Symbol:
Agrn
Name:
agrin
RGD ID:
2067
Description:
Enables calcium ion binding activity; cytokine binding activity; and dystroglycan binding activity. Involved in several processes, including positive regulation of macromolecule metabolic process; regulation of plasma membrane bounded cell projection organization; and synapse organization. Acts upstream of or within receptor clustering. Located in axonal growth cone; basement membrane; and synapse. Is active in glutamatergic synapse. Human ortholog(s) of this gene implicated in congenital myasthenic syndrome 8. Orthologous to human AGRN (agrin); PARTICIPATES IN acetylcholine signaling pathway via nicotinic acetylcholine receptor; cell-extracellular matrix signaling pathway; INTERACTS WITH (+)-pilocarpine; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AGR
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
AGRN (agrin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Agrn (agrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Agrn (agrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
AGRN (agrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
AGRN (agrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Agrn (agrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
AGRN (agrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
AGRN (agrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Agrn (agrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Agrn (agrin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
AGRN (agrin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
agrn (agrin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
agr-1
Alliance
DIOPT (Hieranoid|InParanoid|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
agrn
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 172,031,528 - 172,064,429 (-) NCBI GRCr8 mRatBN7.2 5 166,749,306 - 166,782,212 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 166,749,310 - 166,786,003 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 169,451,492 - 169,472,811 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 171,272,883 - 171,294,202 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 171,235,444 - 171,256,763 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 173,589,910 - 173,622,813 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 173,589,819 - 173,622,645 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 177,063,797 - 177,096,674 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 172,999,420 - 173,020,764 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 173,009,918 - 173,031,259 (-) NCBI Celera 5 164,949,181 - 164,970,209 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Agrn Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of AGRN protein CTD PMID:17971868 Agrn Rat 1,2-dimethylhydrazine multiple interactions ISO Agrn (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of AGRN mRNA CTD PMID:22206623 Agrn Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of AGRN mRNA CTD PMID:26496021 Agrn Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO AGRN (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Agrn Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Agrn (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of AGRN mRNA CTD PMID:21570461 Agrn Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of AGRN mRNA CTD PMID:33387578 Agrn Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of AGRN mRNA CTD PMID:34747641 Agrn Rat 2,4,6-tribromophenol increases expression ISO AGRN (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Agrn Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of AGRN mRNA CTD PMID:28522335 Agrn Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO AGRN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of AGRN mRNA CTD PMID:28628672 Agrn Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of AGRN mRNA CTD PMID:19162173 Agrn Rat 4,4'-sulfonyldiphenol decreases expression ISO Agrn (Mus musculus) 6480464 bisphenol S results in decreased expression of AGRN mRNA CTD PMID:39298647 Agrn Rat 4,4'-sulfonyldiphenol affects methylation ISO Agrn (Mus musculus) 6480464 bisphenol S affects the methylation of AGRN gene CTD PMID:31683443 Agrn Rat 4,4'-sulfonyldiphenol decreases methylation ISO AGRN (Homo sapiens) 6480464 bisphenol S results in decreased methylation of AGRN gene CTD PMID:31601247 Agrn Rat 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid decreases expression ISO AGRN (Homo sapiens) 6480464 Am 580 results in decreased expression of AGRN mRNA CTD PMID:16982809 Agrn Rat 4-hydroxynon-2-enal decreases expression ISO Agrn (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of AGRN mRNA CTD PMID:19191707 Agrn Rat 4-hydroxyphenyl retinamide increases expression ISO Agrn (Mus musculus) 6480464 Fenretinide results in increased expression of AGRN mRNA CTD PMID:28973697 Agrn Rat 5-aza-2'-deoxycytidine multiple interactions ISO AGRN (Homo sapiens) 6480464 [Decitabine co-treated with Vorinostat] affects the expression of AGRN mRNA CTD PMID:17330099 Agrn Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of AGRN mRNA CTD PMID:24780913 Agrn Rat acrolein multiple interactions ISO AGRN (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of AGRN mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of AGRN mRNA CTD PMID:32699268 Agrn Rat acrylamide decreases expression ISO AGRN (Homo sapiens) 6480464 Acrylamide results in decreased expression of AGRN mRNA CTD PMID:32763439 