Symbol:
Csnk2a1
Name:
casein kinase 2, alpha 1 polypeptide
RGD ID:
733324
MGI Page
MGI
Description:
Enables beta-catenin binding activity; kinase activity; and protein phosphatase regulator activity. Acts upstream of or within protein autophosphorylation. Predicted to be located in chromatin and nucleoplasm. Predicted to be part of PcG protein complex; Sin3-type complex; and protein kinase CK2 complex. Predicted to be active in PML body and cytosol. Is expressed in several structures, including alimentary system; brain; genitourinary system; integumental system; and sensory organ. Orthologous to several human genes including CSNK2A1 (casein kinase 2 alpha 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
casein kinase II subunit alpha; casein kinase II, alpha 1 polypeptide; casein kinase II, alpha 1 related sequence 4; CK II alpha; CK2; Csnk2a; Csnk2a1-rs4; MGC102141
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CSNK2A1 (casein kinase 2 alpha 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, NCBI, OMA, OrthoDB, Panther, Treefam
Rattus norvegicus (Norway rat):
Csnk2a1 (casein kinase 2 alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Csnk2a1 (casein kinase 2 alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CSNK2A1 (casein kinase 2 alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CSNK2A1 (casein kinase 2 alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Csnk2a1 (casein kinase 2 alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CSNK2A1 (casein kinase 2 alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CSNK2A1 (casein kinase 2 alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Csnk2a1 (casein kinase 2 alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CSNK2A3 (casein kinase 2 alpha 3) HGNC
Ensembl, OrthoDB, OrthoMCL, Panther
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Csnk2a1 (casein kinase 2 alpha 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CSNK2A1 (casein kinase 2 alpha 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CSNK2A3 (casein kinase 2 alpha 3)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
csnk2a4 (casein kinase 2, alpha 4 polypeptide)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
csnk2a1 (casein kinase 2, alpha 1 polypeptide)
Alliance
DIOPT (Ensembl Compara|InParanoid|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
zgc:86598
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CKA1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CkIIalpha
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
kin-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CKA2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
csnk2a1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Csnk2a1-ps3
Csnk2a1-ps4
Gm18721
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 152,068,468 - 152,123,772 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 152,068,759 - 152,123,772 (+) Ensembl GRCm39 Ensembl GRCm38 2 152,226,535 - 152,281,856 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 152,226,839 - 152,281,852 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 152,052,576 - 152,107,588 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 151,918,392 - 151,973,288 (+) NCBI MGSCv36 mm8 Celera 2 158,043,147 - 158,095,936 (+) NCBI Celera Cytogenetic Map 2 G3 NCBI cM Map 2 74.83 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Csnk2a1 Mouse (S)-nicotine multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 CHRNA7 affects the reaction [Nicotine results in increased expression of CSNK2A1 protein] more ... CTD PMID:35929799 Csnk2a1 Mouse (S)-nicotine increases expression ISO CSNK2A1 (Homo sapiens) 6480464 Nicotine results in increased expression of CSNK2A1 protein CTD PMID:35929799 Csnk2a1 Mouse 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o and p'-DDT results in increased expression of CSNK2A1 mRNA CTD PMID:24096037 Csnk2a1 Mouse 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 o and p'-DDT results in increased expression of CSNK2A1 mRNA CTD PMID:24096037 Csnk2a1 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CSNK2A1 mRNA CTD PMID:22206623 Csnk2a1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CSNK2A1 mRNA CTD PMID:22206623 Csnk2a1 