Symbol:
Rbx1
Name:
ring-box 1
RGD ID:
1308453
Description:
Predicted to enable several functions, including cullin family protein binding activity; ubiquitin protein ligase binding activity; and ubiquitin-like protein ligase activity. Predicted to contribute to ubiquitin-protein transferase activity. Predicted to be involved in several processes, including proteasome-mediated ubiquitin-dependent protein catabolic process; protein modification by small protein conjugation; and regulation of signal transduction. Predicted to act upstream of or within protein K48-linked ubiquitination; protein catabolic process; and protein monoubiquitination. Part of VCB complex. Orthologous to human RBX1 (ring-box 1); PARTICIPATES IN hypoxia inducible factor pathway; neddylation pathway; nuclear factor kappa B signaling pathway; INTERACTS WITH 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
E3 ubiquitin-protein ligase RBX1; LOC300084; MGC116275; ring-box 1, E3 ubiquitin protein ligase; ring-box 1-like; RING-box protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RBX1 (ring-box 1) HGNC
Ensembl, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Rbx1 (ring-box 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rbx1 (ring-box 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RBX1 (ring-box 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RBX1 (ring-box 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rbx1 (ring-box 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RBX1 (ring-box 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RBX1 (ring-box 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rbx1 (ring-box 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CRX (cone-rod homeobox) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
RBX1 (ring-box 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rbx1 (ring-box 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rbx1 (ring-box 1, E3 ubiquitin protein ligase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
HRT1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Roc1a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rbx-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 114,870,893 - 114,881,194 (+) NCBI GRCr8 mRatBN7.2 7 112,976,863 - 113,001,051 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 112,990,835 - 113,001,051 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 114,753,189 - 114,763,404 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 116,976,687 - 116,986,902 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 116,946,098 - 116,956,313 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 122,700,849 - 122,710,907 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 122,700,854 - 122,709,935 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 122,677,395 - 122,687,076 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 119,794,976 - 119,805,104 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 119,828,667 - 119,836,146 (+) NCBI Celera 7 109,310,166 - 109,320,235 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rbx1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RBX1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RBX1 mRNA CTD PMID:22079256 Rbx1 Rat (-)-epigallocatechin 3-gallate decreases expression ISO RBX1 (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of RBX1 mRNA CTD PMID:22079256 Rbx1 Rat 1,2-dimethylhydrazine decreases expression ISO Rbx1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of RBX1 mRNA CTD PMID:22206623 Rbx1 Rat 1,2-dimethylhydrazine multiple interactions ISO Rbx1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RBX1 mRNA CTD PMID:22206623 Rbx1 Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile increases expression EXP 6480464 Citalopram results in increased expression of RBX1 mRNA CTD PMID:28467792 Rbx1 Rat 17alpha-ethynylestradiol affects expression ISO Rbx1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of RBX1 mRNA CTD PMID:17555576 Rbx1 Rat 17alpha-ethynylestradiol multiple interactions ISO Rbx1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of RBX1 mRNA CTD PMID:17942748 Rbx1 Rat 17alpha-ethynylestradiol increases expression ISO Rbx1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of