Symbol:
Fst
Name:
follistatin
RGD ID:
2633
Description:
Enables heparan sulfate proteoglycan binding activity. Involved in cellular response to growth factor stimulus. Predicted to be located in cytoplasm and nucleus. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in polycystic ovary syndrome. Orthologous to human FST (follistatin); PARTICIPATES IN Bone morphogenetic proteins signaling pathway; transforming growth factor-beta superfamily mediated signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
activin-binding protein; FOL1; follistatin-A; FS; Fst-288; LOC686745; RATFOL1; similar to follistatin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FST (follistatin)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Fst (follistatin)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fst (follistatin)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FST (follistatin)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FST (follistatin)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fst (follistatin)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FST (follistatin)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FST (follistatin)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fst (follistatin)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Fst (follistatin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
FST (follistatin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fstb (follistatin b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
fsta (follistatin a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Fs
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fst
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Is Marker For:
Strains:
SHRSP.WKY-(D2Rat13-D2Rat157 )/Gcrc
WKY.SHRSP-(Fst-Pklr )/Gcrc
SHRSP.WKY-(D2Rat13-D2Mit5 )/Gcrc
QTLs:
Bp132
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 47,856,345 - 47,863,670 (-) NCBI GRCr8 mRatBN7.2 2 46,123,260 - 46,130,584 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 46,123,439 - 46,130,571 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 53,226,536 - 53,233,459 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 51,284,901 - 51,291,822 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 46,164,805 - 46,171,742 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 46,537,589 - 46,544,813 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 46,538,700 - 46,544,457 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 65,576,721 - 65,583,918 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 46,542,246 - 46,550,678 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 46,470,478 - 46,478,911 (-) NCBI Celera 2 41,883,386 - 41,889,989 (-) NCBI Celera Cytogenetic Map 2 q14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fst Rat 1-Hydroxypyrene multiple interactions ISO RGD:734008 6480464 [Polycyclic Aromatic Hydrocarbons results in increased abundance of 1-hydroxypyrene] which results in increased expression of more ... CTD PMID:31228248 Fst Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of FST mRNA CTD PMID:30723492 Fst Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of FST mRNA CTD PMID:12655037|PMID:15834898|PMID:17351261|PMID:17557909 Fst Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of FST mRNA CTD PMID:16551644|PMID:26865667 Fst Rat 17beta-estradiol affects expression ISO RGD:734008 6480464 Estradiol affects the expression of FST mRNA CTD PMID:14699072 Fst Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of FST mRNA CTD PMID:32145629 Fst Rat 17beta-estradiol multiple interactions ISO RGD:10603 6480464 [Estradiol co-treated with Progesterone co-treated with Corn Oil] results in increased expression of FST mRNA CTD PMID:32186404 Fst Rat 17beta-estradiol multiple interactions ISO RGD:734008 6480464 Estradiol inhibits the reaction [Fulvestrant results in increased expression of FST mRNA]; Fulvestrant inhibits the more ... CTD PMID:31646340 Fst Rat 17beta-estradiol increases expression ISO RGD:734008 6480464 Estradiol results in increased expression of FST mRNA CTD PMID:31646340 Fst Rat 17beta-estradiol increases expression ISO RGD:10603 6480464 Estradiol results in increased expression of FST mRNA CTD PMID:19484750|PMID:39298647 Fst Rat 17beta-estradiol decreases expression ISO RGD:10603 6480464 Estradiol results in decreased expression of FST mRNA; Estradiol results in decreased expression of FST more ... CTD PMID:22285243|PMID:23144751 Fst Rat 17beta-estradiol decreases expression ISO RGD:734008 6480464 Estradiol results in decreased expression of FST mRNA CTD PMID:16298037 Fst Rat 17beta-hydroxy-5alpha-androstan-3-one decreases expression ISO RGD:10603 6480464 Dihydrotestosterone results in decreased expression of FST mRNA CTD PMID:17023530 Fst Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:734008 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of FST mRNA] CTD PMID:11007951 Fst Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of FST mRNA CTD PMID:34747641 Fst Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:10603 6480464 Tetrachlorodibenzodioxin results in decreased expression of FST mRNA CTD PMID:19770486|PMID:19933214|PMID:26290441 Fst Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of FST mRNA]; AHR more ... CTD PMID:23196670 Fst Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of FST mRNA CTD PMID:23196670|PMID:32109520 Fst Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:10603 6480464 Tetrachlorodibenzodioxin affects the expression of FST mRNA CTD PMID:21570461 Fst Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:734008 6480464 Tetrachlorodibenzodioxin results in decreased expression of FST mRNA CTD PMID:20106945|PMID:21632981 Fst Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:10603 6480464 Tetrachlorodibenzodioxin results in increased expression of FST mRNA CTD PMID:17586704 Fst Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:734008 6480464 Tetrachlorodibenzodioxin results in increased expression of FST mRNA; Tetrachlorodibenzodioxin results in increased expression of FST more ... CTD PMID:11007951|PMID:16083274 Fst Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of FST mRNA CTD PMID:32109520 Fst Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:10603 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of FST mRNA CTD PMID:38648751 Fst Rat 2-hydroxypropanoic acid increases expression ISO RGD:734008 6480464 Lactic Acid results in increased expression of FST mRNA CTD PMID:30851411 Fst Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of FST mRNA CTD PMID:23196670 Fst Rat 3-Hydroxybenzo[a]pyrene multiple interactions ISO RGD:734008 6480464 [Polycyclic Aromatic Hydrocarbons results in increased abundance of 3-hydroxybenzo(a)pyrene] which results in increased expression of more ... CTD PMID:31228248 Fst Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:734008 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Fst Rat 3-methylcholanthrene decreases expression ISO RGD:10603 6480464 Methylcholanthrene results in decreased expression of FST mRNA CTD PMID:20713471 Fst Rat 3-Nitrobenzanthrone increases expression ISO RGD:734008 6480464 3-nitrobenzanthrone results in increased expression of FST mRNA CTD PMID:34036453 Fst Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:10603 6480464 4,4'-diaminodiphenylmethane results in decreased expression of FST mRNA CTD PMID:18648102 Fst Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4,4'-diaminodiphenylmethane results in increased expression of FST mRNA CTD PMID:30723492 Fst Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:10603 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of FST mRNA CTD PMID:30951980 Fst Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:10603 6480464 bisphenol S results in decreased expression of FST mRNA CTD PMID:39298647 Fst Rat 5-aza-2'-deoxycytidine increases expression ISO RGD:10603 6480464 Decitabine results in increased expression of FST mRNA CTD PMID:27915011 Fst Rat 5-aza-2'-deoxycytidine increases expression ISO RGD:734008 6480464 Decitabine results in increased expression of FST mRNA CTD PMID:16367923 Fst Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of FST mRNA CTD PMID:24780913 Fst Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of FST mRNA CTD PMID:31881176 Fst Rat acetylsalicylic acid affects expression EXP 6480464 Aspirin affects the expression of FST mRNA CTD PMID:12800193 Fst Rat aflatoxin B1 increases expression ISO RGD:734008 6480464 Aflatoxin B1 results in increased expression of FST mRNA CTD PMID:21641981|PMID:32234424 Fst Rat aflatoxin B1 decreases methylation ISO RGD:734008 6480464 Aflatoxin B1 results in decreased