Symbol:
Dlx1
Name:
distal-less homeobox 1
RGD ID:
1309593
Description:
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific; RNA polymerase II transcription regulatory region sequence-specific DNA binding activity; and chromatin binding activity. Predicted to be involved in several processes, including negative regulation of cellular response to growth factor stimulus; regulation of neuron differentiation; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including forebrain development; negative regulation of Notch signaling pathway; and negative regulation of oligodendrocyte differentiation. Predicted to be located in cytosol and nucleoplasm. Orthologous to human DLX1 (distal-less homeobox 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
homeobox Dlx1; homeobox protein DLX-1; LOC296500; MGC189409
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 76,763,864 - 76,768,454 (+) NCBI GRCr8 mRatBN7.2 3 56,356,190 - 56,360,780 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 56,356,190 - 56,360,780 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 59,754,121 - 59,758,700 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 68,337,729 - 68,342,308 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 66,099,889 - 66,104,437 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 58,164,931 - 58,169,521 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 58,164,931 - 58,169,521 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 64,650,292 - 64,654,882 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 53,837,052 - 53,841,642 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 53,733,423 - 53,738,014 (+) NCBI Celera 3 55,903,832 - 55,908,422 (+) NCBI Celera Cytogenetic Map 3 q23 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dlx1 Rat 1,2-dichloroethane decreases expression ISO Dlx1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of DLX1 mRNA CTD PMID:28960355 Dlx1 Rat 15-acetyldeoxynivalenol increases expression ISO DLX1 (Homo sapiens) 6480464 15-acetyldeoxynivalenol results in increased expression of DLX1 mRNA CTD PMID:23792671 Dlx1 Rat 17beta-estradiol multiple interactions ISO DLX1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of DLX1 mRNA CTD PMID:30165855 Dlx1 Rat 17beta-estradiol increases expression ISO DLX1 (Homo sapiens) 6480464 Estradiol results in increased expression of DLX1 mRNA CTD PMID:31614463 Dlx1 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO DLX1 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of DLX1 mRNA CTD PMID:29581250 Dlx1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dlx1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DLX1 mRNA CTD PMID:21570461 and PMID:24058054 Dlx1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DLX1 mRNA CTD PMID:32109520 and PMID:33387578 Dlx1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO DLX1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of DLX1 mRNA CTD PMID:20106945 more ... Dlx1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Dlx1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DLX1 mRNA CTD PMID:17586704 and PMID:19933214 Dlx1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Dlx1 Rat 2-palmitoylglycerol increases expression ISO DLX1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of DLX1 mRNA CTD PMID:37199045 Dlx1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Dlx1 (Mus musculus) 6480464 bisphenol S results in decreased expression of DLX1 mRNA CTD PMID:30951980 Dlx1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DLX1 mRNA CTD PMID:24780913 Dlx1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of DLX1 mRNA CTD PMID:31881176 Dlx1 Rat adefovir pivoxil decreases expression ISO DLX1 (Homo sapiens) 6480464 adefovir dipivoxil results in decreased expression of DLX1 mRNA CTD PMID:25596134 Dlx1 Rat aflatoxin B1 decreases methylation ISO DLX1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of DLX1 gene CTD PMID:27153756 Dlx1 Rat all-trans-retinoic acid decreases expression ISO Dlx1 (Mus musculus) 6480464 Tretinoin results in decreased expression of DLX1 protein CTD PMID:17551590 Dlx1 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of DLX1 mRNA CTD PMID:22262565 Dlx1 Rat all-trans-retinoic acid increases expression ISO DLX1 (Homo sapiens) 6480464 Tretinoin results in increased expression of DLX1 mRNA CTD PMID:21934132 Dlx1 Rat antirheumatic drug decreases expression ISO DLX1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of DLX1 mRNA CTD PMID:24449571 Dlx1 Rat arsenite(3-) increases methylation ISO DLX1 (Homo sapiens) 6480464 arsenite results in increased methylation of DLX1 promoter CTD PMID:23974009 Dlx1 Rat arsenous acid decreases expression ISO DLX1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of DLX1 