RBX1 mRNA CTD PMID:17942748 Rbx1 Rat 17beta-estradiol decreases expression ISO RBX1 (Homo sapiens) 6480464 Estradiol results in decreased expression of RBX1 mRNA CTD PMID:23019147 Rbx1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Rbx1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Rbx1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rbx1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of RBX1 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to RBX1 promoter] CTD PMID:17942748 and PMID:19654925 Rbx1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rbx1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RBX1 mRNA CTD PMID:21570461 and PMID:24680724 Rbx1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Rbx1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of RBX1 mRNA CTD PMID:19465110 Rbx1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of RBX1 mRNA CTD PMID:21346803 Rbx1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of RBX1 mRNA CTD PMID:21346803 Rbx1 Rat 2-acetamidofluorene increases expression ISO Rbx1 (Mus musculus) 6480464 2-Acetylaminofluorene results in increased expression of RBX1 mRNA CTD PMID:17317680 Rbx1 Rat 4,4'-diaminodiphenylmethane affects expression ISO Rbx1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of RBX1 mRNA CTD PMID:18648102 Rbx1 Rat 4,4'-sulfonyldiphenol increases expression ISO Rbx1 (Mus musculus) 6480464 bisphenol S results in increased expression of RBX1 mRNA CTD PMID:39298647 Rbx1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of RBX1 mRNA CTD PMID:36041667 Rbx1 Rat all-trans-retinoic acid increases expression ISO RBX1 (Homo sapiens) 6480464 Tretinoin results in increased expression of RBX1 mRNA CTD PMID:33167477 Rbx1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of RBX1 mRNA CTD PMID:38685447 Rbx1 Rat antimycin A decreases expression ISO RBX1 (Homo sapiens) 6480464 Antimycin A results in decreased expression of RBX1 mRNA CTD PMID:33512557 Rbx1 Rat arsenite(3-) multiple interactions ISO RBX1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to RBX1 mRNA] CTD PMID:32406909 Rbx1 Rat benzo[a]pyrene increases expression ISO Rbx1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of RBX1 mRNA CTD PMID:22228805 Rbx1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Rbx1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of RBX1 mRNA CTD PMID:21318169 Rbx1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Rbx1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of RBX1 mRNA CTD PMID:33754040 Rbx1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RBX1 mRNA CTD PMID:25181051 Rbx1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of RBX1 mRNA CTD PMID:36041667 Rbx1 Rat bisphenol A increases expression ISO RBX1 (Homo sapiens) 6480464 bisphenol A results in increased expression of RBX1 protein CTD PMID:37567409 Rbx1 Rat bisphenol A affects expression ISO RBX1 (Homo sapiens) 6480464 bisphenol A affects the expression of RBX1 mRNA CTD PMID:30903817 Rbx1 Rat bisphenol A decreases expression ISO RBX1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of RBX1 mRNA CTD PMID:29275510 Rbx1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of RBX1 mRNA CTD PMID:36041667 Rbx1 Rat cadmium atom multiple interactions ISO RBX1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RBX1 mRNA CTD PMID:35301059 Rbx1 Rat cadmium dichloride multiple interactions ISO RBX1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RBX1 mRNA CTD PMID:35301059 Rbx1 Rat caffeine decreases phosphorylation ISO RBX1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of RBX1 protein CTD PMID:35688186 Rbx1 Rat calycosin increases expression ISO RBX1 (Homo sapiens) 6480464 7 and 3'-dihydroxy-4'-methoxyisoflavone results in increased expression of RBX1 mRNA CTD PMID:24455688 Rbx1 Rat chloropicrin increases expression ISO RBX1 (Homo sapiens) 6480464 chloropicrin results in increased expression of RBX1 mRNA CTD PMID:26352163 Rbx1 Rat chlorpyrifos increases expression ISO Rbx1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of RBX1 mRNA CTD PMID:37019170 Rbx1 Rat cisplatin multiple interactions ISO RBX1 (Homo sapiens) 6480464 [Piroxicam co-treated with Cisplatin] results in increased expression