Symbol:
Rpl23a (Ensembl: Rpl23al7)
Name:
ribosomal protein L23A (Ensembl:ribosomal protein L23A like 7)
RGD ID:
1304897
Description:
Enables large ribosomal subunit rRNA binding activity. Predicted to be involved in translation. Part of cytosolic large ribosomal subunit. Orthologous to human RPL23A (ribosomal protein L23a); PARTICIPATES IN ribosome biogenesis pathway; translation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrolein; ammonium chloride.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
60S ribosomal protein L23a; large ribosomal subunit protein uL23; LOC360572
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RPL23A (ribosomal protein L23a) RGD
RGD
Mus musculus (house mouse):
Rpl23a (ribosomal protein L23A) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Rpl23a (ribosomal protein L23a) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RPL23A (ribosomal protein L23a) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LOC106558887 (60S ribosomal protein L23a) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rpl23a (ribosomal protein L23a) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RPL23A (ribosomal protein L23a) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RPL23A (ribosomal protein L23a) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rpl23a (ribosomal protein L23a) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ITGB5 (integrin subunit beta 5) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
RPL23A (ribosomal protein L23a)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Mus musculus (house mouse):
Rpl23a (ribosomal protein L23A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Danio rerio (zebrafish):
rpl23a (ribosomal protein L23a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
rpl-25.1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPL25
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
RpL23A
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rpl-25.2
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rpl23a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Related Pseudogenes:
Rpl23a-ps20
Rpl23a-ps6
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 63,574,732 - 63,577,511 (-) NCBI GRCr8 mRatBN7.2 10 63,076,660 - 63,079,346 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 63,076,066 - 63,079,346 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 15 31,302,329 - 31,302,979 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 67,708,947 - 67,711,633 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 67,214,301 - 67,216,987 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 62,685,257 - 62,688,055 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 65,441,295 - 65,443,981 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 65,441,295 - 65,443,981 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 66,190,636 - 66,193,322 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 64,451,931 - 64,454,617 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 62,054,259 - 62,056,945 (-) NCBI Celera Cytogenetic Map 10 q25 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rpl23a Rat (-)-epigallocatechin 3-gallate decreases expression ISO RPL23A (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of RPL23A protein CTD PMID:31195006 Rpl23a Rat (1->4)-beta-D-glucan multiple interactions ISO Rpl23a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPL23A mRNA CTD PMID:36331819 Rpl23a Rat 1,2-dimethylhydrazine multiple interactions ISO Rpl23a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RPL23A mRNA CTD PMID:22206623 Rpl23a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rpl23a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of RPL23A mRNA CTD PMID:16214954 Rpl23a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RPL23A mRNA CTD PMID:33387578 and PMID:34747641 Rpl23a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Rpl23a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of RPL23A mRNA CTD PMID:19465110 and PMID:19770486 Rpl23a Rat 2,6-dimethoxyphenol multiple interactions ISO RPL23A (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Rpl23a Rat 2-hydroxypropanoic acid increases expression ISO RPL23A (Homo sapiens) 6480464 Lactic Acid results in increased expression of RPL23A mRNA CTD PMID:30851411 Rpl23a Rat 4,4'-sulfonyldiphenol increases expression ISO Rpl23a (Mus musculus) 6480464 bisphenol S results in increased expression of RPL23A mRNA CTD PMID:39298647 Rpl23a Rat 4,4'-sulfonyldiphenol increases expression ISO RPL23A (Homo sapiens) 6480464 bisphenol S results in increased expression of RPL23A protein CTD PMID:34186270 Rpl23a Rat acrolein increases expression EXP 6480464 Acrolein results in increased expression of RPL23A mRNA CTD PMID:38090360 Rpl23a Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RPL23A mRNA CTD PMID:16483693 Rpl23a Rat antirheumatic drug increases expression ISO RPL23A (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of RPL23A mRNA CTD PMID:24449571 Rpl23a Rat aristolochic acid A decreases expression ISO RPL23A (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of RPL23A mRNA and aristolochic acid I results in decreased expression of RPL23A protein CTD PMID:33212167 Rpl23a Rat arsenite(3-) multiple interactions ISO RPL23A (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to