mRNA CTD PMID:26705709 Dlx1 Rat benzo[a]pyrene decreases methylation ISO DLX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of DLX1 3' UTR and Benzo(a)pyrene results in decreased methylation of DLX1 5' UTR CTD PMID:27901495 Dlx1 Rat benzo[a]pyrene increases methylation ISO DLX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of DLX1 exon CTD PMID:27901495 Dlx1 Rat benzo[a]pyrene affects methylation ISO DLX1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DLX1 promoter CTD PMID:27901495 Dlx1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DLX1 mRNA CTD PMID:25181051 Dlx1 Rat bisphenol A decreases expression ISO Dlx1 (Mus musculus) 6480464 bisphenol A results in decreased expression of DLX1 mRNA CTD PMID:30951980 and PMID:32156529 Dlx1 Rat bisphenol F decreases expression ISO Dlx1 (Mus musculus) 6480464 bisphenol F results in decreased expression of DLX1 mRNA CTD PMID:30951980 Dlx1 Rat cadmium dichloride decreases expression ISO DLX1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of DLX1 mRNA CTD PMID:25596134 Dlx1 Rat CGP 52608 multiple interactions ISO DLX1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DLX1 gene] CTD PMID:28238834 Dlx1 Rat chloroacetaldehyde decreases expression ISO DLX1 (Homo sapiens) 6480464 chloroacetaldehyde results in decreased expression of DLX1 mRNA CTD PMID:25596134 Dlx1 Rat choline multiple interactions ISO Dlx1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of DLX1 gene CTD PMID:20938992 Dlx1 Rat cisplatin increases expression ISO DLX1 (Homo sapiens) 6480464 Cisplatin results in increased expression of DLX1 mRNA CTD PMID:27594783 Dlx1 Rat cisplatin multiple interactions ISO DLX1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of DLX1 mRNA CTD PMID:27392435 Dlx1 Rat cisplatin decreases expression ISO DLX1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of DLX1 mRNA CTD PMID:25596134 and PMID:27392435 Dlx1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of DLX1 mRNA CTD PMID:26577399 Dlx1 Rat Cyclopamine decreases expression ISO Dlx1 (Mus musculus) 6480464 cyclopamine results in decreased expression of DLX1 mRNA CTD PMID:20865013 Dlx1 Rat DDE increases expression ISO DLX1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of DLX1 mRNA CTD PMID:38568856 Dlx1 Rat diarsenic trioxide decreases expression ISO DLX1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of DLX1 mRNA CTD PMID:26705709 Dlx1 Rat dioxygen decreases expression ISO DLX1 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of DLX1 mRNA CTD PMID:25596134 Dlx1 Rat dorsomorphin multiple interactions ISO DLX1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DLX1 mRNA CTD PMID:27188386 Dlx1 Rat folic acid multiple interactions ISO Dlx1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of DLX1 gene CTD PMID:20938992 Dlx1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of DLX1 mRNA CTD PMID:33387578 Dlx1 Rat hydroquinone O-beta-D-glucopyranoside decreases expression ISO DLX1 (Homo sapiens) 6480464 Arbutin results in decreased expression of DLX1 mRNA CTD PMID:17103032 Dlx1 Rat ifosfamide decreases expression ISO DLX1 (Homo sapiens) 6480464 Ifosfamide results in decreased expression of DLX1 mRNA CTD PMID:25596134 Dlx1 Rat iron dichloride decreases expression ISO DLX1 (Homo sapiens) 6480464 ferrous chloride results in decreased expression of DLX1 mRNA CTD PMID:35984750 Dlx1 Rat kojic acid decreases expression ISO DLX1 (Homo sapiens) 6480464 kojic acid results in decreased expression of DLX1 mRNA CTD PMID:16595896 Dlx1 Rat L-methionine multiple interactions ISO Dlx1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of DLX1 gene CTD PMID:20938992 Dlx1 Rat methylmercury chloride increases expression ISO DLX1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of DLX1 mRNA CTD PMID:34089799 Dlx1 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of DLX1 mRNA CTD PMID:28801915 Dlx1 Rat nickel sulfate increases expression ISO DLX1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of DLX1 mRNA CTD PMID:22714537 Dlx1 Rat resveratrol multiple interactions ISO DLX1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of DLX1 mRNA CTD PMID:23557933 Dlx1 Rat SB 431542 multiple interactions ISO DLX1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DLX1 mRNA CTD PMID:27188386 Dlx1 Rat silicon dioxide increases expression ISO DLX1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of DLX1 mRNA CTD PMID:25895662 Dlx1 Rat sodium arsenite increases expression ISO DLX1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of DLX1 mRNA CTD PMID:22714537 more ... Dlx1 Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of DLX1 mRNA CTD PMID:22110744 Dlx1 Rat Theaflavin 3,3'-digallate affects expression ISO DLX1 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of