of RBX1 mRNA CTD PMID:21858171 Rbx1 Rat citalopram increases expression EXP 6480464 Citalopram results in increased expression of RBX1 mRNA CTD PMID:28467792 Rbx1 Rat cobalt dichloride decreases expression ISO RBX1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of RBX1 mRNA CTD PMID:19376846 Rbx1 Rat copper atom multiple interactions ISO RBX1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of RBX1 mRNA CTD PMID:30911355 Rbx1 Rat copper(0) multiple interactions ISO RBX1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of RBX1 mRNA CTD PMID:30911355 Rbx1 Rat copper(II) sulfate decreases expression ISO RBX1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of RBX1 mRNA CTD PMID:19549813 Rbx1 Rat deguelin decreases expression ISO RBX1 (Homo sapiens) 6480464 deguelin results in decreased expression of RBX1 mRNA CTD PMID:33512557 Rbx1 Rat dibenzo[a,l]pyrene decreases expression ISO Rbx1 (Mus musculus) 6480464 dibenzo(a and l)pyrene results in decreased expression of RBX1 mRNA CTD PMID:25908611 Rbx1 Rat Dibutyl phosphate affects expression ISO RBX1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of RBX1 mRNA CTD PMID:37042841 Rbx1 Rat diclofenac decreases expression ISO Rbx1 (Mus musculus) 6480464 Diclofenac results in decreased expression of RBX1 mRNA CTD PMID:26934552 Rbx1 Rat dicrotophos decreases expression ISO RBX1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of RBX1 mRNA CTD PMID:28302478 Rbx1 Rat dinophysistoxin 1 increases expression ISO RBX1 (Homo sapiens) 6480464 dinophysistoxin 1 results in increased expression of RBX1 mRNA CTD PMID:28939011 Rbx1 Rat diuron decreases expression ISO RBX1 (Homo sapiens) 6480464 Diuron results in decreased expression of RBX1 mRNA CTD PMID:35967413 Rbx1 Rat doxorubicin decreases expression ISO RBX1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of RBX1 mRNA CTD PMID:29803840 Rbx1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of RBX1 mRNA CTD PMID:31464424 Rbx1 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of RBX1 protein CTD PMID:31464424 Rbx1 Rat escitalopram increases expression EXP 6480464 Escitalopram results in increased expression of RBX1 mRNA CTD PMID:28467792 Rbx1 Rat ethanol affects splicing ISO Rbx1 (Mus musculus) 6480464 Ethanol affects the splicing of RBX1 mRNA CTD PMID:30319688 Rbx1 Rat fenofibrate decreases expression ISO Rbx1 (Mus musculus) 6480464 Fenofibrate results in decreased expression of RBX1 mRNA CTD PMID:21318169 Rbx1 Rat ferroheme b increases expression ISO Rbx1 (Mus musculus) 6480464 Heme metabolite results in increased expression of RBX1 mRNA CTD PMID:19191707 Rbx1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of RBX1 mRNA CTD PMID:24136188 Rbx1 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of RBX1 mRNA CTD PMID:34044035 Rbx1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of RBX1 mRNA CTD PMID:24136188 Rbx1 Rat folic acid multiple interactions ISO Rbx1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RBX1 mRNA CTD PMID:22206623 Rbx1 Rat heme b increases expression ISO Rbx1 (Mus musculus) 6480464 Heme metabolite results in increased expression of RBX1 mRNA CTD PMID:19191707 Rbx1 Rat hypochlorous acid increases expression ISO Rbx1 (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of RBX1 mRNA CTD PMID:19376150 Rbx1 Rat ivermectin decreases expression ISO RBX1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of RBX1 protein CTD PMID:32959892 Rbx1 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of RBX1 mRNA CTD PMID:24136188 Rbx1 Rat maneb multiple interactions ISO Rbx1 (Mus musculus) 6480464 [Paraquat co-treated with Maneb] results in decreased expression of RBX1 mRNA CTD PMID:18386188 Rbx1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of RBX1 mRNA CTD PMID:38685447 Rbx1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of RBX1 mRNA CTD PMID:24136188 Rbx1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of RBX1 mRNA CTD PMID:24136188 Rbx1 Rat nitrates multiple interactions ISO Rbx1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of RBX1 mRNA CTD PMID:35964746 Rbx1 Rat okadaic acid increases expression ISO RBX1 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of RBX1 mRNA CTD PMID:28939011 Rbx1 Rat ozone