methylation of FST gene CTD PMID:27153756 Fst Rat all-trans-retinoic acid decreases expression ISO RGD:10603 6480464 Tretinoin results in decreased expression of FST mRNA CTD PMID:16604517 Fst Rat all-trans-retinoic acid multiple interactions ISO RGD:10603 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of FST mRNA; [bisphenol F co-treated more ... CTD PMID:30951980 Fst Rat all-trans-retinoic acid decreases expression ISO RGD:734008 6480464 Tretinoin results in decreased expression of FST mRNA CTD PMID:21934132 Fst Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of FST mRNA CTD PMID:16483693 Fst Rat antirheumatic drug increases expression ISO RGD:734008 6480464 Antirheumatic Agents results in increased expression of FST mRNA CTD PMID:24449571 Fst Rat Archazolid B decreases expression ISO RGD:734008 6480464 archazolid B results in decreased expression of FST mRNA CTD PMID:25218289 Fst Rat arsane multiple interactions ISO RGD:734008 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FST more ... CTD PMID:39836092 Fst Rat arsenic atom multiple interactions ISO RGD:734008 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FST more ... CTD PMID:39836092 Fst Rat arsenite(3-) multiple interactions ISO RGD:10603 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of FST mRNA CTD PMID:15894712 Fst Rat arsenite(3-) multiple interactions ISO RGD:734008 6480464 arsenite inhibits the reaction [Fulvestrant results in increased expression of FST mRNA]; Fulvestrant inhibits the more ... CTD PMID:31646340 Fst Rat arsenite(3-) increases expression ISO RGD:734008 6480464 arsenite results in increased expression of FST mRNA CTD PMID:31646340 Fst Rat arsenite(3-) decreases expression ISO RGD:734008 6480464 arsenite results in decreased expression of FST mRNA CTD PMID:23974009 Fst Rat arsenite(3-) increases methylation ISO RGD:734008 6480464 arsenite results in increased methylation of FST promoter CTD PMID:23974009 Fst Rat arsenite(3-) decreases expression ISO RGD:10603 6480464 arsenite results in decreased expression of FST mRNA CTD PMID:15894712 Fst Rat arsenous acid multiple interactions ISO RGD:734008 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to FST protein] CTD PMID:26598702 Fst Rat atrazine multiple interactions ISO RGD:734008 6480464 [Atrazine co-treated with Arsenates] results in increased expression of FST mRNA CTD PMID:18585445 Fst Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of FST mRNA CTD PMID:36841081 Fst Rat azathioprine increases expression ISO RGD:734008 6480464 Azathioprine results in increased expression of FST mRNA CTD PMID:22623647 Fst Rat Azoxymethane multiple interactions ISO RGD:10603 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FST more ... CTD PMID:29950665 Fst Rat benzo[a]pyrene multiple interactions ISO RGD:10603 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of FST mRNA CTD PMID:15894712 Fst Rat benzo[a]pyrene increases expression ISO RGD:734008 6480464 Benzo(a)pyrene results in increased expression of FST mRNA CTD PMID:20106945|PMID:21632981|PMID:21871943|PMID:22316170|PMID:26238291|PMID:32234424 Fst Rat benzo[a]pyrene decreases expression ISO RGD:734008 6480464 Benzo(a)pyrene results in decreased expression of FST mRNA CTD PMID:22178795 Fst Rat benzo[a]pyrene decreases expression ISO RGD:10603 6480464 Benzo(a)pyrene results in decreased expression of FST mRNA CTD PMID:15894712|PMID:19770486|PMID:22228805 Fst Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of FST mRNA CTD PMID:21839799 Fst Rat benzo[a]pyrene increases expression ISO RGD:10603 6480464 Benzo(a)pyrene results in increased expression of FST mRNA CTD PMID:21569818 Fst Rat benzo[a]pyrene diol epoxide I increases expression ISO RGD:734008 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of FST mRNA CTD PMID:19150397|PMID:26238291 Fst Rat Benzo[k]fluoranthene increases expression ISO RGD:10603 6480464 benzo(k)fluoranthene results in increased expression of FST mRNA CTD PMID:26377693 Fst Rat bis(2-chloroethyl) sulfide increases expression ISO RGD:10603 6480464 Mustard Gas results in increased expression of FST mRNA CTD PMID:15674843 Fst Rat bis(2-chloroethyl) sulfide decreases expression ISO RGD:734008 6480464 Mustard Gas results in decreased expression of FST mRNA CTD PMID:25102026 Fst Rat bis(2-ethylhexyl) phthalate affects expression ISO RGD:10603 6480464 Diethylhexyl Phthalate affects the expression of FST mRNA CTD PMID:27495896 Fst Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:10603 6480464 Diethylhexyl Phthalate results in increased expression of FST mRNA CTD PMID:33754040 Fst Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:10603 6480464 Diethylhexyl Phthalate results in decreased expression of FST mRNA; Diethylhexyl Phthalate results in decreased expression more ... CTD PMID:27495896|PMID:33754040 Fst Rat bisphenol A affects expression ISO RGD:734008 6480464 bisphenol A affects the expression of FST mRNA CTD PMID:20170705|PMID:30903817 Fst Rat bisphenol A decreases expression ISO RGD:10603 6480464 bisphenol A results in decreased expression of FST mRNA CTD PMID:37105096 Fst Rat bisphenol A multiple interactions ISO RGD:10603 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of FST mRNA CTD PMID:30951980 Fst Rat bisphenol A decreases expression ISO RGD:734008 6480464 bisphenol A results in decreased expression of FST mRNA CTD PMID:29275510 Fst Rat bisphenol A multiple interactions ISO RGD:734008 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Fst Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FST mRNA CTD PMID:25181051|PMID:32145629 Fst Rat bisphenol F multiple interactions ISO RGD:734008 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Fst Rat bisphenol F increases expression ISO RGD:10603 6480464 bisphenol F results in increased expression of FST mRNA CTD PMID:36706583 Fst Rat bisphenol F multiple interactions ISO RGD:10603 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of FST mRNA CTD PMID:30951980 Fst Rat buta-1,3-diene increases expression ISO RGD:10603 6480464 1,3-butadiene results in increased expression of FST mRNA CTD PMID:29038090 Fst Rat butan-1-ol multiple interactions ISO RGD:734008 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Fst Rat butyric acid decreases expression EXP 6480464 Butyric Acid results in decreased expression of FST mRNA CTD PMID:12800193 Fst Rat cadmium atom decreases expression ISO RGD:734008 6480464 Cadmium results in decreased expression of FST mRNA CTD PMID:24376830 Fst Rat cadmium atom increases expression ISO RGD:734008 6480464 Cadmium results in increased expression of FST mRNA CTD PMID:31646340 Fst Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of FST promoter CTD PMID:22457795 Fst Rat calciol increases expression ISO RGD:10603 6480464 Cholecalciferol results in increased expression of FST mRNA CTD PMID:17170073 Fst Rat calcitriol multiple interactions ISO RGD:734008 6480464 FST protein inhibits the reaction [Calcitriol results in decreased expression of CLEC3B mRNA]; FST protein more ... CTD PMID:23589129 Fst Rat calcitriol decreases expression ISO RGD:734008 6480464 Calcitriol results in decreased expression of FST protein CTD PMID:23589129 Fst Rat carbon nanotube increases expression ISO RGD:734008 6480464 Nanotubes, Carbon results in increased expression of FST mRNA CTD PMID:24389112 Fst Rat carbon nanotube increases expression ISO RGD:10603 6480464 Nanotubes, Carbon results in increased expression of FST mRNA CTD PMID:25554681 Fst Rat carbon nanotube affects expression ISO RGD:10603 6480464 Nanotubes, Carbon analog affects the expression of FST mRNA CTD PMID:25554681 Fst Rat chloropicrin decreases expression ISO RGD:734008 6480464 chloropicrin results in decreased expression of FST mRNA CTD PMID:28476498 Fst Rat chloropicrin affects expression ISO RGD:734008 6480464 chloropicrin affects the expression of FST mRNA CTD PMID:26352163 Fst Rat chloroprene increases expression ISO RGD:10603 6480464 Chloroprene results in increased expression of FST mRNA CTD PMID:23125180 Fst Rat chlorpyrifos decreases expression ISO RGD:10603 6480464 Chlorpyrifos results in decreased expression of FST mRNA CTD PMID:37019170 Fst Rat chromium(6+) affects expression ISO RGD:10603 6480464 chromium hexavalent ion affects the expression of FST mRNA CTD PMID:28472532 Fst Rat cisplatin multiple interactions ISO RGD:734008 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of FST mRNA; Cisplatin affects the reaction more ... CTD PMID:21858171|PMID:27392435 Fst Rat cisplatin increases expression ISO RGD:734008 6480464 Cisplatin results in increased expression of FST mRNA CTD PMID:27594783 Fst Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of