Agrn Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of AGRN mRNA CTD PMID:24977338 Agrn Rat Allylamine increases expression EXP 6480464 Allylamine results in increased expression of AGRN mRNA CTD PMID:15910882 Agrn Rat alpha-pinene multiple interactions ISO AGRN (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of AGRN mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of AGRN mRNA CTD PMID:32699268 Agrn Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of AGRN mRNA CTD PMID:16483693 Agrn Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of AGRN mRNA CTD PMID:30779732 Agrn Rat arsane affects methylation ISO AGRN (Homo sapiens) 6480464 Arsenic affects the methylation of AGRN gene CTD PMID:25304211 Agrn Rat arsane multiple interactions ISO AGRN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AGRN mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of AGRN mRNA CTD PMID:39836092 Agrn Rat arsenic atom affects methylation ISO AGRN (Homo sapiens) 6480464 Arsenic affects the methylation of AGRN gene CTD PMID:25304211 Agrn Rat arsenic atom multiple interactions ISO AGRN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AGRN mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of AGRN mRNA CTD PMID:39836092 Agrn Rat atrazine increases expression ISO AGRN (Homo sapiens) 6480464 Atrazine results in increased expression of AGRN mRNA CTD PMID:22378314 Agrn Rat benzo[a]pyrene decreases expression ISO Agrn (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of AGRN mRNA CTD PMID:19770486 Agrn Rat benzo[a]pyrene affects methylation ISO AGRN (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of AGRN promoter CTD PMID:27901495 Agrn Rat biochanin A decreases expression ISO AGRN (Homo sapiens) 6480464 biochanin A results in decreased expression of AGRN mRNA CTD PMID:12111696 Agrn Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of AGRN mRNA CTD PMID:26496021 Agrn Rat bisphenol A increases expression ISO Agrn (Mus musculus) 6480464 bisphenol A results in increased expression of AGRN mRNA CTD PMID:32156529 Agrn Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of AGRN mRNA CTD PMID:35192832 Agrn Rat bisphenol A multiple interactions ISO AGRN (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of AGRN gene CTD PMID:31601247 Agrn Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of AGRN mRNA CTD PMID:30816183 Agrn Rat bisphenol A affects expression ISO AGRN (Homo sapiens) 6480464 bisphenol A affects the expression of AGRN mRNA CTD PMID:30903817 Agrn Rat bisphenol A decreases methylation ISO Agrn (Mus musculus) 6480464 bisphenol A results in decreased methylation of AGRN promoter CTD PMID:27312807 Agrn Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of AGRN mRNA CTD PMID:25181051 Agrn Rat bisphenol F multiple interactions ISO AGRN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of AGRN mRNA CTD PMID:28628672 Agrn Rat bortezomib decreases expression ISO AGRN (Homo sapiens) 6480464 Bortezomib results in decreased expression of AGRN mRNA CTD PMID:20977926 Agrn Rat butan-1-ol multiple interactions ISO AGRN (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of AGRN mRNA CTD PMID:29432896 Agrn Rat butanal decreases expression ISO AGRN (Homo sapiens) 6480464 butyraldehyde results in decreased expression of AGRN mRNA CTD PMID:26079696 Agrn Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of AGRN mRNA CTD PMID:19010381 Agrn Rat cadmium dichloride increases expression ISO AGRN (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of AGRN mRNA CTD PMID:38382870 and PMID:38568856 Agrn Rat cadmium dichloride decreases expression ISO AGRN (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of AGRN mRNA CTD PMID:25596134 Agrn Rat camptothecin increases expression ISO AGRN (Homo sapiens) 6480464 Camptothecin results in increased expression of AGRN mRNA CTD PMID:17374387 Agrn Rat chlordecone increases expression ISO Agrn (Mus musculus) 6480464 Chlordecone results in increased expression of AGRN mRNA CTD PMID:33711761 Agrn Rat chloroacetaldehyde decreases expression ISO AGRN (Homo sapiens) 6480464 chloroacetaldehyde results in decreased expression of AGRN mRNA CTD PMID:25596134 Agrn Rat chlorpromazine decreases expression EXP 6480464 Chlorpromazine results in decreased expression of AGRN mRNA CTD PMID:25596134 Agrn Rat chlorpyrifos decreases expression ISO Agrn (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of AGRN mRNA CTD PMID:20350560 Agrn Rat chromium(6+) affects expression ISO Agrn (Mus musculus) 6480464 chromium hexavalent ion affects the expression of AGRN mRNA CTD PMID:28472532 Agrn Rat cidofovir anhydrous increases expression ISO AGRN (Homo sapiens) 6480464 Cidofovir results in increased expression of AGRN mRNA CTD PMID:25596134 Agrn Rat cisplatin increases expression ISO AGRN (Homo sapiens) 6480464 Cisplatin results in increased expression of AGRN mRNA CTD PMID:25596134 Agrn Rat clodronic acid increases expression ISO AGRN (Homo sapiens) 6480464 Clodronic Acid results in increased expression of AGRN mRNA CTD PMID:25596134 Agrn Rat clofibrate multiple interactions ISO Agrn (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of AGRN mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of AGRN mRNA] CTD PMID:17585979 Agrn Rat clofibrate decreases expression ISO Agrn (Mus musculus) 6480464 Clofibrate results in decreased expression of AGRN mRNA CTD PMID:23811191 Agrn Rat corosolic acid increases expression ISO AGRN (Homo sapiens) 6480464 corosolic