DLX1 mRNA CTD PMID:34925699 Dlx1 Rat titanium dioxide decreases methylation ISO Dlx1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DLX1 gene CTD PMID:35295148 Dlx1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of DLX1 mRNA CTD PMID:33387578 Dlx1 Rat trichostatin A increases expression ISO DLX1 (Homo sapiens) 6480464 trichostatin A results in increased expression of DLX1 mRNA CTD PMID:24935251 Dlx1 Rat trichostatin A affects expression ISO DLX1 (Homo sapiens) 6480464 trichostatin A affects the expression of DLX1 mRNA CTD PMID:28542535 Dlx1 Rat triptonide increases expression ISO Dlx1 (Mus musculus) 6480464 triptonide results in increased expression of DLX1 mRNA CTD PMID:33045310 Dlx1 Rat urethane increases expression ISO DLX1 (Homo sapiens) 6480464 Urethane results in increased expression of DLX1 mRNA CTD PMID:28818685 Dlx1 Rat valproic acid affects expression ISO DLX1 (Homo sapiens) 6480464 Valproic Acid affects the expression of DLX1 mRNA CTD PMID:25979313 Dlx1 Rat valproic acid multiple interactions ISO DLX1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DLX1 mRNA CTD PMID:27188386 Dlx1 Rat valproic acid increases expression ISO DLX1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of DLX1 mRNA CTD PMID:26272509 Dlx1 Rat valproic acid increases expression ISO Dlx1 (Mus musculus) 6480464 Valproic Acid results in increased expression of DLX1 mRNA CTD PMID:24896083 Dlx1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of DLX1 mRNA CTD PMID:23869203 Dlx1 Rat zoledronic acid decreases expression ISO DLX1 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of DLX1 mRNA CTD PMID:25596134
1,2-dichloroethane (ISO) 15-acetyldeoxynivalenol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-palmitoylglycerol (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) adefovir pivoxil (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) antirheumatic drug (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) chloroacetaldehyde (ISO) choline (ISO) cisplatin (ISO) Cuprizon (EXP) Cyclopamine (ISO) DDE (ISO) diarsenic trioxide (ISO) dioxygen (ISO) dorsomorphin (ISO) folic acid (ISO) gentamycin (EXP) hydroquinone O-beta-D-glucopyranoside (ISO) ifosfamide (ISO) iron dichloride (ISO) kojic acid (ISO) L-methionine (ISO) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (EXP) nickel sulfate (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (EXP) Theaflavin 3,3'-digallate (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) zoledronic acid (ISO)
Biological Process
cellular response to BMP stimulus (IEA,ISO,ISS) cellular response to transforming growth factor beta stimulus (IEA,ISO,ISS) cerebral cortex GABAergic interneuron differentiation (ISO) cerebral cortex GABAergic interneuron fate commitment (IEA,ISO) embryonic skeletal system development (IEA,ISO) forebrain neuron differentiation (IEA,ISO) GABAergic neuron differentiation (ISO) hippocampus development (IEA,ISO) negative regulation of BMP signaling pathway (IEA,ISO,ISS) negative regulation of cellular response to transforming growth factor beta stimulus (IEA,ISO,ISS) negative regulation of neuron apoptotic process (IEA,ISO) negative regulation of Notch signaling pathway (IEA,ISO) negative regulation of oligodendrocyte differentiation (IEA,ISO) negative regulation of photoreceptor cell differentiation (IEA,ISO,ISS) negative regulation of transcription by RNA polymerase II (IEA,ISO,ISS) neuroblast differentiation (IEA,ISO) neuron apoptotic process (IEA,ISO) Notch signaling pathway (IEA,ISO) odontogenesis of dentin-containing tooth (IEA,ISO) oligodendrocyte differentiation (IEA,ISO) positive regulation of amacrine cell differentiation (IEA,ISO,ISS) positive regulation of cell differentiation (ISO,ISS) positive regulation of transcription by RNA polymerase II (IEA,ISO,ISS) proximal/distal pattern formation (IEA,ISO) regulation of transcription by RNA polymerase II (ISO) subpallium development (IEA,ISO)
Dlx1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 76,763,864 - 76,768,454 (+) NCBI GRCr8 mRatBN7.2 3 56,356,190 - 56,360,780 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 56,356,190 - 56,360,780 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 59,754,121 - 59,758,700 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 68,337,729 - 68,342,308 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 66,099,889 - 66,104,437 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 58,164,931 - 58,169,521 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 58,164,931 - 58,169,521 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 64,650,292 - 64,654,882 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 53,837,052 - 53,841,642 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 53,733,423 - 53,738,014 (+) NCBI Celera 3 55,903,832 - 55,908,422 (+) NCBI Celera Cytogenetic Map 3 q23 NCBI