FST mRNA CTD PMID:22023808 Fst Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of FST mRNA CTD PMID:24386269 Fst Rat colforsin daropate hydrochloride multiple interactions ISO RGD:734008 6480464 FST protein inhibits the reaction [BMP6 protein inhibits the reaction [Colforsin results in increased secretion more ... CTD PMID:18936084 Fst Rat copper atom multiple interactions ISO RGD:734008 6480464 [NSC 689534 binds to Copper] which results in decreased expression of FST mRNA CTD PMID:20971185 Fst Rat copper atom increases expression EXP 6480464 Copper results in increased expression of FST mRNA CTD PMID:30556269 Fst Rat copper(0) multiple interactions ISO RGD:734008 6480464 [NSC 689534 binds to Copper] which results in decreased expression of FST mRNA CTD PMID:20971185 Fst Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of FST mRNA CTD PMID:30556269 Fst Rat copper(II) sulfate decreases expression ISO RGD:734008 6480464 Copper Sulfate results in decreased expression of FST mRNA CTD PMID:19549813 Fst Rat corn oil multiple interactions ISO RGD:10603 6480464 [Estradiol co-treated with Progesterone co-treated with Corn Oil] results in increased expression of FST mRNA CTD PMID:32186404 Fst Rat crocidolite asbestos increases expression ISO RGD:734008 6480464 Asbestos, Crocidolite results in increased expression of FST mRNA CTD PMID:18687144|PMID:25351596|PMID:25757056 Fst Rat crocidolite asbestos decreases expression ISO RGD:734008 6480464 Asbestos, Crocidolite results in decreased expression of FST mRNA CTD PMID:24160326|PMID:29523930 Fst Rat cycloheximide multiple interactions ISO RGD:734008 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of FST mRNA] CTD PMID:11007951 Fst Rat cyclosporin A decreases expression ISO RGD:734008 6480464 Cyclosporine results in decreased expression of FST mRNA CTD PMID:25562108|PMID:27989131 Fst Rat dexamethasone multiple interactions EXP 6480464 Dexamethasone inhibits the reaction [Freund's Adjuvant results in increased expression of FST mRNA] CTD PMID:21149847 Fst Rat dexamethasone multiple interactions ISO RGD:734008 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Fst Rat dextran sulfate multiple interactions ISO RGD:10603 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FST more ... CTD PMID:29950665 Fst Rat diarsenic trioxide multiple interactions ISO RGD:734008 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to FST protein] CTD PMID:26598702 Fst Rat dibenzo[a,l]pyrene decreases expression ISO RGD:10603 6480464 dibenzo(a,l)pyrene results in decreased expression of FST mRNA CTD PMID:25908611 Fst Rat dichloroacetic acid increases expression ISO RGD:10603 6480464 Dichloroacetic Acid results in increased expression of FST mRNA CTD PMID:28962523 Fst Rat dicrotophos increases expression ISO RGD:734008 6480464 dicrotophos results in increased expression of FST mRNA CTD PMID:28302478 Fst Rat diethyl malate affects expression ISO RGD:10603 6480464 diethyl malate affects the expression of FST mRNA CTD PMID:24814887 Fst Rat diethylstilbestrol decreases expression ISO RGD:734008 6480464 Diethylstilbestrol results in decreased expression of FST mRNA CTD PMID:36621641 Fst Rat dioxygen decreases expression ISO RGD:734008 6480464 Oxygen deficiency results in decreased expression of FST mRNA CTD PMID:24236059|PMID:26516004 Fst Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression more ... CTD PMID:33729688 Fst Rat dioxygen multiple interactions ISO RGD:10603 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of FST mRNA CTD PMID:30529165 Fst Rat dioxygen multiple interactions ISO RGD:734008 6480464 Oxygen affects the reaction [AHR protein results in increased expression of FST mRNA] CTD PMID:27103661 Fst Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of FST mRNA CTD PMID:25152437 Fst Rat dorsomorphin multiple interactions ISO RGD:734008 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Fst Rat doxorubicin decreases expression ISO RGD:734008 6480464 Doxorubicin results in decreased expression of FST mRNA CTD PMID:29803840 Fst Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of FST mRNA CTD PMID:29391264 Fst Rat entinostat multiple interactions ISO RGD:734008 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Fst Rat epoxiconazole affects expression ISO RGD:10603 6480464 epoxiconazole affects the expression of FST mRNA CTD PMID:35436446 Fst Rat ethanol multiple interactions ISO RGD:734008 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Fst Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of FST mRNA CTD PMID:34044035 Fst Rat fluoranthene multiple interactions ISO RGD:10603 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of FST mRNA CTD PMID:28329830 Fst Rat formaldehyde increases expression ISO RGD:734008 6480464 Formaldehyde results in increased expression of FST mRNA CTD PMID:27664576 Fst Rat fulvestrant increases expression ISO RGD:734008 6480464 Fulvestrant results in increased expression of FST mRNA CTD PMID:16298037|PMID:31646340 Fst Rat fulvestrant multiple interactions ISO RGD:734008 6480464 arsenite inhibits the reaction [Fulvestrant results in increased expression of FST mRNA]; Estradiol inhibits the more ... CTD PMID:31646340 Fst Rat furan increases expression ISO RGD:10603 6480464 furan results in increased expression of FST mRNA CTD PMID:24183702 Fst Rat furan increases expression EXP 6480464 furan results in increased expression of FST mRNA CTD PMID:27387713 Fst Rat genistein decreases expression ISO RGD:734008 6480464 Genistein results in decreased expression of FST mRNA CTD PMID:26865667 Fst Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of FST mRNA CTD PMID:33387578 Fst Rat geraniol increases expression ISO RGD:734008 6480464 geraniol results in increased expression of FST mRNA CTD PMID:27683099 Fst Rat GW 4064 decreases expression ISO RGD:10603 6480464 GW 4064 results in decreased expression of FST mRNA CTD PMID:26655953 Fst Rat hydralazine multiple interactions ISO RGD:734008 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of FST mRNA CTD PMID:17183730 Fst Rat hydrogen peroxide increases expression ISO RGD:734008 6480464 Hydrogen Peroxide results in increased expression of FST CTD PMID:18687144 Fst Rat indometacin multiple interactions ISO RGD:734008 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Fst Rat inulin multiple interactions ISO RGD:10603 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FST mRNA CTD PMID:36331819 Fst Rat isobutanol multiple interactions ISO RGD:734008 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic more ... CTD PMID:29432896 Fst Rat isoflavones decreases expression ISO RGD:734008 6480464 Isoflavones results in decreased expression of FST mRNA CTD PMID:16365062 Fst Rat leflunomide increases expression ISO RGD:734008 6480464 leflunomide results in increased expression of FST mRNA CTD PMID:28988120 Fst Rat lipopolysaccharide decreases expression EXP 329849007 LPS decreases expression of follistatin protein in rat cardiac fibroblasts RGD Fst Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of FST mRNA CTD PMID:16415329 Fst Rat lipopolysaccharide multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of FST mRNA; Ranitidine promotes the reaction more ... CTD PMID:16415329 Fst Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of FST mRNA CTD PMID:28619521 Fst Rat Methandrostenolone decreases expression EXP 6480464 Methandrostenolone results in decreased expression of FST mRNA CTD PMID:21818626 Fst Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of FST mRNA CTD PMID:30467583 Fst Rat methotrexate affects expression ISO RGD:10603 6480464 Methotrexate affects the expression of FST mRNA CTD PMID:18502557 Fst Rat methoxychlor decreases expression EXP 6480464 Methoxychlor results in decreased expression of FST mRNA CTD PMID:23303685 Fst Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of FST gene CTD PMID:23303685 Fst Rat methylisothiazolinone increases expression ISO RGD:734008 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of FST mRNA CTD PMID:31629900 Fst Rat methylmercury chloride increases expression ISO RGD:734008 6480464 methylmercuric chloride results in increased expression of FST mRNA CTD PMID:23179753|PMID:26272509|PMID:28001369|PMID:34089799 Fst Rat methylmercury chloride multiple interactions ISO RGD:734008 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Fst Rat Monobutylphthalate affects expression ISO RGD:10603 6480464 monobutyl phthalate affects the expression of FST mRNA CTD PMID:19162170 Fst Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression EXP 6480464 Methylnitronitrosoguanidine results in increased expression of FST mRNA CTD