multiple interactions ISO RBX1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of RBX1 mRNA CTD PMID:35430440 Rbx1 Rat paracetamol affects expression ISO Rbx1 (Mus musculus) 6480464 Acetaminophen affects the expression of RBX1 mRNA CTD PMID:17562736 Rbx1 Rat paraquat increases expression ISO Rbx1 (Mus musculus) 6480464 Paraquat results in increased expression of RBX1 mRNA CTD PMID:21371552 Rbx1 Rat paraquat multiple interactions ISO Rbx1 (Mus musculus) 6480464 [Paraquat co-treated with Maneb] results in decreased expression of RBX1 mRNA CTD PMID:18386188 Rbx1 Rat phenobarbital affects expression ISO RBX1 (Homo sapiens) 6480464 Phenobarbital affects the expression of RBX1 mRNA CTD PMID:19159669 Rbx1 Rat phorbol 13-acetate 12-myristate increases expression ISO RBX1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of RBX1 mRNA CTD PMID:19031421 Rbx1 Rat pinosylvin decreases expression ISO RBX1 (Homo sapiens) 6480464 pinosylvin results in decreased expression of RBX1 mRNA CTD PMID:23333577 Rbx1 Rat piroxicam multiple interactions ISO RBX1 (Homo sapiens) 6480464 [Piroxicam co-treated with Cisplatin] results in increased expression of RBX1 mRNA CTD PMID:21858171 Rbx1 Rat potassium chromate multiple interactions ISO RBX1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RBX1 mRNA CTD PMID:22079256 Rbx1 Rat potassium chromate decreases expression ISO RBX1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of RBX1 mRNA CTD PMID:22079256 Rbx1 Rat pyrimidifen decreases expression ISO RBX1 (Homo sapiens) 6480464 pyrimidifen results in decreased expression of RBX1 mRNA CTD PMID:33512557 Rbx1 Rat sertraline decreases expression ISO RBX1 (Homo sapiens) 6480464 Sertraline results in decreased expression of RBX1 mRNA CTD PMID:24865413 Rbx1 Rat sodium arsenate increases expression ISO Rbx1 (Mus musculus) 6480464 sodium arsenate results in increased expression of RBX1 mRNA CTD PMID:30953684 Rbx1 Rat sodium arsenite increases expression ISO RBX1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of RBX1 mRNA CTD PMID:28595984 and PMID:34032870 Rbx1 Rat sodium dichromate increases expression ISO Rbx1 (Mus musculus) 6480464 sodium bichromate results in increased expression of RBX1 mRNA CTD PMID:22155349 Rbx1 Rat solanesol multiple interactions ISO RBX1 (Homo sapiens) 6480464 solanesol inhibits the reaction [KEAP1 protein binds to CUL3 protein binds to RBX1 protein] CTD PMID:25645596 Rbx1 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of RBX1 mRNA CTD PMID:24136188 Rbx1 Rat tamoxifen affects expression ISO Rbx1 (Mus musculus) 6480464 Tamoxifen affects the expression of RBX1 mRNA CTD PMID:17555576 Rbx1 Rat tebufenpyrad decreases expression ISO RBX1 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of RBX1 mRNA CTD PMID:33512557 Rbx1 Rat thifluzamide decreases expression ISO RBX1 (Homo sapiens) 6480464 thifluzamide results in decreased expression of RBX1 mRNA CTD PMID:33512557 Rbx1 Rat titanium dioxide decreases methylation ISO Rbx1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of RBX1 gene CTD PMID:35295148 Rbx1 Rat trans-pinosylvin decreases expression ISO RBX1 (Homo sapiens) 6480464 pinosylvin results in decreased expression of RBX1 mRNA CTD PMID:23333577 Rbx1 Rat trovafloxacin increases expression ISO Rbx1 (Mus musculus) 6480464 trovafloxacin results in increased expression of RBX1 mRNA CTD PMID:35537566 Rbx1 Rat urethane decreases expression ISO RBX1 (Homo sapiens) 6480464 Urethane results in decreased expression of RBX1 mRNA CTD PMID:28818685 Rbx1 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of RBX1 mRNA CTD PMID:24136188 Rbx1 Rat valproic acid decreases expression ISO RBX1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of RBX1 mRNA CTD PMID:23179753 more ... Rbx1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of RBX1 mRNA CTD PMID:18042343 and PMID:23555832 Rbx1 Rat zoledronic acid decreases expression ISO RBX1 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of RBX1 protein CTD PMID:28871336