acid results in increased expression of AGRN mRNA CTD PMID:37939859 Agrn Rat crocidolite asbestos increases expression ISO Agrn (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of AGRN mRNA CTD PMID:29279043 Agrn Rat cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of AGRN mRNA CTD PMID:25596134 Agrn Rat cyclosporin A decreases methylation ISO AGRN (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of AGRN promoter CTD PMID:27989131 Agrn Rat cyclosporin A decreases expression ISO AGRN (Homo sapiens) 6480464 Cyclosporine results in decreased expression of AGRN mRNA CTD PMID:25596134 Agrn Rat daunorubicin increases expression ISO AGRN (Homo sapiens) 6480464 Daunorubicin results in increased expression of AGRN mRNA CTD PMID:17374387 Agrn Rat dexamethasone decreases expression ISO AGRN (Homo sapiens) 6480464 Dexamethasone results in decreased expression of AGRN mRNA CTD PMID:25047013 Agrn Rat dexamethasone multiple interactions ISO AGRN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of AGRN mRNA CTD PMID:28628672 Agrn Rat Dibutyl phosphate affects expression ISO AGRN (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of AGRN mRNA CTD PMID:37042841 Agrn Rat dioxygen increases expression ISO Agrn (Mus musculus) 6480464 Oxygen deficiency results in increased expression of AGRN mRNA CTD PMID:24205000 Agrn Rat dioxygen increases expression ISO AGRN (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of AGRN mRNA CTD PMID:25596134 Agrn Rat elemental selenium increases expression ISO AGRN (Homo sapiens) 6480464 Selenium results in increased expression of AGRN mRNA CTD PMID:19244175 Agrn Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of AGRN mRNA CTD PMID:29391264 Agrn Rat ethanol affects expression EXP 6480464 Ethanol affects the expression of AGRN mRNA CTD PMID:11772933 Agrn Rat ethanol affects splicing ISO Agrn (Mus musculus) 6480464 Ethanol affects the splicing of AGRN mRNA CTD PMID:30319688 Agrn Rat ethanol increases expression ISO Agrn (Mus musculus) 6480464 Ethanol results in increased expression of AGRN mRNA CTD PMID:30319688 Agrn Rat ethyl methanesulfonate increases expression ISO AGRN (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of AGRN mRNA CTD PMID:23649840 Agrn Rat etoposide increases expression ISO AGRN (Homo sapiens) 6480464 Etoposide results in increased expression of AGRN mRNA CTD PMID:17374387 Agrn Rat fenofibrate decreases expression EXP 6480464 Fenofibrate results in decreased expression of AGRN mRNA CTD PMID:25596134 Agrn Rat fenthion decreases expression ISO Agrn (Mus musculus) 6480464 Fenthion results in decreased expression of AGRN mRNA CTD PMID:34813904 Agrn Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of AGRN mRNA CTD PMID:24136188 Agrn Rat folic acid multiple interactions ISO Agrn (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of AGRN mRNA CTD PMID:22206623 Agrn Rat fulvestrant multiple interactions ISO AGRN (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of AGRN gene CTD PMID:31601247 Agrn Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of AGRN mRNA CTD PMID:33387578 Agrn Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of AGRN gene CTD PMID:35440735 Agrn Rat hypochlorous acid decreases expression ISO Agrn (Mus musculus) 6480464 Hypochlorous Acid results in decreased expression of AGRN mRNA CTD PMID:19376150 Agrn Rat ifosfamide increases expression ISO AGRN (Homo sapiens) 6480464 Ifosfamide results in increased expression of AGRN mRNA CTD PMID:25596134 Agrn Rat indometacin multiple interactions ISO AGRN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of AGRN mRNA CTD PMID:28628672 Agrn Rat inulin multiple interactions ISO Agrn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of AGRN mRNA CTD PMID:36331819 Agrn Rat ivermectin decreases expression ISO AGRN (Homo sapiens) 6480464 Ivermectin results in decreased expression of AGRN protein CTD PMID:32959892 Agrn Rat linsidomine increases oxidation EXP 6480464 linsidomine results in increased oxidation of AGRN protein CTD PMID:28086193 Agrn Rat lipopolysaccharide multiple interactions ISO AGRN (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of AGRN mRNA CTD PMID:35877022 Agrn Rat manganese atom multiple interactions ISO AGRN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AGRN mRNA CTD PMID:39836092 Agrn Rat manganese(0) multiple interactions ISO AGRN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AGRN mRNA CTD PMID:39836092 Agrn Rat manganese(II) chloride multiple interactions ISO AGRN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AGRN mRNA CTD PMID:39836092 Agrn Rat mercury dichloride multiple interactions ISO Agrn (Mus musculus) 6480464 Mercuric Chloride inhibits the reaction [AGRN protein results in increased phosphorylation of CHRNB1 protein] CTD PMID:15045580 Agrn Rat metformin decreases expression EXP 6480464 Metformin results in decreased expression of AGRN mRNA CTD PMID:25596134 Agrn Rat methamphetamine increases expression ISO Agrn (Mus musculus) 6480464 Methamphetamine results in increased expression of AGRN mRNA CTD PMID:26307267 Agrn Rat methidathion decreases expression ISO Agrn (Mus musculus) 6480464 methidathion results in decreased expression of AGRN mRNA CTD PMID:34813904 Agrn Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of AGRN mRNA CTD PMID:38685447 Agrn Rat methyl methanesulfonate increases expression ISO AGRN (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of AGRN mRNA CTD PMID:23649840 