PMID:15120970 Fst Rat N-nitrosodiethylamine increases expression ISO RGD:10603 6480464 Diethylnitrosamine results in increased expression of FST mRNA CTD PMID:24535843 Fst Rat N-Nitrosopyrrolidine increases expression ISO RGD:734008 6480464 N-Nitrosopyrrolidine results in increased expression of FST mRNA CTD PMID:32234424 Fst Rat N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of FST mRNA; Ranitidine promotes the reaction more ... CTD PMID:16415329 Fst Rat nickel sulfate increases expression ISO RGD:10603 6480464 nickel sulfate results in increased expression of FST mRNA CTD PMID:16100012 Fst Rat O-methyleugenol increases expression ISO RGD:734008 6480464 methyleugenol results in increased expression of FST mRNA CTD PMID:32234424 Fst Rat okadaic acid increases expression ISO RGD:734008 6480464 Okadaic Acid results in increased expression of FST mRNA CTD PMID:38832940 Fst Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of FST mRNA CTD PMID:23665939 Fst Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of FST mRNA CTD PMID:25729387 Fst Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of FST mRNA CTD PMID:25729387 Fst Rat oxybenzone increases expression EXP 6480464 oxybenzone results in increased expression of FST mRNA CTD PMID:30599193 Fst Rat ozone multiple interactions ISO RGD:10603 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of FST more ... CTD PMID:27106289 Fst Rat ozone increases expression ISO RGD:734008 6480464 Ozone results in increased expression of FST mRNA CTD PMID:23033980 Fst Rat paracetamol affects expression ISO RGD:10603 6480464 Acetaminophen affects the expression of FST mRNA CTD PMID:17562736 Fst Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of FST mRNA CTD PMID:33387578 Fst Rat paracetamol decreases expression ISO RGD:734008 6480464 Acetaminophen results in decreased expression of FST mRNA CTD PMID:21420995 Fst Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of FST mRNA CTD PMID:32680482 Fst Rat pentobarbital multiple interactions EXP 6480464 Pentobarbital inhibits the reaction [Estrogens results in increased expression of FST mRNA] CTD PMID:8612495 Fst Rat perfluorohexanesulfonic acid increases expression ISO RGD:10603 6480464 perfluorohexanesulfonic acid results in increased expression of FST mRNA CTD PMID:37995155 Fst Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:10603 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FST mRNA CTD PMID:36331819 Fst Rat phenethyl isothiocyanate decreases expression ISO RGD:734008 6480464 phenethyl isothiocyanate results in decreased expression of FST mRNA CTD PMID:26678675 Fst Rat phenobarbital multiple interactions ISO RGD:10603 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of FST mRNA]; NR1I3 protein more ... CTD PMID:19482888 Fst Rat phenobarbital affects expression ISO RGD:734008 6480464 Phenobarbital affects the expression of FST mRNA CTD PMID:19159669 Fst Rat phenobarbital increases expression ISO RGD:10603 6480464 Phenobarbital results in increased expression of FST mRNA CTD PMID:19482888 Fst Rat phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of FST mRNA CTD PMID:19162173 Fst Rat pirinixic acid multiple interactions ISO RGD:734008 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Fst Rat piroxicam decreases expression ISO RGD:734008 6480464 Piroxicam results in decreased expression of FST mRNA CTD PMID:21858171 Fst Rat piroxicam multiple interactions ISO RGD:734008 6480464 Cisplatin affects the reaction [Piroxicam results in decreased expression of FST mRNA] CTD PMID:21858171 Fst Rat potassium iodide increases expression EXP 6480464 Potassium Iodide results in increased expression of FST protein CTD PMID:32593569 Fst Rat pregnenolone 16alpha-carbonitrile decreases expression ISO RGD:10603 6480464 Pregnenolone Carbonitrile results in decreased expression of FST mRNA CTD PMID:28903501 Fst Rat progesterone multiple interactions ISO RGD:734008 6480464 FST protein inhibits the reaction [BMP6 protein inhibits the reaction [Colforsin results in increased secretion more ... CTD PMID:18936084 Fst Rat progesterone multiple interactions ISO RGD:10603 6480464 [Estradiol co-treated with Progesterone co-treated with Corn Oil] results in increased expression of FST mRNA CTD PMID:32186404 Fst Rat progesterone increases expression ISO RGD:10603 6480464 Progesterone results in increased expression of FST mRNA; Progesterone results in increased expression of FST more ... CTD PMID:22238285|PMID:22285243 Fst Rat propiconazole increases expression ISO RGD:10603 6480464 propiconazole results in increased expression of FST mRNA CTD PMID:19363144 Fst Rat rac-lactic acid increases expression ISO RGD:734008 6480464 Lactic Acid results in increased expression of FST mRNA CTD PMID:30851411 Fst Rat raloxifene multiple interactions ISO RGD:734008 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in decreased expression of FST mRNA CTD PMID:19059307 Fst Rat raloxifene affects expression ISO RGD:734008 6480464 Raloxifene Hydrochloride affects the expression of FST mRNA CTD PMID:14699072 Fst Rat ranitidine multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of FST mRNA; Ranitidine promotes the reaction more ... CTD PMID:16415329 Fst Rat resveratrol increases expression ISO RGD:734008 6480464 resveratrol results in increased expression of FST mRNA CTD PMID:17257620|PMID:25888808 Fst Rat SB 431542 multiple interactions ISO RGD:734008 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Fst Rat serpentine asbestos decreases expression ISO RGD:734008 6480464 Asbestos, Serpentine results in decreased expression of FST mRNA CTD PMID:24160326 Fst Rat sevoflurane affects expression EXP 6480464 sevoflurane affects the expression of FST mRNA CTD PMID:15967596 Fst Rat silicon dioxide affects expression ISO RGD:734008 6480464 Silicon Dioxide analog affects the expression of FST mRNA CTD PMID:25895662 Fst Rat simvastatin multiple interactions ISO RGD:10603 6480464 FST protein inhibits the reaction [Simvastatin results in decreased phosphorylation of AKT1 protein]; FST protein more ... CTD PMID:33034787 Fst Rat sodium arsenite decreases expression ISO RGD:10603 6480464 sodium arsenite results in decreased expression of FST mRNA CTD PMID:16014739 Fst Rat sodium arsenite decreases expression ISO RGD:734008 6480464 sodium arsenite results in decreased expression of FST mRNA CTD PMID:35954277 Fst Rat sodium arsenite multiple interactions ISO RGD:734008 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FST more ... CTD PMID:39836092 Fst Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of FST mRNA CTD PMID:22561333 Fst Rat sodium dodecyl sulfate decreases expression ISO RGD:734008 6480464 Sodium Dodecyl Sulfate results in decreased expression of FST mRNA CTD PMID:31734321 Fst Rat sunitinib decreases expression ISO RGD:734008 6480464 Sunitinib results in decreased expression of FST mRNA CTD PMID:31533062 Fst Rat tamoxifen affects expression ISO RGD:734008 6480464 Tamoxifen affects the expression of FST mRNA CTD PMID:14699072 Fst Rat tamoxifen decreases expression ISO RGD:734008 6480464 Tamoxifen results in decreased expression of FST mRNA CTD PMID:16298037 Fst Rat tamoxifen multiple interactions ISO RGD:734008 6480464 [Tamoxifen co-treated with ESR2 protein] results in decreased expression of FST mRNA CTD PMID:19059307 Fst Rat temozolomide increases expression ISO RGD:734008 6480464 Temozolomide results in increased expression of FST mRNA CTD PMID:31758290 Fst Rat testosterone increases expression ISO RGD:10603 6480464 Testosterone results in increased expression of FST mRNA; Testosterone results in increased expression of FST more ... CTD PMID:22138414 Fst Rat testosterone decreases expression ISO RGD:734008 6480464 Testosterone results in decreased expression of FST mRNA CTD PMID:33359661 Fst Rat testosterone multiple interactions ISO RGD:10603 6480464 FST mutant form inhibits the reaction [Testosterone results in increased expression of MYH2 protein] CTD PMID:22138414 Fst Rat tetrachloromethane increases expression ISO RGD:10603 6480464 Carbon Tetrachloride results in increased expression of FST mRNA CTD PMID:27339419|PMID:31919559 Fst Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of FST mRNA CTD PMID:34492290 Fst Rat titanium dioxide increases expression ISO RGD:10603 6480464 titanium dioxide results in increased expression of FST mRNA CTD PMID:27760801 Fst Rat titanium dioxide affects methylation ISO RGD:10603 6480464 titanium dioxide affects the methylation of FST promoter CTD PMID:35295148 Fst Rat titanium dioxide multiple interactions ISO RGD:10603 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FST more ... CTD PMID:29950665 