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-acetamidofluorene (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) all-trans-retinoic acid (ISO) amitrole (EXP) antimycin A (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calycosin (ISO) chloropicrin (ISO) chlorpyrifos (ISO) cisplatin (ISO) citalopram (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) deguelin (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) dicrotophos (ISO) dinophysistoxin 1 (ISO) diuron (ISO) doxorubicin (ISO) endosulfan (EXP) escitalopram (EXP) ethanol (ISO) fenofibrate (ISO) ferroheme b (ISO) finasteride (EXP) fipronil (EXP) flutamide (EXP) folic acid (ISO) heme b (ISO) hypochlorous acid (ISO) ivermectin (ISO) leflunomide (EXP) maneb (ISO) methimazole (EXP) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (ISO) paraquat (ISO) phenobarbital (ISO) phorbol 13-acetate 12-myristate (ISO) pinosylvin (ISO) piroxicam (ISO) potassium chromate (ISO) pyrimidifen (ISO) sertraline (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dichromate (ISO) solanesol (ISO) sulindac (EXP) tamoxifen (ISO) tebufenpyrad (ISO) thifluzamide (ISO) titanium dioxide (ISO) trans-pinosylvin (ISO) trovafloxacin (ISO) urethane (ISO) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP) zoledronic acid (ISO)
Biological Process
cellular response to amino acid stimulus (IEA,ISO) cellular response to oxidative stress (IEA,ISO) cellular response to UV (ISO) DNA damage response (ISO) negative regulation of insulin receptor signaling pathway (IEA,ISO) negative regulation of response to oxidative stress (IEA,ISO) negative regulation of type I interferon production (IEA,ISO) positive regulation of canonical NF-kappaB signal transduction (IEA,ISO) positive regulation of proteasomal ubiquitin-dependent protein catabolic process (IEA,ISO) positive regulation of protein autoubiquitination (IEA,ISO) positive regulation of protein catabolic process (IEA,ISO) positive regulation of TORC1 signaling (IEA,ISO) proteasome-mediated ubiquitin-dependent protein catabolic process (IEA,ISO) protein catabolic process (ISO) protein K48-linked ubiquitination (IEA,ISO) protein monoubiquitination (IEA,ISO) protein neddylation (IEA,ISO) protein polyubiquitination (IEA,ISO) protein ubiquitination (IBA,IEA,ISO) RNA polymerase II transcription initiation surveillance (IEA,ISO) SCF-dependent proteasomal ubiquitin-dependent protein catabolic process (IEA,ISO) spermatogenesis (IEA,ISO) T cell activation (IEA,ISO) transcription-coupled nucleotide-excision repair (IEA,ISO) ubiquitin-dependent protein catabolic process (IBA,IEA,ISO) ubiquitin-dependent protein catabolic process via the C-end degron rule pathway (IEA,ISO)
Cellular Component
Cul2-RING ubiquitin ligase complex (IEA,ISO) Cul3-RING ubiquitin ligase complex (IEA,ISO) Cul4-RING E3 ubiquitin ligase complex (IEA,ISO) Cul4A-RING E3 ubiquitin ligase complex (IEA,ISO) Cul4B-RING E3 ubiquitin ligase complex (IEA,ISO) Cul5-RING ubiquitin ligase complex (IEA,ISO) Cul7-RING ubiquitin ligase complex (IEA,ISO) cullin-RING ubiquitin ligase complex (IBA,IEA,ISO) cytoplasm (IEA,ISO) cytosol (ISO) nucleoplasm (IEA,ISO) nucleus (IBA,IEA,ISO) SCF ubiquitin ligase complex (IEA,ISO) VCB complex (IDA)
Molecular Function
cullin family protein binding (IBA,IEA,ISO) metal ion binding (IEA) molecular adaptor activity (ISO) NEDD8 ligase activity (IEA,ISO) protein binding (ISO) protein-containing complex binding (IPI) RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO) ubiquitin protein ligase activity (IBA,IEA,ISO) ubiquitin protein ligase binding (IEA,ISO) ubiquitin-protein transferase activity (IC,IEA,ISO) ubiquitin-ubiquitin ligase activity (IEA,ISO) zinc ion binding (IEA)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
The Nrf2 regulatory network provides an interface between redox and intermediary metabolism.
Hayes JD and Dinkova-Kostova AT, Trends Biochem Sci. 2014 Apr;39(4):199-218. doi: 10.1016/j.tibs.2014.02.002. Epub 2014 Mar 16.
3.
VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases.
Kamura T, etal., Genes Dev. 2004 Dec 15;18(24):3055-65.
4.
Muf1, a novel Elongin BC-interacting leucine-rich repeat protein that can assemble with Cul5 and Rbx1 to reconstitute a ubiquitin ligase.
Kamura T, etal., J Biol Chem. 2001 Aug 10;276(32):29748-53. Epub 2001 May 30.
5.
Rbx1, a component of the VHL tumor suppressor complex and SCF ubiquitin ligase.
Kamura T, etal., Science. 1999 Apr 23;284(5414):657-61.
6.