DLX1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 172,085,507 - 172,089,674 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 172,084,740 - 172,089,677 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 172,950,235 - 172,954,402 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 172,658,454 - 172,662,648 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 166,566,309 - 166,570,503 (+) NCBI Celera Cytogenetic Map 2 q31.1 NCBI HuRef 2 164,830,459 - 164,834,653 (+) NCBI HuRef CHM1_1 2 172,957,684 - 172,961,878 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 172,570,383 - 172,575,917 (+) NCBI T2T-CHM13v2.0
Dlx1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 71,358,457 - 71,364,325 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 71,358,457 - 71,364,325 (+) Ensembl GRCm39 Ensembl GRCm38 2 71,528,113 - 71,533,981 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 71,528,113 - 71,533,981 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 71,367,502 - 71,372,037 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 71,330,284 - 71,334,819 (+) NCBI MGSCv36 mm8 Celera 2 73,193,503 - 73,198,048 (+) NCBI Celera Cytogenetic Map 2 C2 NCBI cM Map 2 42.61 NCBI
Dlx1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955449 2,920,478 - 2,924,667 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955449 2,920,705 - 2,924,667 (-) NCBI ChiLan1.0 ChiLan1.0
DLX1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 74,768,913 - 74,773,852 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 74,784,291 - 74,788,828 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 59,382,156 - 59,387,100 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 176,839,361 - 176,843,909 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 176,839,721 - 176,843,909 (+) Ensembl panpan1.1 panPan2
DLX1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 36 16,485,158 - 16,489,397 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 36 16,484,859 - 16,487,886 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 36 16,493,520 - 16,498,111 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 36 16,605,670 - 16,610,243 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 16,605,155 - 16,610,240 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 36 16,693,224 - 16,697,802 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 36 16,693,589 - 16,698,176 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 36 16,797,500 - 16,802,082 (+) NCBI UU_Cfam_GSD_1.0
Dlx1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 133,693,510 - 133,698,405 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936509 2,248,181 - 2,250,991 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936509 2,248,181 - 2,250,991 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DLX1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 78,185,790 - 78,191,226 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 78,186,667 - 78,191,788 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 87,613,190 - 87,617,605 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DLX1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 57,586,452 - 57,599,071 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 57,590,838 - 57,595,266 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 141,953,127 - 141,958,074 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dlx1
.
Predicted Target Of
Count of predictions: 181 Count of miRNA genes: 122 Interacting mature miRNAs: 156 Transcripts: ENSRNOT00000002078 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 9590286 Uminl1 Urine mineral level QTL 1 3.5 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 3 28249687 73249687 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 731180 Bp152 Blood pressure QTL 152 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 53781112 91609953 Rat 61356 Bp37 Blood pressure QTL 37 3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 8694196 Abfw2 Abdominal fat weight QTL 2 16.58 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 28249687 73249687 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1582249 Bw77 Body weight QTL 77 3.2 0.0025 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 64655484 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 12879868 Am6 Aortic mass QTL 6 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 31426403 70668733 Rat 11565451 Bw177 Body weight QTL 177 0.002 body mass (VT:0001259) body weight (CMO:0000012) 3 31426403 70668733 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 11565452 Kidm57 Kidney mass QTL 57 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 31426403 70668733 Rat 12879866 Cm94 Cardiac mass QTL 94 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 31426403 70668733 Rat 12879867 Cm95 Cardiac mass QTL 95 0.047 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 31426403 70668733 Rat 1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 61377 Edpm3 Estrogen-dependent pituitary mass QTL 3 7.05 0.038 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 53184692 89878207 Rat 2302055 Pia30 Pristane induced arthritis QTL 30 3.