Fst Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of FST mRNA CTD PMID:25729387 Fst Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of FST mRNA CTD PMID:25729387 Fst Rat triadimefon increases expression ISO RGD:10603 6480464 triadimefon results in increased expression of FST mRNA CTD PMID:19363144 Fst Rat trichostatin A decreases expression ISO RGD:734008 6480464 trichostatin A results in decreased expression of FST mRNA CTD PMID:24935251|PMID:26272509 Fst Rat trichostatin A multiple interactions ISO RGD:734008 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Fst Rat triclosan increases expression ISO RGD:734008 6480464 Triclosan results in increased expression of FST mRNA CTD PMID:30510588 Fst Rat triptonide increases expression ISO RGD:10603 6480464 triptonide results in increased expression of FST mRNA CTD PMID:33045310 Fst Rat troglitazone increases expression ISO RGD:734008 6480464 troglitazone results in increased expression of FST mRNA CTD PMID:19140230 Fst Rat troglitazone increases expression ISO RGD:10603 6480464 troglitazone results in increased expression of FST mRNA CTD PMID:28973697 Fst Rat urethane increases expression ISO RGD:734008 6480464 Urethane results in increased expression of FST mRNA CTD PMID:28818685 Fst Rat valproic acid multiple interactions ISO RGD:734008 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of FST mRNA; [NOG protein co-treated more ... CTD PMID:17183730|PMID:27188386 Fst Rat valproic acid decreases expression ISO RGD:734008 6480464 Valproic Acid results in decreased expression of FST mRNA CTD PMID:23179753|PMID:24383497|PMID:26272509|PMID:29154799 Fst Rat valproic acid affects expression ISO RGD:734008 6480464 Valproic Acid affects the expression of FST mRNA CTD PMID:25979313 Fst Rat valproic acid increases expression ISO RGD:734008 6480464 Valproic Acid results in increased expression of FST mRNA CTD PMID:23179753|PMID:34742744 Fst Rat valproic acid affects expression ISO RGD:10603 6480464 Valproic Acid affects the expression of FST mRNA CTD PMID:17292431|PMID:17963808 Fst Rat vancomycin decreases expression ISO RGD:10603 6480464 Vancomycin results in decreased expression of FST mRNA CTD PMID:18930951 Fst Rat vitamin E increases expression ISO RGD:734008 6480464 Vitamin E results in increased expression of FST mRNA CTD PMID:19244175
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1-Hydroxypyrene (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-Hydroxybenzo[a]pyrene (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 3-Nitrobenzanthrone (ISO) 4,4'-diaminodiphenylmethane (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acetylsalicylic acid (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) Archazolid B (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP,ISO) azathioprine (ISO) Azoxymethane (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) Benzo[k]fluoranthene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) butan-1-ol (ISO) butyric acid (EXP) cadmium atom (ISO) cadmium dichloride (EXP) calciol (ISO) calcitriol (ISO) carbon nanotube (ISO) chloropicrin (ISO) chloroprene (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) cisplatin (EXP,ISO) cobalt dichloride (EXP) colforsin daropate hydrochloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) corn oil (ISO) crocidolite asbestos (ISO) cycloheximide (ISO) cyclosporin A (ISO) dexamethasone (EXP,ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) dichloroacetic acid (ISO) dicrotophos (ISO) diethyl malate (ISO) diethylstilbestrol (ISO) dioxygen (EXP,ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) fipronil (EXP) fluoranthene (ISO) formaldehyde (ISO) fulvestrant (ISO) furan (EXP,ISO) genistein (ISO) gentamycin (EXP) geraniol (ISO) GW 4064 (ISO) hydralazine (ISO) hydrogen peroxide (ISO) indometacin (ISO) inulin (ISO) isobutanol (ISO) isoflavones (ISO) leflunomide (ISO) lipopolysaccharide (EXP) methamphetamine (EXP) Methandrostenolone (EXP) methapyrilene (EXP) methotrexate (ISO) methoxychlor (EXP) methylisothiazolinone (ISO) methylmercury chloride (ISO) Monobutylphthalate (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (EXP) N-nitrosodiethylamine (ISO) N-Nitrosopyrrolidine (ISO) N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP) nickel sulfate (ISO) O-methyleugenol (ISO) okadaic acid (ISO) orphenadrine (EXP) oxaliplatin (EXP) oxybenzone (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP) pentobarbital (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenethyl isothiocyanate (ISO) phenobarbital (EXP,ISO) pirinixic acid (ISO) piroxicam (ISO) potassium iodide (EXP) pregnenolone 16alpha-carbonitrile (ISO) progesterone (ISO) propiconazole (ISO) rac-lactic acid (ISO) raloxifene (ISO) ranitidine (EXP) resveratrol (ISO) SB 431542 (ISO) serpentine asbestos (ISO) sevoflurane (EXP) silicon dioxide (ISO) simvastatin (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sodium dodecyl sulfate (ISO) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) triadimefon (ISO) trichostatin A (ISO) triclosan (ISO) triptonide (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) vancomycin (ISO) vitamin E (ISO)
Biological Process
ameloblast differentiation (IEA,ISO) BMP signaling pathway (IEA,ISO) cell differentiation (IBA) cellular response to growth factor stimulus (IEP) female gonad development (IEA,ISO) gamete generation (IEA,ISO) hair follicle morphogenesis (IEA,ISO) hematopoietic progenitor cell differentiation (IEA,ISO) keratinocyte proliferation (IEA,ISO) negative regulation of activin receptor signaling pathway (IBA,IEA,ISO) negative regulation of epithelial cell differentiation (IEA,ISO) negative regulation of follicle-stimulating hormone secretion (TAS) negative regulation of transcription by RNA polymerase II (IEA,ISO) odontogenesis of dentin-containing tooth (IEA,ISO) pattern specification process (IEA,ISO) positive regulation of hair follicle development (IEA,ISO) regulation of BMP signaling pathway (IBA) skeletal system development (IEA,ISO)
1.
Dynamics of messenger RNAs encoding inhibin/activin subunits and follistatin in the ovary during the rat estrous cycle.
Arai KY, etal., Biol Reprod. 2002 Apr;66(4):1119-26.
2.
Rat anterior pituitary folliculostellate cells are targets of interleukin-1beta and a major source of intrapituitary follistatin.
Bilezikjian LM, etal., Endocrinology 2003 Feb;144(2):732-40.
3.
GnRH pulse frequency modulation of gonadotropin subunit gene transcription in normal gonadotropes-assessment by primary transcript assay provides evidence for roles of GnRH and follistatin.
Burger LL, etal., Endocrinology 2002 Sep;143(9):3243-9.
4.
Mapping of rat chromosome 2 markers generated from chromosome-sorted DNA.
Deng AY, etal., Mamm Genome 1997 Oct;8(10):731-5.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
betaA- and betaC-activin, follistatin, activin receptor mRNA and betaC-activin peptide expression during rat liver regeneration.
Gold EJ, etal., J Mol Endocrinol. 2005 Apr;34(2):505-15.
8.
Structural basis for the inhibition of activin signalling by follistatin.
Harrington AE, etal., EMBO J. 2006 Mar 8;25(5):1035-45. Epub 2006 Feb 16.
9.
Crystal structures of the heparan sulfate-binding domain of follistatin. Insights into ligand binding.
Innis CA and Hyvonen M, J Biol Chem. 2003 Oct 10;278(41):39969-77. Epub 2003 Jul 16.
10.
Multiple defects and perinatal death in mice deficient in follistatin.
Matzuk MM, etal., Nature 1995 Mar 23;374(6520):360-3.
11.
Granulosa cell tumor mutant FOXL2C134W suppresses GDF-9 and activin A-induced follistatin transcription in primary granulosa cells.
McTavish KJ, etal., Mol Cell Endocrinol. 2013 Jun 15;372(1-2):57-64. doi: 10.1016/j.mce.2013.03.021. Epub 2013 Apr 6.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Differential expression of the pituitary gonadotropin subunit genes during male rat sexual maturation: reciprocal relationship between hypothalamic pituitary adenylate cyclase-activating polypeptide and follicle-stimulating hormone beta expression.
Moore JP Jr, etal., Biol Reprod. 2003 Jul;69(1):234-41. Epub 2003 Mar 19.
14.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
16.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
17.
Pituitary follistatin gene expression in female rats: evidence that inhibin regulates transcription.
Prendergast KA, etal., Biol Reprod. 2004 Feb;70(2):364-70. Epub 2003 Oct 15.
18.
GOA pipeline
RGD automated data pipeline
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
Comprehensive gene review and curation
RGD comprehensive gene curation
21.
Follistatin overexpression in rodent liver tumors: a possible mechanism to overcome activin growth control.
