009179 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313089 Bss81 Bone structure and strength QTL 81 3.4 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 14 37669719 82669719 Rat 9590294 Uminl4 Urine mineral level QTL 4 5.66 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 14 55624247 100624247 Rat 1582236 Gluco22 Glucose level QTL 22 3.3 0.0164 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 73415323 92554092 Rat 631213 Bw60 Body weight QTL60 4.51 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 14 79950921 95876975 Rat 2300197 Scl59 Serum cholesterol level QTL 59 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 55147478 100147478 Rat 70153 Bp59 Blood pressure QTL 59 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 14 68757796 83368335 Rat 631523 Pia13 Pristane induced arthritis QTL 13 3.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 40793460 98037301 Rat 1582259 Gluco23 Glucose level QTL 23 3.1 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 70053989 104886043 Rat 1582197 Gluco27 Glucose level QTL 27 3.4 0.0006 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 73415323 92554092 Rat 2313100 Bss82 Bone structure and strength QTL 82 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 14 37669719 82669719 Rat 634328 Hc5 Hypercalciuria QTL 5 2.3 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 14 58184885 103184885 Rat 1582250 Gluco26 Glucose level QTL 26 3.3 0.0009 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 73415323 95876975 Rat 2317879 Alcrsp27 Alcohol response QTL 27 3.3 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 14 56631369 101631369 Rat 1641900 Alcrsp11 Alcohol response QTL 11 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 14 70053989 104886043 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 1582255 Gluco29 Glucose level QTL 29 3.1 0.0025 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 14 73415323 92554092 Rat 9589034 Epfw11 Epididymal fat weight QTL 11 6 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 14 55624247 100624247 Rat 1582209 Gluco20 Glucose level QTL 20 3.8 0.0005 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 73415323 92554092 Rat 2313048 Bss84 Bone structure and strength QTL 84 3.1 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 14 37669719 82669719 Rat 1300136 Rf22 Renal function QTL 22 3.9 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 14 42262529 95023211 Rat 1549834 Scl45 Serum cholesterol level QTL 45 5.8 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 50023211 95023211 Rat 738037 Hcas6 Hepatocarcinoma susceptibility QTL 6 2.93 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 14 39057237 83368335 Rat 2313084 Bss83 Bone structure and strength QTL 83 2.9 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 14 37669719 82669719 Rat
UniSTS:265677
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 21,006,765 - 21,007,058 (+) MAPPER mRatBN7.2 mRatBN7.2 4 41,829,100 - 41,829,392 (+) MAPPER mRatBN7.2 Rnor_6.0 14 22,707,130 - 22,707,422 NCBI Rnor6.0 Rnor_5.0 14 22,609,939 - 22,610,231 UniSTS Rnor5.0 RGSC_v3.4 14 22,613,076 - 22,613,368 UniSTS RGSC3.4 Cytogenetic Map 14 q21 UniSTS
Ppia
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 21,006,634 - 21,006,784 (+) MAPPER mRatBN7.2 Rnor_6.0 14 22,706,999 - 22,707,148 NCBI Rnor6.0 Rnor_5.0 14 22,609,808 - 22,609,957 UniSTS Rnor5.0 Cytogenetic Map 14 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
22
86
164
114
120
82
38
82
320
146
148
70
82
38
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000038275
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 81,278,349 - 81,282,951 (+) Ensembl Rnor_6.0 Ensembl 14 86,675,818 - 86,677,438 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000079015 ⟹ ENSRNOP00000071920
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 81,278,928 - 81,299,601 (+) Ensembl Rnor_6.0 Ensembl 14 86,673,817 - 86,677,237 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000091873 ⟹ ENSRNOP00000073930
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 81,275,091 - 81,282,954 (+) Ensembl Rnor_6.0 Ensembl 14 86,673,775 - 86,677,443 (+) Ensembl
RefSeq Acc Id:
NM_017101 ⟹ NP_058797
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,493,216 - 85,496,884 (+) NCBI mRatBN7.2 14 81,279,292 - 81,282,960 (+) NCBI Rnor_6.0 14 86,673,775 - 86,677,443 (+) NCBI Rnor_5.0 14 80,306,923 - 80,310,652 (+) NCBI RGSC_v3.4 14 87,165,998 - 87,169,995 (+) RGD Celera 14 80,161,152 - 80,164,810 (+) RGD
Sequence:
CTTTGCAGACGCCGCTGTCTCTTTTCGCCGCTTGCTGCAGACATGGTCAACCCCACCGTGTTCTTCGACATCACGGCTGATGGCGAGCCCTTGGGTCGCGTCTGCTTCGAGCTGTTTGCAGACAAAGT
hide sequence
RefSeq Acc Id:
XM_017599085 ⟹ XP_017454574
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,491,223 - 85,495,360 (+) NCBI mRatBN7.2 14 81,279,733 - 81,282,959 (+) NCBI Rnor_6.0 14 86,674,258 - 86,677,443 (+) NCBI
Sequence:
CTTCCCCGAGCCGCTGCCTTTTAATCGGGGCTGGGTAGGAACTCTGCCTAAGGTCCAAGGACGAAGGTTCGGTGAAGCCGCTGTTTGCAGACAAAGTTCCAAAGACAGCAGAAAACTTTCGTGCTCTG
hide sequence
RefSeq Acc Id:
NP_058797 ⟸ NM_017101
- UniProtKB:
P18303 (UniProtKB/Swiss-Prot), Q5BK98 (UniProtKB/Swiss-Prot), P10111 (UniProtKB/Swiss-Prot), A6IKU0 (UniProtKB/TrEMBL), A6IKT9 (UniProtKB/TrEMBL)
- Sequence:
MVNPTVFFDITADGEPLGRVCFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVV
hide sequence
RefSeq Acc Id:
XP_017454574 ⟸ XM_017599085
- Peptide Label:
isoform X1
- Sequence:
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDG
hide sequence
Ensembl Acc Id:
ENSRNOP00000071920 ⟸ ENSRNOT00000079015
Ensembl Acc Id:
ENSRNOP00000073930 ⟸ ENSRNOT00000091873
RGD ID: 13699474 Promoter ID: EPDNEW_R9998 Type: multiple initiation site Name: Ppia_1 Description: peptidylprolyl isomerase A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 86,673,774 - 86,673,834 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-21
Ppia
peptidylprolyl isomerase A
Ppia
peptidylprolyl isomerase A (cyclophilin A)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-24
Ppia
peptidylprolyl isomerase A (cyclophilin A)
Ppia
peptidylprolyl isomerase A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Ppia
Peptidylprolyl isomerase A (cyclophilin A)
Symbol and Name status set to approved
70586 APPROVED