RPL23A mRNA] and arsenite promotes the reaction [G3BP1 protein binds to RPL23A protein] CTD PMID:32406909 Rpl23a Rat benzo[a]pyrene decreases expression ISO Rpl23a (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of RPL23A mRNA CTD PMID:19770486 Rpl23a Rat bis(2-ethylhexyl) phthalate increases expression ISO Rpl23a (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of RPL23A mRNA CTD PMID:33754040 Rpl23a Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RPL23A mRNA CTD PMID:25181051 Rpl23a Rat bisphenol A decreases expression ISO RPL23A (Homo sapiens) 6480464 bisphenol A results in decreased expression of RPL23A protein CTD PMID:34186270 and PMID:37567409 Rpl23a Rat bisphenol AF increases expression ISO RPL23A (Homo sapiens) 6480464 bisphenol AF results in increased expression of RPL23A protein CTD PMID:34186270 Rpl23a Rat Bisphenol B increases expression ISO RPL23A (Homo sapiens) 6480464 bisphenol B results in increased expression of RPL23A protein CTD PMID:34186270 Rpl23a Rat bisphenol F increases expression ISO RPL23A (Homo sapiens) 6480464 bisphenol F results in increased expression of RPL23A protein CTD PMID:34186270 Rpl23a Rat carbon nanotube affects expression ISO Rpl23a (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of RPL23A protein CTD PMID:21135415 Rpl23a Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of RPL23A mRNA CTD PMID:18500788 Rpl23a Rat chloropicrin increases expression ISO RPL23A (Homo sapiens) 6480464 chloropicrin results in increased expression of RPL23A mRNA CTD PMID:26352163 Rpl23a Rat chromium(6+) affects expression ISO Rpl23a (Mus musculus) 6480464 chromium hexavalent ion affects the expression of RPL23A mRNA CTD PMID:28472532 Rpl23a Rat cisplatin multiple interactions ISO RPL23A (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of RPL23A mRNA CTD PMID:27392435 Rpl23a Rat cisplatin increases expression ISO RPL23A (Homo sapiens) 6480464 Cisplatin results in increased expression of RPL23A mRNA CTD PMID:27392435 Rpl23a Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of RPL23A mRNA CTD PMID:17602206 Rpl23a Rat copper(II) sulfate decreases expression ISO RPL23A (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of RPL23A mRNA CTD PMID:19549813 Rpl23a Rat cylindrospermopsin increases expression ISO Rpl23a (Mus musculus) 6480464 cylindrospermopsin results in increased expression of RPL23A mRNA CTD PMID:20936652 Rpl23a Rat dihydroartemisinin affects binding ISO RPL23A (Homo sapiens) 6480464 artenimol analog binds to RPL23A protein CTD PMID:26340163 Rpl23a Rat enzyme inhibitor multiple interactions ISO RPL23A (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of RPL23A protein CTD PMID:23301498 Rpl23a Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of RPL23A mRNA CTD PMID:24136188 Rpl23a Rat folic acid multiple interactions ISO Rpl23a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RPL23A mRNA CTD PMID:22206623 Rpl23a Rat FR900359 increases phosphorylation ISO RPL23A (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of RPL23A protein CTD PMID:37730182 Rpl23a Rat furan increases expression EXP 6480464 furan results in increased expression of RPL23A mRNA CTD PMID:26194646 Rpl23a Rat furfural multiple interactions ISO RPL23A (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Rpl23a Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of RPL23A mRNA CTD PMID:24136188 Rpl23a Rat hydralazine multiple interactions ISO RPL23A (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of RPL23A mRNA CTD PMID:17183730 Rpl23a Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of RPL23A mRNA CTD PMID:36868495 Rpl23a Rat inulin multiple interactions ISO Rpl23a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of RPL23A mRNA CTD PMID:36331819 Rpl23a Rat ivermectin decreases expression ISO RPL23A (Homo sapiens) 6480464 Ivermectin results in decreased expression of RPL23A protein CTD PMID:32959892 Rpl23a Rat lead(0) affects expression ISO RPL23A (Homo sapiens) 6480464 Lead affects the expression of RPL23A mRNA CTD PMID:28903495 Rpl23a Rat lipopolysaccharide multiple interactions ISO RPL23A (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of RPL23A mRNA CTD PMID:35877022 Rpl23a Rat methotrexate affects response to substance ISO RPL23A (Homo sapiens) 6480464 RPL23A protein affects the susceptibility to Methotrexate CTD PMID:16217747 Rpl23a Rat paclitaxel decreases response to substance ISO RPL23A (Homo sapiens) 6480464 RPL23A mRNA results in decreased susceptibility to Paclitaxel CTD PMID:16322897 Rpl23a Rat paracetamol affects expression ISO Rpl23a (Mus musculus) 6480464 Acetaminophen affects the expression of RPL23A mRNA CTD PMID:17562736 Rpl23a Rat parathion increases expression ISO Rpl23a (Mus musculus) 6480464 Parathion results in increased expression of RPL23A mRNA CTD PMID:34813904 Rpl23a Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Rpl23a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPL23A mRNA more ... CTD PMID:36331819 Rpl23a Rat perfluorooctanoic acid increases expression ISO RPL23A (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of RPL23A protein CTD PMID:26879310 Rpl23a Rat rac-lactic acid increases expression ISO RPL23A (Homo sapiens) 6480464 Lactic Acid results in increased expression of RPL23A mRNA CTD PMID:30851411 Rpl23a