Agrn Rat methylmercury chloride affects expression EXP 6480464 methylmercuric chloride affects the expression of AGRN mRNA CTD PMID:20864626 Agrn Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of AGRN mRNA CTD PMID:25729387 Agrn Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of AGRN mRNA CTD PMID:25729387 Agrn Rat ozone multiple interactions ISO AGRN (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of AGRN mRNA more ... CTD PMID:32699268 Agrn Rat paracetamol multiple interactions ISO Agrn (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of AGRN mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of AGRN mRNA] CTD PMID:17585979 Agrn Rat pentachlorophenol increases expression ISO Agrn (Mus musculus) 6480464 Pentachlorophenol results in increased expression of AGRN mRNA CTD PMID:23892564 Agrn Rat perfluorononanoic acid decreases expression ISO AGRN (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of AGRN mRNA CTD PMID:38568856 Agrn Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Agrn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of AGRN mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of AGRN mRNA CTD PMID:36331819 Agrn Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of AGRN mRNA CTD PMID:19162173 Agrn Rat perfluorooctanoic acid decreases expression ISO AGRN (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of AGRN protein CTD PMID:26879310 Agrn Rat pirinixic acid decreases expression ISO Agrn (Mus musculus) 6480464 pirinixic acid results in decreased expression of AGRN mRNA CTD PMID:17426115 Agrn Rat potassium dichromate increases expression ISO Agrn (Mus musculus) 6480464 Potassium Dichromate results in increased expression of AGRN mRNA CTD PMID:23608068 Agrn Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of AGRN protein CTD PMID:16777347 Agrn Rat reactive oxygen species multiple interactions EXP 6480464 Reactive Oxygen Species inhibits the reaction [DAG1 protein modified form binds to AGRN protein] CTD PMID:16672922 Agrn Rat resveratrol multiple interactions ISO AGRN (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of AGRN mRNA CTD PMID:23557933 Agrn Rat sarin decreases expression ISO AGRN (Homo sapiens) 6480464 Sarin results in decreased expression of AGRN mRNA CTD PMID:19522546 Agrn Rat SB 431542 multiple interactions ISO AGRN (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of AGRN protein CTD PMID:37664457 Agrn Rat selenium atom increases expression ISO AGRN (Homo sapiens) 6480464 Selenium results in increased expression of AGRN mRNA CTD PMID:19244175 Agrn Rat silicon dioxide decreases secretion ISO AGRN (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased secretion of AGRN protein CTD PMID:25895662 Agrn Rat silicon dioxide decreases expression ISO AGRN (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of AGRN mRNA CTD PMID:25895662 Agrn Rat silver atom decreases expression ISO Agrn (Mus musculus) 6480464 Silver results in decreased expression of AGRN mRNA CTD PMID:27131904 Agrn Rat silver(0) decreases expression ISO Agrn (Mus musculus) 6480464 Silver results in decreased expression of AGRN mRNA CTD PMID:27131904 Agrn Rat sodium arsenite increases expression ISO AGRN (Homo sapiens) 6480464 sodium arsenite results in increased expression of AGRN mRNA CTD PMID:17879257 and PMID:34032870 Agrn Rat sodium arsenite decreases expression ISO Agrn (Mus musculus) 6480464 sodium arsenite results in decreased expression of AGRN mRNA CTD PMID:37682722 Agrn Rat sodium arsenite multiple interactions ISO AGRN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AGRN mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of AGRN mRNA CTD PMID:39836092 Agrn Rat titanium dioxide decreases methylation ISO AGRN (Homo sapiens) 6480464 titanium dioxide results in decreased methylation of AGRN 3' UTR CTD PMID:34973136 Agrn Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of AGRN mRNA CTD PMID:25729387 Agrn Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of AGRN mRNA CTD PMID:25729387 Agrn Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of AGRN mRNA CTD PMID:33387578 Agrn Rat trichostatin A affects expression ISO AGRN (Homo sapiens) 6480464 trichostatin A affects the expression of AGRN mRNA CTD PMID:28542535 Agrn Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of AGRN mRNA CTD PMID:25596134 Agrn Rat valproic acid increases methylation ISO AGRN (Homo sapiens) 6480464 Valproic Acid results in increased methylation of AGRN gene CTD PMID:29154799 Agrn Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of AGRN mRNA CTD PMID:29427782 Agrn Rat valproic acid increases expression ISO AGRN (Homo sapiens) 6480464 Valproic Acid results in increased expression of AGRN mRNA CTD PMID:19101580 Agrn Rat vancomycin decreases expression ISO Agrn (Mus musculus) 6480464 Vancomycin results in decreased expression of AGRN mRNA CTD PMID:18930951 Agrn Rat vitamin E decreases expression ISO AGRN (Homo sapiens) 6480464 Vitamin E results in decreased expression of AGRN mRNA CTD PMID:19244175 Agrn Rat vorinostat multiple interactions ISO AGRN (Homo sapiens) 6480464 [decitabine co-treated with vorinostat] affects the expression of AGRN mRNA CTD PMID:17330099 Agrn Rat zoledronic acid increases expression ISO AGRN (Homo sapiens) 6480464 zoledronic acid results in increased expression of AGRN protein CTD PMID:28871336
Imported Annotations - KEGG (archival)