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 3 27936919 72936919 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2303593 Gluco46 Glucose level QTL 46 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 28468571 73468571 Rat 1354590 Despr11 Despair related QTL 11 0.000031 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 3 28468571 73468571 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 631647 Bp122 Blood pressure QTL 122 6.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1300169 Bp177 Blood pressure QTL 177 2.96 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 3 33703347 61017857 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2302276 Bw82 Body weight QTL 82 4.32 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 62951183 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 9590136 Scort3 Serum corticosterone level QTL 3 23.37 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 28249687 73249687 Rat 10450804 Scl70 Serum cholesterol level QTL 70 4.7 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 8552950 Pigfal12 Plasma insulin-like growth factor 1 level QTL 12 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 28249687 73249687 Rat 631676 Cm8 Cardiac mass QTL 8 7.03 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 3 16954708 61954708 Rat 10450794 Scl69 Serum cholesterol level QTL 69 6.3 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 8694386 Bw159 Body weight QTL 159 4.52 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 3 28249687 73249687 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 2301400 Cm68 Cardiac mass QTL 68 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 31426403 70668733 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat
BE112823
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 56,359,276 - 56,359,426 (+) MAPPER mRatBN7.2 Rnor_6.0 3 58,168,018 - 58,168,167 NCBI Rnor6.0 Rnor_5.0 3 64,653,379 - 64,653,528 UniSTS Rnor5.0 RGSC_v3.4 3 53,840,139 - 53,840,288 UniSTS RGSC3.4 Celera 3 55,906,919 - 55,907,068 UniSTS RH 3.4 Map 4 403.05 UniSTS Cytogenetic Map 3 q21 UniSTS
AU048745
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 5 q32 UniSTS Cytogenetic Map 13 q24 UniSTS Cytogenetic Map 6 q32 UniSTS Cytogenetic Map 17 p12 UniSTS Cytogenetic Map 16 p14 UniSTS Cytogenetic Map 13 q26 UniSTS Cytogenetic Map 10 q22 UniSTS Cytogenetic Map 7 q11 UniSTS Cytogenetic Map 8 q24 UniSTS Cytogenetic Map 5 q21 UniSTS Cytogenetic Map 4 q24 UniSTS Cytogenetic Map 2 q11 UniSTS Cytogenetic Map 1 q54 UniSTS Cytogenetic Map 1 q36 UniSTS Cytogenetic Map 18 p11 UniSTS Cytogenetic Map 13 q13 UniSTS Cytogenetic Map 10 q24 UniSTS Cytogenetic Map 8 q31 UniSTS Cytogenetic Map 3 q21 UniSTS Cytogenetic Map 13 p13 UniSTS Cytogenetic Map 1 q21 UniSTS Cytogenetic Map 11 q23 UniSTS Cytogenetic Map 10 q31 UniSTS Cytogenetic Map 16 q12.2 UniSTS Cytogenetic Map 3 q24 UniSTS Cytogenetic Map 5 q36 UniSTS Cytogenetic Map 3 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
2
39
109
56
50
25
14
25
5
142
70
91
36
53
25
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002078 ⟹ ENSRNOP00000002078
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 56,356,190 - 56,360,780 (+) Ensembl Rnor_6.0 Ensembl 3 58,164,931 - 58,169,521 (+) Ensembl
RefSeq Acc Id:
NM_001100531 ⟹ NP_001094001
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 76,763,864 - 76,768,454 (+) NCBI mRatBN7.2 3 56,356,190 - 56,360,780 (+) NCBI Rnor_6.0 3 58,164,931 - 58,169,521 (+) NCBI Rnor_5.0 3 64,650,292 - 64,654,882 (+) NCBI RGSC_v3.4 3 53,837,052 - 53,841,642 (+) RGD Celera 3 55,903,832 - 55,908,422 (+) RGD
Sequence:
CAGGCGTTGGGGGCGGGCGAAGGGTGGGGACAGCAAGGGGGAGGGCGACGGCAGGGCGCGGCTGGTTGGTTTCTGGGGCGGGAAGCGCGCGAGGGAGGCGGGAGGCTGGAGTCGCGCGCCTTCGAGGT
hide sequence
RefSeq Acc Id:
NP_001094001 ⟸ NM_001100531
- UniProtKB:
G3V669 (UniProtKB/TrEMBL), A6HM52 (UniProtKB/TrEMBL)
- Sequence:
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKI
hide sequence
Ensembl Acc Id:
ENSRNOP00000002078 ⟸ ENSRNOT00000002078
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Dlx1
distal-less homeobox 1
Dlx1_predicted
distal-less homeobox 1 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Dlx1_predicted
distal-less homeobox 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