Rossmanith W, etal., Mol Carcinog 2002 Sep;35(1):1-5.
22.
The UV filter benzophenone 3, alters early follicular assembly in rat whole ovary cultures.
Santamaría CG, etal., Toxicol Lett. 2019 Mar 15;303:48-54. doi: 10.1016/j.toxlet.2018.12.016. Epub 2018 Dec 30.
23.
Follistatin gene expression in the ovary and extragonadal tissues.
Shimasaki S, etal., Mol Endocrinol 1989 Apr;3(4):651-9.
24.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
25.
Thirty-seven candidate genes for polycystic ovary syndrome: strongest evidence for linkage is with follistatin.
Urbanek M, etal., Proc Natl Acad Sci U S A. 1999 Jul 20;96(15):8573-8.
26.
Expression of the activin axis and neuronal rescue effects of recombinant activin A following hypoxic-ischemic brain injury in the infant rat.
Wu DD, etal., Brain Res. 1999 Jul 24;835(2):369-78. doi: 10.1016/s0006-8993(99)01638-8.
27.
Lipopolysaccharide induced activin A-follistatin imbalance affects cardiac fibrosis.
Zhang WQ, etal., Chin Med J (Engl). 2012 Jun;125(12):2205-12.
Fst (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 47,856,345 - 47,863,670 (-) NCBI GRCr8 mRatBN7.2 2 46,123,260 - 46,130,584 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 46,123,439 - 46,130,571 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 53,226,536 - 53,233,459 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 51,284,901 - 51,291,822 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 46,164,805 - 46,171,742 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 46,537,589 - 46,544,813 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 46,538,700 - 46,544,457 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 65,576,721 - 65,583,918 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 46,542,246 - 46,550,678 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 46,470,478 - 46,478,911 (-) NCBI Celera 2 41,883,386 - 41,889,989 (-) NCBI Celera Cytogenetic Map 2 q14 NCBI
FST (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 53,480,629 - 53,487,134 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 53,480,626 - 53,487,134 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 52,776,459 - 52,782,964 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 52,812,352 - 52,817,680 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 52,812,351 - 52,817,659 NCBI Celera 5 49,730,217 - 49,735,545 (+) NCBI Celera Cytogenetic Map 5 q11.2 NCBI HuRef 5 49,748,385 - 49,754,428 (+) NCBI HuRef CHM1_1 5 52,779,193 - 52,785,231 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 54,308,436 - 54,314,946 (+) NCBI T2T-CHM13v2.0
Fst (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 114,588,798 - 114,595,522 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 114,588,826 - 114,595,487 (-) Ensembl GRCm39 Ensembl GRCm38 13 114,452,262 - 114,458,989 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 114,452,290 - 114,458,951 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 115,242,470 - 115,248,938 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 115,574,219 - 115,579,464 (-) NCBI MGSCv36 mm8 Celera 13 118,786,092 - 118,792,681 (-) NCBI Celera Cytogenetic Map 13 D2.2 NCBI cM Map 13 64.15 NCBI
Fst (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955446 13,925,776 - 13,932,104 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955446 13,925,833 - 13,932,104 (-) NCBI ChiLan1.0 ChiLan1.0
FST (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 60,454,897 - 60,462,481 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 58,608,522 - 58,616,019 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 60,544,495 - 60,550,516 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 62,163,655 - 62,168,218 (-) NCBI panpan1.1 PanPan1.1 panPan2
FST (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 61,779,252 - 61,785,666 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 61,779,259 - 61,783,260 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 61,544,683 - 61,551,112 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 62,270,843 - 62,277,297 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 62,271,936 - 62,277,253 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 62,049,664 - 62,056,089 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 62,178,184 - 62,184,600 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 62,695,162 - 62,701,588 (-) NCBI UU_Cfam_GSD_1.0
Fst (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 205,054,434 - 205,060,754 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936480 13,990,929 - 13,997,248 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936480 13,990,967 - 13,997,248 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FST (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 32,805,932 - 32,811,421 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 32,806,341 - 32,811,382 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 34,779,040 - 34,784,066 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FST (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 49,773,646 - 49,780,343 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 49,773,980 - 49,780,333 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666082 1,343,148 - 1,349,927 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fst (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 48 Count of miRNA genes: 46 Interacting mature miRNAs: 47 Transcripts: ENSRNOT00000015680 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2293676 Bmd19 Bone mineral density QTL 19 10.7 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 43162366 111362592 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 2293682 Bmd24 Bone mineral density QTL 24 8.9 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 2 43162366 111362592 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 70174 BpQTLCluster2 Blood pressure QTL cluster 2 4.24 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 40067944 102785628 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 