Rat SB 431542 multiple interactions ISO RPL23A (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of RPL23A protein CTD PMID:37664457 Rpl23a Rat sodium arsenite increases expression ISO RPL23A (Homo sapiens) 6480464 sodium arsenite results in increased expression of RPL23A mRNA CTD PMID:21457566 Rpl23a Rat sodium arsenite multiple interactions ISO RPL23A (Homo sapiens) 6480464 sodium arsenite results in decreased expression of and results in increased activity of RPL23A protein CTD PMID:30528433 Rpl23a Rat sodium arsenite decreases expression ISO RPL23A (Homo sapiens) 6480464 sodium arsenite results in decreased expression of RPL23A mRNA CTD PMID:38568856 Rpl23a Rat sodium chloride multiple interactions ISO RPL23A (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of RPL23A protein more ... CTD PMID:38598786 Rpl23a Rat sodium fluoride decreases expression ISO Rpl23a (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of RPL23A protein CTD PMID:28918527 Rpl23a Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of RPL23A mRNA CTD PMID:34492290 Rpl23a Rat valproic acid multiple interactions ISO RPL23A (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of RPL23A mRNA CTD PMID:17183730 Rpl23a Rat valproic acid increases methylation ISO RPL23A (Homo sapiens) 6480464 Valproic Acid results in increased methylation of RPL23A gene CTD PMID:29154799 Rpl23a Rat zearalenone decreases expression ISO Rpl23a (Mus musculus) 6480464 Zearalenone results in decreased expression of RPL23A mRNA CTD PMID:30138655
Rpl23a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 63,574,732 - 63,577,511 (-) NCBI GRCr8 mRatBN7.2 10 63,076,660 - 63,079,346 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 63,076,066 - 63,079,346 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 15 31,302,329 - 31,302,979 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 67,708,947 - 67,711,633 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 67,214,301 - 67,216,987 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 62,685,257 - 62,688,055 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 65,441,295 - 65,443,981 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 65,441,295 - 65,443,981 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 66,190,636 - 66,193,322 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 64,451,931 - 64,454,617 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 62,054,259 - 62,056,945 (-) NCBI Celera Cytogenetic Map 10 q25 NCBI
RPL23A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 28,719,985 - 28,724,359 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 28,719,985 - 28,724,359 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 27,047,003 - 27,051,377 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 24,071,127 - 24,075,501 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 24,071,017 - 24,075,500 NCBI Celera 17 23,906,165 - 23,910,537 (+) NCBI Celera Cytogenetic Map 17 q11.2 NCBI HuRef 17 23,255,900 - 23,260,272 (+) NCBI HuRef CHM1_1 17 27,109,472 - 27,113,844 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 29,662,794 - 29,667,166 (+) NCBI T2T-CHM13v2.0
Rpl23a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 78,071,761 - 78,074,410 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 78,071,758 - 78,074,410 (-) Ensembl GRCm39 Ensembl GRCm38 11 78,180,935 - 78,183,584 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 78,180,932 - 78,183,584 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 77,994,437 - 77,997,086 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 77,997,130 - 77,999,738 (-) NCBI MGSCv36 mm8 Celera 11 85,680,808 - 85,683,457 (-) NCBI Celera Cytogenetic Map 11 B5 NCBI cM Map 11 46.74 NCBI
Rpl23a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955481 4,433,417 - 4,437,754 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955481 4,433,367 - 4,437,838 (-) NCBI ChiLan1.0 ChiLan1.0
RPL23A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 35,735,384 - 35,741,278 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 37,615,906 - 37,620,420 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 28,051,502 - 28,055,630 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 28,556,527 - 28,561,032 (-) NCBI panpan1.1 PanPan1.1 panPan2
LOC106558887 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 11,192,720 - 11,193,214 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 12,818,516 - 12,818,999 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 11,192,761 - 11,193,244 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 43,733,264 - 43,736,897 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 11,061,449 - 11,061,932 (+) NCBI UMICH_Zoey_3.1
Rpl23a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 42,051,881 - 42,055,814 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936538 4,929,895 - 4,933,761 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936538 4,929,893 - 4,933,759 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RPL23A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 44,957,142 - 44,960,735 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 44,956,851 - 44,960,737 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 46,941,786 - 46,945,674 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RPL23A
Rpl23a
.