Expanding role of ubiquitination in NF-kappaB signaling.
Liu S and Chen ZJ, Cell Res. 2011 Jan;21(1):6-21. Epub 2010 Dec 7.
7.
Multiple roles of Rbx1 in the VBC-Cul2 ubiquitin ligase complex.
Megumi Y, etal., Genes Cells. 2005 Jul;10(7):679-91.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
An intact NEDD8 pathway is required for Cullin-dependent ubiquitylation in mammalian cells.
Ohh M, etal., EMBO Rep. 2002 Feb;3(2):177-82. Epub 2002 Jan 29.
10.
Nedd8 on cullin: building an expressway to protein destruction.
Pan ZQ, etal., Oncogene. 2004 Mar 15;23(11):1985-97.
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Regulation of oxygen homeostasis by hypoxia-inducible factor 1.
Semenza GL Physiology (Bethesda). 2009 Apr;24:97-106.
16.
Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
Zheng N, etal., Nature. 2002 Apr 18;416(6882):703-9.
Rbx1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 114,870,893 - 114,881,194 (+) NCBI GRCr8 mRatBN7.2 7 112,976,863 - 113,001,051 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 112,990,835 - 113,001,051 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 114,753,189 - 114,763,404 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 116,976,687 - 116,986,902 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 116,946,098 - 116,956,313 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 122,700,849 - 122,710,907 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 122,700,854 - 122,709,935 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 122,677,395 - 122,687,076 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 119,794,976 - 119,805,104 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 119,828,667 - 119,836,146 (+) NCBI Celera 7 109,310,166 - 109,320,235 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
RBX1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 40,951,378 - 40,973,309 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 40,951,347 - 40,973,309 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 41,347,382 - 41,369,313 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 39,677,331 - 39,698,614 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 39,671,884 - 39,693,168 NCBI Celera 22 25,151,059 - 25,172,347 (+) NCBI Celera Cytogenetic Map 22 q13.2 NCBI HuRef 22 24,308,951 - 24,330,592 (+) NCBI HuRef CHM1_1 22 41,306,113 - 41,327,855 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 41,423,571 - 41,445,506 (+) NCBI T2T-CHM13v2.0
Rbx1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 81,350,517 - 81,360,570 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 81,350,497 - 81,360,570 (+) Ensembl GRCm39 Ensembl GRCm38 15 81,466,316 - 81,476,369 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 81,466,296 - 81,476,369 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 81,296,746 - 81,306,799 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 81,293,628 - 81,303,619 (+) NCBI MGSCv36 mm8 Celera 15 83,584,172 - 83,594,608 (+) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 38.11 NCBI
Rbx1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 26,579,759 - 26,592,980 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 26,579,759 - 26,592,980 (+) NCBI ChiLan1.0 ChiLan1.0
RBX1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 50,781,027 - 50,802,296 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 53,480,935 - 53,503,770 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 21,845,351 - 21,866,627 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 39,941,405 - 39,962,175 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 39,941,405 - 39,962,175 (+) Ensembl panpan1.1 panPan2
RBX1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 24,265,733 - 24,280,253 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 24,266,408 - 24,280,235 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 24,200,859 - 24,214,782 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 25,014,111 - 25,028,037 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 25,013,516 - 25,028,019 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 24,729,691 - 24,743,612 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 25,050,324 - 25,064,237 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 25,224,699 - 25,238,847 (-) NCBI UU_Cfam_GSD_1.0
Rbx1
RBX1
RBX1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 23,500,361 - 23,521,676 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 23,500,356 - 23,522,723 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 101,955,371 - 101,977,480 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rbx1
.