(+)-pilocarpine (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) acrylamide (ISO) all-trans-retinoic acid (EXP) Allylamine (EXP) alpha-pinene (ISO) ammonium chloride (EXP) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) biochanin A (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bortezomib (ISO) butan-1-ol (ISO) butanal (ISO) cadmium dichloride (EXP,ISO) camptothecin (ISO) chlordecone (ISO) chloroacetaldehyde (ISO) chlorpromazine (EXP) chlorpyrifos (ISO) chromium(6+) (ISO) cidofovir anhydrous (ISO) cisplatin (ISO) clodronic acid (ISO) clofibrate (ISO) corosolic acid (ISO) crocidolite asbestos (ISO) cyclosporin A (EXP,ISO) daunorubicin (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dioxygen (ISO) elemental selenium (ISO) endosulfan (EXP) ethanol (EXP,ISO) ethyl methanesulfonate (ISO) etoposide (ISO) fenofibrate (EXP) fenthion (ISO) flutamide (EXP) folic acid (ISO) fulvestrant (ISO) gentamycin (EXP) glyphosate (EXP) hypochlorous acid (ISO) ifosfamide (ISO) indometacin (ISO) inulin (ISO) ivermectin (ISO) linsidomine (EXP) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dichloride (ISO) metformin (EXP) methamphetamine (ISO) methidathion (ISO) methimazole (EXP) methyl methanesulfonate (ISO) methylmercury chloride (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) pentachlorophenol (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) pirinixic acid (ISO) potassium dichromate (ISO) progesterone (EXP) reactive oxygen species (EXP) resveratrol (ISO) sarin (ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) trichostatin A (ISO) troglitazone (EXP) valproic acid (EXP,ISO) vancomycin (ISO) vitamin E (ISO) vorinostat (ISO) zoledronic acid (ISO)
Biological Process
cell differentiation (IEA) chemical synaptic transmission (IMP,ISO) circadian rhythm (ISO) enzyme-linked receptor protein signaling pathway (ISO) motor neuron apoptotic process (ISO) negative regulation of P-type sodium:potassium-exchanging transporter activity (ISO) negative regulation of sodium ion export across plasma membrane (ISO) neuromuscular junction development (IBA,ISO,TAS) neurotransmitter receptor localization to postsynaptic specialization membrane (ISO) plasma membrane organization (ISO) positive regulation of filopodium assembly (IDA) positive regulation of GTPase activity (IDA) positive regulation of motor neuron apoptotic process (ISO) positive regulation of peptidyl-tyrosine phosphorylation (IDA) positive regulation of protein geranylgeranylation (ISO) positive regulation of protein phosphorylation (IMP,ISO) positive regulation of protein tyrosine kinase activity (ISO) positive regulation of Rac protein signal transduction (ISO) positive regulation of skeletal muscle acetylcholine-gated channel clustering (ISO) positive regulation of synaptic assembly at neuromuscular junction (ISO,ISS) positive regulation of transcription by RNA polymerase II (IDA,ISO) protein transport (ISO) Rac protein signal transduction (ISO) receptor clustering (IBA,IDA,IEA,ISO,ISS) regulation of axon guidance (IDA) regulation of cardiac muscle cell membrane potential (ISO) regulation of cardiac muscle contraction (ISO) regulation of microtubule cytoskeleton organization (IDA) regulation of protein phosphorylation (IDA) regulation of synapse organization (IDA,IMP) regulation of synaptic activity (ISO) regulation of synaptic assembly at neuromuscular junction (IEA) skeletal muscle acetylcholine-gated channel clustering (IDA,IMP) synapse assembly (IMP)
1.
Agrin binds BMP2, BMP4 and TGFbeta1.
Banyai L, etal., PLoS One. 2010 May 21;5(5):e10758. doi: 10.1371/journal.pone.0010758.
2.
Agrin induced morphological and structural changes in growth cones of cultured hippocampal neurons.
Bergstrom RA, etal., Neuroscience. 2007 Nov 9;149(3):527-36. Epub 2007 Aug 14.
3.
Agrin requires specific proteins to selectively activate ¿-aminobutyric acid neurons for pain suppression.
Erasso D, etal., Exp Neurol. 2014 Nov;261:646-53. doi: 10.1016/j.expneurol.2014.08.014. Epub 2014 Aug 21.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Dystroglycan-alpha, a dystrophin-associated glycoprotein, is a functional agrin receptor.
Gee SH, etal., Cell. 1994 Jun 3;77(5):675-86.
6.
Agrin becomes concentrated at neuroeffector junctions in developing rodent urinary bladder.
Gingras J, etal., Cell Tissue Res. 2005 Apr;320(1):115-25. Epub 2005 Feb 16.
7.
Agrin acts via a MuSK receptor complex.
Glass DJ, etal., Cell 1996 May 17;85(4):513-23.
8.
Alpha3Na+/K+-ATPase is a neuronal receptor for agrin.
Hilgenberg LG, etal., Cell. 2006 Apr 21;125(2):359-69.
9.
The COOH-terminal domain of agrin signals via a synaptic receptor in central nervous system neurons.
Hoover CL, etal., J Cell Biol. 2003 Jun 9;161(5):923-32.
10.
Lrp4 is a receptor for Agrin and forms a complex with MuSK.
Kim N, etal., Cell. 2008 Oct 17;135(2):334-42. doi: 10.1016/j.cell.2008.10.002. Epub 2008 Oct 9.
11.
Induction of filopodia-like protrusions by transmembrane agrin: role of agrin glycosaminoglycan chains and Rho-family GTPases.
Lin L, etal., Exp Cell Res. 2010 Aug 15;316(14):2260-77. doi: 10.1016/j.yexcr.2010.05.006. Epub 2010 May 13.
12.
Agrin mediates a rapid switch from electrical coupling to chemical neurotransmission during synaptogenesis.
Martin AO, etal., J Cell Biol. 2005 May 9;169(3):503-14.
13.
Transmembrane agrin regulates dendritic filopodia and synapse formation in mature hippocampal neuron cultures.
McCroskery S, etal., Neuroscience. 2009 Sep 29;163(1):168-79. doi: 10.1016/j.neuroscience.2009.06.012. Epub 2009 Jun 10.