631208 Bw1 Body weight QTL1 5.09 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 2 43171017 83575226 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1300155 Bp174 Blood pressure QTL 174 4.09 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 42804607 60653831 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 12879863 Bp402 Blood pressure QTL 402 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 41125789 56532139 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat 61371 Edpm1 Estrogen-dependent pituitary mass QTL 1 4 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 35134841 88029593 Rat 10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 10755436 Coatc8 Coat color QTL 8 0.02431 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 35023117 80023117 Rat 10755434 Coatc7 Coat color QTL 7 0.04794 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 30648065 75648065 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300160 Hrtrt3 Heart rate QTL 3 3.62 heart pumping trait (VT:2000009) absolute change in heart rate (CMO:0000534) 2 29971593 51729300 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 9685065 Swd6 Spike wave discharge measurement QTL 6 5.8 0.01 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge rate (CMO:0001739) 2 39223937 48793699 Rat 9590095 Sffal3 Serum free fatty acids level QTL 3 6.78 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 2 27157160 72157160 Rat 1643006 Pain1 Pain QTL 1 3.63 0.005 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 2 26999571 48268661 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
D2Wox13
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 47,863,756 - 47,863,910 (+) Marker Load Pipeline mRatBN7.2 2 46,130,672 - 46,130,826 (+) MAPPER mRatBN7.2 Rnor_6.0 2 46,544,917 - 46,545,070 NCBI Rnor6.0 Rnor_5.0 2 65,584,009 - 65,584,162 UniSTS Rnor5.0 RGSC_v3.4 2 46,551,143 - 46,551,296 UniSTS RGSC3.4 RGSC_v3.4 2 46,551,142 - 46,551,296 RGD RGSC3.4 RGSC_v3.1 2 46,479,375 - 46,479,529 RGD RH 3.4 Map 2 297.6 UniSTS RH 3.4 Map 2 297.6 RGD RH 2.0 Map 2 267.2 RGD Cytogenetic Map 2 q16 UniSTS
D2Arb3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 46,130,674 - 46,130,822 (+) MAPPER mRatBN7.2 Rnor_6.0 2 46,544,919 - 46,545,066 NCBI Rnor6.0 Rnor_5.0 2 65,584,011 - 65,584,158 UniSTS Rnor5.0 RGSC_v3.4 2 46,551,144 - 46,551,292 RGD RGSC3.4 RGSC_v3.4 2 46,551,145 - 46,551,292 UniSTS RGSC3.4 RGSC_v3.1 2 46,479,377 - 46,479,525 RGD Cytogenetic Map 2 q16 UniSTS
AA858520
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 2 293.1 UniSTS Cytogenetic Map 2 q16 UniSTS
Fst
Rat Assembly Chr Position (strand) Source JBrowse Rnor_6.0 2 46,539,696 - 46,541,189 NCBI Rnor6.0 Rnor_5.0 2 65,578,828 - 65,580,216 UniSTS Rnor5.0 RGSC_v3.4 2 46,543,186 - 46,544,783 UniSTS RGSC3.4 Cytogenetic Map 2 q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
89
88
57
24
57
6
215
96
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015680 ⟹ ENSRNOP00000015680
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 46,123,439 - 46,130,571 (-) Ensembl Rnor_6.0 Ensembl 2 46,538,700 - 46,544,457 (-) Ensembl
RefSeq Acc Id:
NM_012561 ⟹ NP_036693
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 47,856,345 - 47,863,292 (-) NCBI mRatBN7.2 2 46,123,260 - 46,130,208 (-) NCBI Rnor_6.0 2 46,537,589 - 46,544,452 (-) NCBI Rnor_5.0 2 65,576,721 - 65,583,918 (-) NCBI RGSC_v3.4 2 46,542,246 - 46,550,678 (-) RGD Celera 2 41,883,386 - 41,889,989 (-) NCBI
Sequence:
ATGGTCTGCGCCAGGCACCAGCCCGGCGGGCTCTGCCTCCTGCTGCTGCTACTCTGCCAATTCATGGAAGACCGCAGCGCCCAGGCTGGGAATTGCTGGCTCCGCCAAGCCAAGAACGGCCGCTGCCA GGTCCTGTATAAGACAGAACTGAGCAAGGAAGAGTGTTGCAGCACCGGCCGGCTGAGCACCTCGTGGACCGAGGAGGATGTGAACGACAATACTCTCTTCAAGTGGATGATTTTCAACGGGGGCGCCC CCAACTGCATCCCTTGTAAAGAAACGTGTGAGAATGTGGACTGTGGCCCCGGGAAAAAGTGCCGAATGAACAAGAAGAACAAACCCCGCTGCGTCTGTGCCCCAGACTGTTCCAACATCACCTGGAAG GGTCCAGTGTGTGGGCTCGATGGGAAAACCTACCGCAACGAATGTGCGCTCCTCAAGGCCAGATGTAAAGAGCAGCCGGAACTGGAAGTCCAGTACCAGGGCAAATGTAAAAAGACTTGCAGGGATGT TTTCTGTCCAGGCAGCTCCACTTGTGTGGTGGATCAGACCAATAATGCCTACTGTGTGACCTGTAATCGGATTTGCCCGGAACCCTCATCTTCAGAGCAGTCCCTTTGCGGGAACGATGGTGTGACTT ACTCCAGTGCCTGCCACCTGAGAAAGGCCACCTGCTTGCTGGGCAGATCCATTGGATTAGCCTATGAGGGAAAGTGTATCAAAGCAAAGTCTTGTGAAGACATCCAGTGCGGTGGTGGAAAAAAATGC CTATGGGATTTCAAGGTTGGCAGAGGTCGCTGCTCTCTCTGCGATGAGCTGTGCCCGGACAGTAAGTCGGATGAGCCCGTCTGTGCCAGCGACAATGCCACGTACGCCAGCGAGTGTGCCATGAAGGA AGCTGCCTGCTCCTCCGGCGTACTGCTTGAAGTGAAGCACTCCGGATCTTGCAACTCCATCTCGGAAGAAACGGAGGAAGAGGAGGAAGAGGAAGACCAGGACTACAGCTTCCCTATCTCTTCCACTC TAGAGTGGTAAACTGTCCAGCAGTGTGCAGTGTGGACAGAGCCTGTGGGCAAAACAAAACACAGCAGAAAAAAAAAAAAAAAGGCAAGAAAAAAAAGATAGAAAAGAAAATTAAGAAAAAGAAAAAAT ATATTGTTCATAATGTAAATAAGTGTATGCTTATTTATTTGGGGGGAAAACTATACATTAAAGGACCTTTGTCCTGAAGCTCTCTCCCAGGTCACATTGTTACTCACTGGCCATGGAGAGATGGTCAT TTTGTGGTCTACTGGATGAGGCCTATAGTTGAGGCTTTGTAGACATTTATTTATACTGTGTCATGTTTTATAATTTATACATAAAGTGTCTGGTTGACTGTACACCTTGTTTTTGAAGAAATTTATTC GTGAAAGGAAGAGCAGTTGTTATTTATTGTGAGGTCTCTTGCTTGTAAAGTAGAACTGTTTTGTTTTGTTTTGTTTTTTTTTTGCCCCCTTGTAAACCGTGTAAGTTCATTCCTCACTATGCACACCC ACCTGTCTCCCTCCCCATTTCACTGTTAGATTCTTCTCCACCTTTTAACAAATTTGCATGTCAGTTCCTGTCACGTTTATTTATTGGGTTCTCGGCTGCCTAACCTGTACATACCTGATCCCTCGGGT TTTGTTTACAAGGAATCTTGACTGACCAAAAGGCACTGTAACTCTGCCTCAGATACAAGGTACAGAGGAGATGCGTCTCGGAGGAAACGTCTGCTTCCGTCCCCTTGTTCTGGTGAACGTTGGGAGAG AGCATGAGAGAAGCATTAAAATTCTAGAGCTGTGCTTTTATGATCCAAAGACATAGAGTGATGTGGGTGTCAGAGACTGAAGAGAGGTGAAAGTCGCGCTTTCAACCTGTCATTCAGGGTTTCCTTTG AGCTAGTCGGCTGTACCTTTTCAATTAGTTCTCTTTTTTTTTTTTCAACCAACATGTCACTAAAAGTTCCATCAAAGCTTTATCAGTTCAAGTTTCTTGCTTTTCATAATACTTTTTTCTGATGCAAT TTTATATTTTCAAACATGGCAAGTTAAATATAAATTCATTTAAATATATAGTTTTGTACTTTTCTACCATGTAAATGTGCAATGTATATAAAAGTTATAATGTGTATTTGTAGATAAATGATGAGTGA AAAAATAAAAAAAAATGTAAAAGCCA
hide sequence
RefSeq Acc Id:
XM_006231953 ⟹ XP_006232015
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 47,856,345 - 47,863,670 (-) NCBI mRatBN7.2 2 46,123,260 - 46,130,583 (-) NCBI Rnor_6.0 2 46,537,589 - 46,544,813 (-) NCBI Rnor_5.0 2 65,576,721 - 65,583,918 (-) NCBI
Sequence:
TGATTTCGGGCACCTCCGACAGATAATTGGGAAGGGTTTCCAGAAGGTGGGAAATGTCACCTGA TTCACACTGAACTTTTAAAAGCTCCCCACCCCCAAAGAGCCGGCACACCCTCGGTCGCCGCCGCCCTCCCACAGCCCCACACACTGGGAGACCGCCCACCGCAAACCTCGGAGACCCCCGTCTAGATT TAAAGCGCGGCTGCGCCCGGCTTCTGACGTCCATTGAATCGCGCGGGCGGCCGGTGGCGAGCGCGGGGCTGCGCCGGGATCGCTGCGCCCTCCGCCGCTCGCCTCTGCGACGCGCGCCGCTCGCCCAA GCCACCCGCCGCCGCGCTCCTCGCCCCGCGCCTGCCCCAGGATGGTCTGCGCCAGGCACCAGCCCGGCGGGCTCTGCCTCCTGCTGCTGCTACTCTGCCAATTCATGGAAGACCGCAGCGCCCAGGCT GGGAATTGCTGGCTCCGCCAAGCCAAGAACGGCCGCTGCCAGGTCCTGTATAAGACAGAACTGAGCAAGGAAGAGTGTTGCAGCACCGGCCGGCTGAGCACCTCGTGGACCGAGGAGGATGTGAACGA CAATACTCTCTTCAAGTGGATGATTTTCAACGGGGGCGCCCCCAACTGCATCCCTTGTAAAGAAACGTGTGAGAATGTGGACTGTGGCCCCGGGAAAAAGTGCCGAATGAACAAGAAGAACAAACCCC GCTGCGTCTGTGCCCCAGACTGTTCCAACATCACCTGGAAGGGTCCAGTGTGTGGGCTCGATGGGAAAACCTACCGCAACGAATGTGCGCTCCTCAAGGCCAGATGTAAAGAGCAGCCGGAACTGGAA GTCCAGTACCAGGGCAAATGTAAAAAGACTTGCAGGGATGTTTTCTGTCCAGGCAGCTCCACTTGTGTGGTGGATCAGACCAATAATGCCTACTGTGTGACCTGTAATCGGATTTGCCCGGAACCCTC ATCTTCAGAGCAGTCCCTTTGCGGGAACGATGGTGTGACTTACTCCAGTGCCTGCCACCTGAGAAAGGCCACCTGCTTGCTGGGCAGATCCATTGGATTAGCCTATGAGGGAAAGTGTATCACAAAGT CTTGTGAAGACATCCAGTGCGGTGGTGGAAAAAAATGCCTATGGGATTTCAAGGTTGGCAGAGGTCGCTGCTCTCTCTGCGATGAGCTGTGCCCGGACAGTAAGTCGGATGAGCCCGTCTGTGCCAGC GACAATGCCACGTACGCCAGCGAGTGTGCCATGAAGGAAGCTGCCTGCTCCTCCGGCGTACTGCTTGAAGTGAAGCACTCCGGATCTTGCAACTCCATCTCGGAAGAAACGGAGGAAGAGGAGGAAGA GGAAGACCAGGACTACAGCTTCCCTATCTCTTCCACTCTAGAGTGGTAAACTGTCCAGCAGTGTGCAGTGTGGACAGAGCCTGTGGGCAAAACAAAACACAGCAGAAAAAAAAAAAAAAAGGCAAGAA AAAAAAGATAGAAAAGAAAATTAAGAAAAAGAAAAAATATATTGTTCATAATGTAAATAAGTGTATGCTTATTTATTTGGGGGGAAAACTATACATTAAAGGACCTTTGTCCTGAAGCTCTCTCCCAG GTCACATTGTTACTCACTGGCCATGGAGAGATGGTCATTTTGTGGTCTACTGGATGAGGCCTATAGTTGAGGCTTTGTAGACATTTATTTATACTGTGTCATGTTTTATAATTTATACATAAAGTGTC TGGTTGACTGTACACCTTGTTTTTGAAGAAATTTATTCGTGAAAGGAAGAGCAGTTGTTATTTATTGTGAGGTCTCTTGCTTGTAAAGTAGAACTGTTTTGTTTTGTTTTGTTTTTTTTTTGCCCCCT TGTAAACCGTGTAAGTTCATTCCTCACTATGCACACCCACCTGTCTCCCTCCCCATTTCACTGTTAGATTCTTCTCCACCTTTTAACAAATTTGCATGTCAGTTCCTGTCACGTTTATTTATTGGGTT CTCGGCTGCCTAACCTGTACATACCTGATCCCTCGGGTTTTGTTTACAAGGAATCTTGACTGACCAAAAGGCACTGTAACTCTGCCTCAGATACAAGGTACAGAGGAGATGCGTCTCGGAGGAAACGT CTGCTTCCGTCCCCTTGTTCTGGTGAACGTTGGGAGAGAGCATGAGAGAAGCATTAAAATTCTAGAGCTGTGCTTTTATGATCCAAAGACATAGAGTGATGTGGGTGTCAGAGACTGAAGAGAGGTGA AAGTCGCGCTTTCAACCTGTCATTCAGGGTTTCCTTTGAGCTAGTCGGCTGTACCTTTTCAATTAGTTCTCTTTTTTTTTTTTCAACCAACATGTCACTAAAAGTTCCATCAAAGCTTTATCAGTTCA AGTTTCTTGCTTTTCATAATACTTTTTTCTGATGCAATTTTATATTTTCAAACATGGCAAGTTAAATATAAATTCATTTAAATATATAGTTTTGTACTTTTCTACCATGTAAATGTGCAATGTATATA AAAGTTATAATGTGTATTTGTAGATAAATGATGAGTGAAAAAATAAAAAAAAATGTAAAAGCCA
hide sequence
RefSeq Acc Id:
XM_006231954 ⟹ XP_006232016
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 47,856,345 - 47,863,669 (-) NCBI mRatBN7.2 2 46,123,260 - 46,130,582 (-) NCBI Rnor_6.0 2 46,538,745 - 46,544,813 (-) NCBI Rnor_5.0 2 65,576,721 - 65,583,918 (-) NCBI
Sequence:
TGATTTCGGGCACCTCCGACAGATAATTGGGAAGGGTTTCCAGAAGGTGGGAAATGTCACCTGA TTCACACTGAACTTTTAAAAGCTCCCCACCCCCAAAGAGCCGGCACACCCTCGGTCGCCGCCGCCCTCCCACAGCCCCACACACTGGGAGACCGCCCACCGCAAACCTCGGAGACCCCCGTCTAGATT TAAAGCGCGGCTGCGCCCGGCTTCTGACGTCCATTGAATCGCGCGGGCGGCCGGTGGCGAGCGCGGGGCTGCGCCGGGATCGCTGCGCCCTCCGCCGCTCGCCTCTGCGACGCGCGCCGCTCGCCCAA GCCACCCGCCGCCGCGCTCCTCGCCCCGCGCCTGCCCCAGGATGGTCTGCGCCAGGCACCAGCCCGGCGGGCTCTGCCTCCTGCTGCTGCTACTCTGCCAATTCATGGAAGACCGCAGCGCCCAGGCT GGGAATTGCTGGCTCCGCCAAGCCAAGAACGGCCGCTGCCAGGTCCTGTATAAGACAGAACTGAGCAAGGAAGAGTGTTGCAGCACCGGCCGGCTGAGCACCTCGTGGACCGAGGAGGATGTGAACGA CAATACTCTCTTCAAGTGGATGATTTTCAACGGGGGCGCCCCCAACTGCATCCCTTGTAAAGAAACGTGTGAGAATGTGGACTGTGGCCCCGGGAAAAAGTGCCGAATGAACAAGAAGAACAAACCCC GCTGCGTCTGTGCCCCAGACTGTTCCAACATCACCTGGAAGGGTCCAGTGTGTGGGCTCGATGGGAAAACCTACCGCAACGAATGTGCGCTCCTCAAGGCCAGATGTAAAGAGCAGCCGGAACTGGAA GTCCAGTACCAGGGCAAATGTAAAAAGACTTGCAGGGATGTTTTCTGTCCAGGCAGCTCCACTTGTGTGGTGGATCAGACCAATAATGCCTACTGTGTGACCTGTAATCGGATTTGCCCGGAACCCTC ATCTTCAGAGCAGTCCCTTTGCGGGAACGATGGTGTGACTTACTCCAGTGCCTGCCACCTGAGAAAGGCCACCTGCTTGCTGGGCAGATCCATTGGATTAGCCTATGAGGGAAAGTGTATCAAAGCAA AGTCTTGTGAAGACATCCAGTGCGGTGGTGGAAAAAAATGCCTATGGGATTTCAAGGTTGGCAGAGGTCGCTGCTCTCTCTGCGATGAGCTGTGCCCGGACAGTAAGTCGGATGAGCCCGTCTGTGCC AGCGACAATGCCACGTACGCCAGCGAGTGTGCCATGAAGGAAGCTGCCTGCTCCTCCGGCGTACTGCTTGAAGTGAAGCACTCCGGATCTTGCAACTGAATCTGCCTGTAAAACCTGAGCCATTGACT CTTCAGAACTTTCTGCAATTTTGACTTCATAGATTATGGTGGTTTGTTTTTTTGTTTTTTGTTTTTTGTTTTTGTTTTTTTTTAAGTAAGCATTACATAACTGCAGAGGCCCAAAAGACAAAACAAAA CAAACAAAAAACAAAAAACAAAAAAACCCAAAAAGCATCACACTGCAAGTCATGTAAAAATGCAACGCTGTAATGTGGCTGTGTCAGAGGGCTTTGAAAGCGTACACTGAGATGCTTCGGCGCTGTTG TTATCCGTGTTTAAACAACAGCTCCCCCTGTATTCCCCCATCTAGCCATCTCGGAAGAAACGGAGGAAGAGGAGGAAGAGGAAGACCAGGACTACAGCTTCCCTATCTCTTCCACTCTAGAGTGGTAA ACTGTCCAGCA
hide sequence
RefSeq Acc Id:
NP_036693 ⟸ NM_012561
- Peptide Label:
precursor
- UniProtKB:
Q80XW7 (UniProtKB/Swiss-Prot), P21674 (UniProtKB/Swiss-Prot)
- Sequence:
MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWK GPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKC LWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSTLEW
hide sequence
RefSeq Acc Id:
XP_006232015 ⟸ XM_006231953
- Peptide Label:
isoform X1
- Sequence:
MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWK GPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCITKSCEDIQCGGGKKCL WDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSTLEW
hide sequence
RefSeq Acc Id:
XP_006232016 ⟸ XM_006231954
- Peptide Label:
isoform X2
- Sequence:
MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWK GPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKC LWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
hide sequence
Ensembl Acc Id:
ENSRNOP00000015680 ⟸ ENSRNOT00000015680
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-03-29
Fst
follistatin
LOC686745
similar to follistatin
Data merged from RGD:1593716
737654
PROVISIONAL
2006-11-20
LOC686745
similar to follistatin
Symbol and Name status set to provisional
70820
PROVISIONAL
2002-06-10
Fst
follistatin
Symbol and Name status set to approved
70586
APPROVED
Note Type
Note
Reference
gene_disease
mRNA is overexpressed in some hepatocellular carcinomas
728764