Predicted Target Of
Count of predictions: 43 Count of miRNA genes: 41 Interacting mature miRNAs: 43 Transcripts: ENSRNOT00000035657 Prediction methods: Microtar, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1331839 Eae18b Experimental allergic encephalomyelitis QTL 18b 5.8 0.03 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 10 61248303 67785171 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631526 Bp76 Blood pressure QTL 76 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 61345413 66743655 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
38
94
64
60
48
6
48
6
144
56
82
34
49
12
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000035657 ⟹ ENSRNOP00000036391
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 63,076,066 - 63,079,346 (-) Ensembl Rnor_6.0 Ensembl 10 65,441,295 - 65,443,981 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114672 ⟹ ENSRNOP00000082672
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 63,076,660 - 63,079,341 (-) Ensembl
RefSeq Acc Id:
NM_001108283 ⟹ NP_001101753
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 63,574,732 - 63,577,418 (-) NCBI mRatBN7.2 10 63,076,660 - 63,079,346 (-) NCBI Rnor_6.0 10 65,441,295 - 65,443,981 (-) NCBI Rnor_5.0 10 66,190,636 - 66,193,322 (+) NCBI RGSC_v3.4 10 64,451,931 - 64,454,617 (+) RGD Celera 10 62,054,259 - 62,056,945 (-) RGD
Sequence:
CTCATGGGAATGAGGCTGGGTAACCCTTTTCGCCAAGATGGCGCCGAAAGCGAAGAAGGAAGCTCCTGCCCCTCCCAAAGCCGAAGCCAAAGCGAAGGCCTTGAAAGCTAAGAAGGCAGTGCTGAAAG
hide sequence
RefSeq Acc Id:
XM_063269378 ⟹ XP_063125448
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 63,574,738 - 63,577,511 (-) NCBI
RefSeq Acc Id:
NP_001101753 ⟸ NM_001108283
- UniProtKB:
P62752 (UniProtKB/Swiss-Prot), B5DES1 (UniProtKB/TrEMBL), D3ZTX9 (UniProtKB/TrEMBL)
- Sequence:
MAPKAKKEAPAPPKAEAKAKALKAKKAVLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLI
hide sequence
Ensembl Acc Id:
ENSRNOP00000036391 ⟸ ENSRNOT00000035657
Ensembl Acc Id:
ENSRNOP00000082672 ⟸ ENSRNOT00000114672
RefSeq Acc Id:
XP_063125448 ⟸ XM_063269378
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QIC1 (UniProtKB/TrEMBL), D3ZTX9 (UniProtKB/TrEMBL)
RGD ID: 13697469 Promoter ID: EPDNEW_R7994 Type: multiple initiation site Name: Rpl23a_1 Description: ribosomal protein L23a SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 65,443,956 - 65,444,016 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-04-07
Rpl23a
ribosomal protein L23A
Rpl23a
ribosomal protein L23a
Name changed
629549 APPROVED
2005-12-06
Rpl23a
ribosomal protein L23a
Rpl23a_predicted
ribosomal protein L23a (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Rpl23a_predicted
ribosomal protein L23a (predicted)
Symbol and Name status set to approved
70820 APPROVED