14.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
15.
Agrin regulates rapsyn interaction with surface acetylcholine receptors, and this underlies cytoskeletal anchoring and clustering.
Moransard M, etal., J Biol Chem. 2003 Feb 28;278(9):7350-9. Epub 2002 Dec 16.
16.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
17.
Targeting of recombinant agrin to axonal growth cones.
Neuhuber B and Daniels MP, Mol Cell Neurosci. 2003 Dec;24(4):1180-96.
18.
Alternative splicing of agrin regulates its binding to heparin alpha-dystroglycan, and the cell surface.
O'Toole JJ, etal., Proc Natl Acad Sci U S A. 1996 Jul 9;93(14):7369-74.
19.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
20.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
21.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
22.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
23.
Structure and expression of a rat agrin.
Rupp F, etal., Neuron 1991 May;6(5):811-23.
24.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
25.
Neuregulin inhibits acetylcholine receptor aggregation in myotubes.
Trinidad JC and Cohen JB, J Biol Chem. 2004 Jul 23;279(30):31622-8. Epub 2004 May 20.
26.
Asparagine of z8 insert is critical for the affinity, conformation, and acetylcholine receptor-clustering activity of neural agrin.
Tseng CN, etal., J Biol Chem. 2010 Sep 3;285(36):27641-51. doi: 10.1074/jbc.M110.130625. Epub 2010 Jun 21.
27.
The neuromuscular junction: selective remodeling of synaptic regulators at the nerve/muscle interface.
Witzemann V, etal., Mech Dev. 2013 Jun-Aug;130(6-8):402-11. doi: 10.1016/j.mod.2012.09.004. Epub 2012 Sep 29.
28.
LRP4 serves as a coreceptor of agrin.
Zhang B, etal., Neuron. 2008 Oct 23;60(2):285-97. doi: 10.1016/j.neuron.2008.10.006.
29.
Structural basis of agrin-LRP4-MuSK signaling.
Zong Y, etal., Genes Dev. 2012 Feb 1;26(3):247-58. doi: 10.1101/gad.180885.111.
Agrn Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 172,031,528 - 172,064,429 (-) NCBI GRCr8 mRatBN7.2 5 166,749,306 - 166,782,212 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 166,749,310 - 166,786,003 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 169,451,492 - 169,472,811 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 171,272,883 - 171,294,202 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 171,235,444 - 171,256,763 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 173,589,910 - 173,622,813 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 173,589,819 - 173,622,645 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 177,063,797 - 177,096,674 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 172,999,420 - 173,020,764 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 173,009,918 - 173,031,259 (-) NCBI Celera 5 164,949,181 - 164,970,209 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
AGRN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 1,020,120 - 1,056,116 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 1,020,120 - 1,056,119 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 955,500 - 991,496 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 945,366 - 981,355 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 1,597,136 - 1,631,462 (-) NCBI Celera Cytogenetic Map 1 p36.33 NCBI HuRef 1 226,888 - 263,237 (+) NCBI HuRef CHM1_1 1 942,522 - 978,540 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 450,247 - 486,181 (+) NCBI T2T-CHM13v2.0
Agrn Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 156,249,747 - 156,281,997 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 156,249,747 - 156,281,945 (-) Ensembl GRCm39 Ensembl GRCm38 4 156,165,290 - 156,197,533 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 156,165,290 - 156,197,488 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 155,539,399 - 155,559,244 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 155,009,090 - 155,028,935 (-) NCBI MGSCv36 mm8 Celera 4 158,419,989 - 158,441,614 (-) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 88.55 NCBI
Agrn Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955486 9,675,214 - 9,704,991 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955486 9,674,103 - 9,704,994 (-) NCBI ChiLan1.0 ChiLan1.0
AGRN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 227,197,744 - 227,232,423 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 225,893,486 - 225,928,339 (-) NCBI NHGRI_mPanPan1 PanPan1.1 1 953,977 - 967,946 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 936,000 - 966,808 (+) Ensembl panpan1.1 panPan2
AGRN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 56,239,621 - 56,273,679 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 56,239,701 - 56,272,745 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 56,317,660 - 56,351,511 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 56,443,168 - 56,477,026 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 56,443,113 - 56,476,999 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 56,434,207 - 56,468,062 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 56,326,114 - 56,359,961 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 56,716,182 - 56,750,025 (+) NCBI UU_Cfam_GSD_1.0
Agrn Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 27,426,638 - 27,455,302 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936737 2,011,724 - 2,039,796 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936737 2,010,647 - 2,041,401 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
AGRN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 63,365,983 - 63,398,309 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 63,366,017 - 63,398,311 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 57,851,241 - 57,880,816 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
AGRN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 130,383,226 - 130,416,926 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 130,383,220 - 130,416,933 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 35,009,405 - 35,044,463 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Agrn
.