Predicted Target Of
Count of predictions: 160 Count of miRNA genes: 140 Interacting mature miRNAs: 146 Transcripts: ENSRNOT00000025979 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
RH135115
Rat Assembly Chr Position (strand) Source JBrowse Rnor_6.0 7 122,710,269 - 122,710,460 NCBI Rnor6.0 RH 3.4 Map 7 882.2 UniSTS Cytogenetic Map 7 q34 UniSTS
RH137490
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 112,996,536 - 112,996,742 (+) MAPPER mRatBN7.2 Rnor_6.0 7 122,706,572 - 122,706,777 NCBI Rnor6.0 Rnor_5.0 7 122,682,583 - 122,682,788 UniSTS Rnor5.0 RGSC_v3.4 7 119,799,479 - 119,799,684 UniSTS RGSC3.4 Celera 7 109,315,848 - 109,316,053 UniSTS Cytogenetic Map 7 q34 UniSTS
RH131226
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 113,000,747 - 113,000,930 (+) MAPPER mRatBN7.2 Rnor_6.0 7 122,710,604 - 122,710,786 NCBI Rnor6.0 Rnor_5.0 7 122,686,773 - 122,686,955 UniSTS Rnor5.0 RGSC_v3.4 7 119,804,801 - 119,804,983 UniSTS RGSC3.4 Celera 7 109,319,932 - 109,320,114 UniSTS RH 3.4 Map 7 878.9 UniSTS Cytogenetic Map 7 q34 UniSTS
RH142947
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 112,992,368 - 112,992,491 (+) MAPPER mRatBN7.2 Rnor_6.0 7 122,702,383 - 122,702,505 NCBI Rnor6.0 Rnor_5.0 7 122,678,929 - 122,679,051 UniSTS Rnor5.0 Celera 7 109,311,700 - 109,311,822 UniSTS RH 3.4 Map 7 880.6 UniSTS Cytogenetic Map 7 q34 UniSTS
RH137754
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 112,991,861 - 112,992,039 (+) MAPPER mRatBN7.2 Rnor_6.0 7 122,701,876 - 122,702,053 NCBI Rnor6.0 Rnor_5.0 7 122,678,422 - 122,678,599 UniSTS Rnor5.0 Celera 7 109,311,193 - 109,311,370 UniSTS Cytogenetic Map 7 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000086603 ⟹ ENSRNOP00000069049
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 112,990,835 - 113,001,051 (+) Ensembl Rnor_6.0 Ensembl 7 122,700,854 - 122,709,935 (+) Ensembl
RefSeq Acc Id:
NM_001034135 ⟹ NP_001029307
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 114,870,979 - 114,881,194 (+) NCBI mRatBN7.2 7 112,990,835 - 113,001,051 (+) NCBI Rnor_6.0 7 122,700,849 - 122,710,907 (+) NCBI Rnor_5.0 7 122,677,395 - 122,687,076 (+) NCBI RGSC_v3.4 7 119,794,976 - 119,805,104 (+) RGD Celera 7 109,310,166 - 109,320,235 (+) NCBI
Sequence:
CCAAAATGGCGGCGGCGATGGATGTGGATACCCCCAGCGGCACCAACAGCGGCGCGGGCAAGAAGCGCTTTGAAGTTAAAAAGTGGAATGCAGTAGCCCTCTGGGCCTGGGATATTGTGGTTGATAAC
hide sequence
RefSeq Acc Id:
XM_039078842 ⟹ XP_038934770
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 114,870,893 - 114,881,194 (+) NCBI mRatBN7.2 7 112,990,797 - 113,001,051 (+) NCBI
RefSeq Acc Id:
NP_001029307 ⟸ NM_001034135
- UniProtKB:
Q498D8 (UniProtKB/TrEMBL), A0A0G2JUC8 (UniProtKB/TrEMBL)
- Sequence:
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
hide sequence
Ensembl Acc Id:
ENSRNOP00000069049 ⟸ ENSRNOT00000086603
RefSeq Acc Id:
XP_038934770 ⟸ XM_039078842
- Peptide Label:
isoform X1
RGD ID: 13695511 Promoter ID: EPDNEW_R6036 Type: multiple initiation site Name: Rbx1_1 Description: ring-box 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 122,700,840 - 122,700,900 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-13
Rbx1
ring-box 1
Rbx1
ring-box 1, E3 ubiquitin protein ligase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-05-24
Rbx1
ring-box 1, E3 ubiquitin protein ligase
LOC100363742
ring-box 1-like
Data merged from RGD:2322409
1643240 APPROVED
2012-10-10
Rbx1
ring-box 1, E3 ubiquitin protein ligase
Rbx1
ring-box 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-05-06
LOC100363742
ring-box 1-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-12-06
Rbx1
ring-box 1
Rbx1_predicted
ring-box 1 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Rbx1_predicted
ring-box 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