Predicted Target Of
Count of predictions: 1178 Count of miRNA genes: 262 Interacting mature miRNAs: 325 Transcripts: ENSRNOT00000042726, ENSRNOT00000045678, ENSRNOT00000046315, ENSRNOT00000047854 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat
RH127796
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 172,031,689 - 172,031,878 (+) Marker Load Pipeline mRatBN7.2 5 166,749,466 - 166,749,656 (+) MAPPER mRatBN7.2 Rnor_6.0 5 173,590,071 - 173,590,260 NCBI Rnor6.0 Rnor_5.0 5 177,063,958 - 177,064,147 UniSTS Rnor5.0 RGSC_v3.4 5 172,999,581 - 172,999,770 UniSTS RGSC3.4 Celera 5 164,949,342 - 164,949,531 UniSTS RH 3.4 Map 5 1172.9 UniSTS Cytogenetic Map 5 q36 UniSTS
RH94447
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 166,750,028 - 166,750,202 (+) MAPPER mRatBN7.2 Rnor_6.0 5 173,590,633 - 173,590,806 NCBI Rnor6.0 Rnor_5.0 5 177,064,520 - 177,064,693 UniSTS Rnor5.0 RGSC_v3.4 5 173,000,143 - 173,000,316 UniSTS RGSC3.4 Celera 5 164,949,904 - 164,950,077 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000045678 ⟹ ENSRNOP00000050623
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 166,749,310 - 166,786,003 (-) Ensembl Rnor_6.0 Ensembl 5 173,589,819 - 173,622,645 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000047854 ⟹ ENSRNOP00000040828
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 166,749,310 - 166,786,003 (-) Ensembl Rnor_6.0 Ensembl 5 173,589,914 - 173,611,202 (-) Ensembl
RefSeq Acc Id:
NM_175754 ⟹ NP_786930
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 172,031,528 - 172,052,825 (-) NCBI mRatBN7.2 5 166,749,306 - 166,770,603 (-) NCBI Rnor_6.0 5 173,589,910 - 173,611,202 (-) NCBI Rnor_5.0 5 177,063,797 - 177,096,674 (-) NCBI RGSC_v3.4 5 172,999,420 - 173,020,764 (-) RGD Celera 5 164,949,181 - 164,970,209 (-) RGD
Sequence:
TGCTTATCTCCTACCATGAACCTGGAGGGCTGGGGAGAGGACCTGGTGCTCCCCTAGCCATAACTGGCTAAACTTTGAGATCACAGCTGCATCTGCTGCTCCAGAGCACCCAGCATGGGGGGAGTAGC
hide sequence
RefSeq Acc Id:
XM_006239541 ⟹ XP_006239603
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 172,031,528 - 172,064,429 (-) NCBI mRatBN7.2 5 166,749,306 - 166,782,211 (-) NCBI Rnor_6.0 5 173,589,910 - 173,622,813 (-) NCBI Rnor_5.0 5 177,063,797 - 177,096,674 (-) NCBI
Sequence:
CCGCCTTGCTGCGGTCCAGTTCTGTCCTGCCCCCTGCACGGTCCGGCCCGCGCGCTCTCCCGGCTCCCTTCCGCCGTTCTGGGCTGCGCCATGGTCAGCCTGCGGCTGTGTTCCCGGGCCCCGCTGCT
hide sequence
RefSeq Acc Id:
XM_006239542 ⟹ XP_006239604
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 172,031,528 - 172,064,429 (-) NCBI mRatBN7.2 5 166,749,306 - 166,782,211 (-) NCBI Rnor_6.0 5 173,589,910 - 173,622,813 (-) NCBI Rnor_5.0 5 177,063,797 - 177,096,674 (-) NCBI
Sequence:
CCGCCTTGCTGCGGTCCAGTTCTGTCCTGCCCCCTGCACGGTCCGGCCCGCGCGCTCTCCCGGCTCCCTTCCGCCGTTCTGGGCTGCGCCATGGTCAGCCTGCGGCTGTGTTCCCGGGCCCCGCTGCT
hide sequence
RefSeq Acc Id:
XM_017593166 ⟹ XP_017448655
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 172,031,528 - 172,064,429 (-) NCBI mRatBN7.2 5 166,749,306 - 166,782,211 (-) NCBI Rnor_6.0 5 173,589,910 - 173,622,813 (-) NCBI
Sequence:
CCGCCTTGCTGCGGTCCAGTTCTGTCCTGCCCCCTGCACGGTCCGGCCCGCGCGCTCTCCCGGC
hide sequence
RefSeq Acc Id:
XM_017593167 ⟹ XP_017448656
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 172,031,528 - 172,064,429 (-) NCBI mRatBN7.2 5 166,749,306 - 166,782,211 (-) NCBI Rnor_6.0 5 173,589,910 - 173,622,813 (-) NCBI
Sequence:
CCGCCTTGCTGCGGTCCAGTTCTGTCCTGCCCCCTGCACGGTCCGGCCCGCGCGCTCTCCCGGC
hide sequence
RefSeq Acc Id:
XM_017593168 ⟹ XP_017448657
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 172,031,528 - 172,064,429 (-) NCBI mRatBN7.2 5 166,749,306 - 166,782,211 (-) NCBI Rnor_6.0 5 173,589,910 - 173,622,813 (-) NCBI
Sequence:
CCGCCTTGCTGCGGTCCAGTTCTGTCCTGCCCCCTGCACGGTCCGGCCCGCGCGCTCTCCCGGC
hide sequence
RefSeq Acc Id:
XM_017593169 ⟹ XP_017448658
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 172,031,528 - 172,064,429 (-) NCBI mRatBN7.2 5 166,749,306 - 166,782,212 (-) NCBI Rnor_6.0 5 173,589,910 - 173,622,813 (-) NCBI
Sequence:
CCGCCTTGCTGCGGTCCAGTTCTGTCCTGCCCCCTGCACGGTCCGGCCCGCGCGCTCTCCCGGC
hide sequence
RefSeq Acc Id:
XM_017593170 ⟹ XP_017448659
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 172,031,528 - 172,053,699 (-) NCBI mRatBN7.2 5 166,749,306 - 166,771,490 (-) NCBI Rnor_6.0 5 173,589,910 - 173,612,677 (-) NCBI
Sequence:
GAGGTTTGAGAGTAATCGCGGGCTGAAGAGTCGGACTTACTGGTACGGAAGCCTGATTTGAGGC
hide sequence
RefSeq Acc Id:
XM_039109320 ⟹ XP_038965248
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 172,031,528 - 172,044,775 (-) NCBI mRatBN7.2 5 166,749,306 - 166,763,068 (-) NCBI
RefSeq Acc Id:
XM_063287202 ⟹ XP_063143272
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 172,031,528 - 172,064,429 (-) NCBI
RefSeq Acc Id:
NP_786930 ⟸ NM_175754
- UniProtKB:
A6IUW3 (UniProtKB/TrEMBL)
- Sequence:
MPPLPLEHRPRQEPGASMLVRYFMIPCNICLILLATSTLGFAVLLFLSNYKPGIHFTPAPPTPPDVCRGMLCGFGAVCEPSVEDPGRASCVCKKNACPATVAPVCGSDASTYSNECELQRAQCNQQRR
hide sequence
RefSeq Acc Id:
XP_006239604 ⟸ XM_006239542
- Peptide Label:
isoform X6
- Sequence:
MVSLRLCSRAPLLPPLLLLVVAARTLPGASGTCPERALERREEEANVVLTGTVEEILNVDPVQH
hide sequence
RefSeq Acc Id:
XP_006239603 ⟸ XM_006239541
- Peptide Label:
isoform X5
- UniProtKB:
D4A2F1 (UniProtKB/TrEMBL), A6IUW3 (UniProtKB/TrEMBL)
- Sequence:
MVSLRLCSRAPLLPPLLLLVVAARTLPGASGTCPERALERREEEANVVLTGTVEEILNVDPVQH
hide sequence
RefSeq Acc Id:
XP_017448658 ⟸ XM_017593169
- Peptide Label:
isoform X4
- UniProtKB:
Q63034 (UniProtKB/Swiss-Prot), P25304 (UniProtKB/Swiss-Prot)
- Sequence:
MVSLRLCSRAPLLPPLLLLVVAARTLPGASGTCPERALERREEEANVVLTGTVEEILNVDPVQH
hide sequence
RefSeq Acc Id:
XP_017448656 ⟸ XM_017593167
- Peptide Label:
isoform X2
- UniProtKB:
Q63034 (UniProtKB/Swiss-Prot), P25304 (UniProtKB/Swiss-Prot)
- Sequence:
MVSLRLCSRAPLLPPLLLLVVAARTLPGASGTCPERALERREEEANVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDVVAQESLLDGGNKVVIGGFGDPLICDNQVSTGDTRIFFVNPAPPYMWP
hide sequence
RefSeq Acc Id:
XP_017448657 ⟸ XM_017593168
- Peptide Label:
isoform X3
- UniProtKB:
Q63034 (UniProtKB/Swiss-Prot), P25304 (UniProtKB/Swiss-Prot)
- Sequence:
MVSLRLCSRAPLLPPLLLLVVAARTLPGASGTCPERALERREEEANVVLTGTVEEILNVDPVQH
hide sequence
RefSeq Acc Id:
XP_017448655 ⟸ XM_017593166
- Peptide Label:
isoform X1
- UniProtKB:
Q63034 (UniProtKB/Swiss-Prot), P25304 (UniProtKB/Swiss-Prot)
- Sequence:
MVSLRLCSRAPLLPPLLLLVVAARTLPGASGTCPERALERREEEANVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDVVAQESLLDGGNKVVIGGFGDPLICDNQVSTGDTRIFFVNPAPPYMWP
hide sequence
RefSeq Acc Id:
XP_017448659 ⟸ XM_017593170
- Peptide Label:
isoform X8
- UniProtKB:
Q63034 (UniProtKB/Swiss-Prot), P25304 (UniProtKB/Swiss-Prot)
- Sequence:
MPPLPLEHRPRQEPGASMLVRYFMIPCNICLILLATSTLGFAVLLFLSNYKPGIHFTPAPPTPP
hide sequence
Ensembl Acc Id:
ENSRNOP00000040828 ⟸ ENSRNOT00000047854
Ensembl Acc Id:
ENSRNOP00000050623 ⟸ ENSRNOT00000045678
RefSeq Acc Id:
XP_038965248 ⟸ XM_039109320
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_063143272 ⟸ XM_063287202
- Peptide Label:
isoform X7
- UniProtKB:
A6IUW3 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Agrn
Agrin
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
null
contains141 cysteine residues
632164
gene_cellular_localization
localized to synapses
632164
gene_expression
expressed in embryonic spinal cord and muscle
632164
gene_process
may play a role in synaptic development and regeneration
632164
gene_protein
protein sequence contains1940 amino acid residues
632164