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of CSNK2A1 mRNA CTD PMID:17555576 Csnk2a1 Mouse 17alpha-ethynylestradiol increases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of CSNK2A1 mRNA CTD PMID:24096037 and PMID:29097150 Csnk2a1 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of CSNK2A1 mRNA CTD PMID:17942748 and PMID:24096037 Csnk2a1 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CSNK2A1 mRNA CTD PMID:17942748 Csnk2a1 Mouse 17beta-estradiol increases activity ISO CSNK2A1 (Homo sapiens) 6480464 Estradiol results in increased activity of CSNK2A1 protein CTD PMID:16901965 Csnk2a1 Mouse 17beta-hydroxy-5alpha-androstan-3-one decreases expression EXP 6480464 Dihydrotestosterone results in decreased expression of CSNK2A1 mRNA CTD PMID:17023530 Csnk2a1 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Csnk2a1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CSNK2A1 mRNA CTD PMID:18343893 Csnk2a1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CSNK2A1 mRNA CTD PMID:32109520 Csnk2a1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CSNK2A1 mRNA CTD PMID:17942748 Csnk2a1 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CSNK2A1 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to CSNK2A1 promoter] CTD PMID:17942748 and PMID:19654925 Csnk2a1 Mouse 2,3,7,8-Tetrachlorodibenzofuran affects expression EXP 6480464 2 more ... CTD PMID:18343893 Csnk2a1 Mouse 2,6-dinitrotoluene affects expression ISO Csnk2a1 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of CSNK2A1 mRNA CTD PMID:21346803 Csnk2a1 Mouse 2-methoxyethanol decreases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 methyl cellosolve results in decreased expression of CSNK2A1 mRNA CTD PMID:19643169 Csnk2a1 Mouse 3,3',4,4',5-pentachlorobiphenyl affects expression ISO CSNK2A1 (Homo sapiens) 6480464 3 more ... CTD PMID:21703328 Csnk2a1 Mouse 3,3',5,5'-tetrabromobisphenol A decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of CSNK2A1 protein CTD PMID:31675489 Csnk2a1 Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of CSNK2A1 mRNA CTD PMID:19285098 Csnk2a1 Mouse 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of CSNK2A1 mRNA CTD PMID:18648102 Csnk2a1 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of CSNK2A1 mRNA CTD PMID:39298647 Csnk2a1 Mouse 4,5,6,7-TETRABROMOBENZOTRIAZOLE multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 4 more ... CTD PMID:22317921 Csnk2a1 Mouse 4-vinylcyclohexene dioxide affects expression EXP 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of CSNK2A1 mRNA CTD PMID:20829426 Csnk2a1 Mouse 5-aza-2'-deoxycytidine increases activity ISO CSNK2A1 (Homo sapiens) 6480464 Decitabine results in increased activity of CSNK2A1 protein CTD PMID:19027835 Csnk2a1 Mouse 5-aza-2'-deoxycytidine increases expression ISO CSNK2A1 (Homo sapiens) 6480464 Decitabine results in increased expression of CSNK2A1 mRNA and Decitabine results in increased expression of CSNK2A1 protein CTD PMID:19027835 Csnk2a1 Mouse acetamide decreases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 acetamide results in decreased expression of CSNK2A1 mRNA CTD PMID:31881176 Csnk2a1 Mouse acetylsalicylic acid increases expression ISO CSNK2A1 (Homo sapiens) 6480464 Aspirin results in increased expression of CSNK2A1 mRNA CTD PMID:11906190 Csnk2a1 Mouse acetylsalicylic acid decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 Aspirin results in decreased expression of CSNK2A1 mRNA CTD PMID:11906190 Csnk2a1 Mouse aconitine increases expression ISO CSNK2A1 (Homo sapiens) 6480464 Aconitine results in increased expression of CSNK2A1 protein CTD PMID:32234357 Csnk2a1 Mouse aconitine decreases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Aconitine results in decreased expression of CSNK2A1 protein CTD PMID:33236894 Csnk2a1 Mouse acrolein multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of CSNK2A1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of CSNK2A1 mRNA CTD PMID:32699268 Csnk2a1 Mouse acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of CSNK2A1 mRNA CTD PMID:21319176 Csnk2a1 Mouse aflatoxin B1 decreases methylation ISO CSNK2A1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of CSNK2A1 gene CTD PMID:27153756 Csnk2a1 Mouse alpha-pinene multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of CSNK2A1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of CSNK2A1 mRNA CTD PMID:32699268 Csnk2a1 Mouse alternariol decreases activity ISO CSNK2A1 (Homo sapiens) 6480464 alternariol results in decreased activity of CSNK2A1 protein CTD PMID:32328700 Csnk2a1 Mouse Altertoxin II decreases activity ISO CSNK2A1 (Homo sapiens) 6480464 altertoxin II results in decreased activity of CSNK2A1 protein CTD PMID:32328700 Csnk2a1 Mouse ammonium chloride affects expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of CSNK2A1 mRNA CTD PMID:16483693 Csnk2a1 Mouse AMP-PNP affects binding ISO CSNK2A1 (Homo sapiens) 6480464 Adenylyl Imidodiphosphate binds to CSNK2A1 protein CTD PMID:34344863 Csnk2a1 Mouse aristolochic acid A increases expression ISO CSNK2A1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of CSNK2A1 protein CTD PMID:33212167 Csnk2a1 Mouse Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of CSNK2A1 mRNA CTD PMID:23650126 Csnk2a1 Mouse arsane increases expression ISO CSNK2A1 (Homo sapiens) 6480464 Arsenic results in increased expression of CSNK2A1 mRNA CTD PMID:19945496 Csnk2a1 Mouse arsenic atom increases expression ISO CSNK2A1 (Homo sapiens) 6480464 Arsenic results in increased expression of CSNK2A1 mRNA CTD PMID:19945496 Csnk2a1 Mouse arsenite(3-) affects expression ISO CSNK2A1 (Homo sapiens) 6480464 arsenite affects the expression of CSNK2A1 mRNA CTD PMID:22959463 Csnk2a1 Mouse ATP multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 silmitasertib inhibits the reaction [Adenosine Triphosphate binds to [CSNK2A1 protein binds to CSNK2A1 protein binds to CSNK2B protein binds to CSNK2B protein]] CTD PMID:21174434 Csnk2a1 Mouse ATP affects binding ISO CSNK2A1 (Homo sapiens) 6480464 Adenosine Triphosphate binds to [CSNK2A1 protein binds to CSNK2A1 protein binds to CSNK2B protein binds to CSNK2B protein] CTD PMID:21174434 Csnk2a1 Mouse benzene multiple interactions ISO Csnk2a1 (Rattus norvegicus) 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of CSNK2A1 mRNA CTD PMID:17905399 Csnk2a1 Mouse benzo[a]pyrene increases methylation ISO CSNK2A1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CSNK2A1 5' UTR CTD PMID:27901495 Csnk2a1 Mouse benzo[e]pyrene increases methylation ISO CSNK2A1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of CSNK2A1 intron CTD PMID:30157460 Csnk2a1 Mouse beta-lapachone increases expression ISO CSNK2A1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of CSNK2A1 mRNA CTD PMID:38218311 Csnk2a1 Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of CSNK2A1 mRNA CTD PMID:33754040 Csnk2a1 Mouse bisphenol A increases methylation ISO Csnk2a1 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of CSNK2A1 gene CTD PMID:28505145 Csnk2a1 Mouse bisphenol A increases expression ISO CSNK2A1 (Homo sapiens) 6480464 bisphenol A results in increased expression of CSNK2A1 mRNA CTD PMID:30809271 Csnk2a1 Mouse bisphenol A increases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of CSNK2A1 mRNA CTD PMID:30816183 more ... Csnk2a1 Mouse bisphenol A affects expression ISO CSNK2A1 (Homo sapiens) 6480464 bisphenol A affects the expression of CSNK2A1 mRNA CTD PMID:30903817 Csnk2a1 Mouse Bisphenol A diglycidyl ether affects splicing EXP 6480464 bisphenol A diglycidyl ether affects the splicing of CSNK2A1 mRNA CTD PMID:36464114 Csnk2a1 Mouse bisphenol AF affects splicing EXP 6480464 bisphenol AF affects the splicing of CSNK2A1 mRNA CTD PMID:36464114 Csnk2a1 Mouse bisphenol AF increases expression ISO CSNK2A1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of CSNK2A1 protein CTD PMID:34186270 Csnk2a1 Mouse Bisphenol B increases expression ISO CSNK2A1 (Homo sapiens) 6480464 bisphenol B results in increased expression of CSNK2A1 protein CTD PMID:34186270 Csnk2a1 Mouse cadmium dichloride decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CSNK2A1 mRNA CTD PMID:25851441 and PMID:38568856 Csnk2a1 Mouse cadmium dichloride increases expression ISO CSNK2A1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of CSNK2A1 mRNA CTD PMID:33129824 Csnk2a1 Mouse capsaicin increases phosphorylation ISO CSNK2A1 (Homo sapiens) 6480464 Capsaicin results in increased phosphorylation of CSNK2A1 protein CTD PMID:20510015 Csnk2a1 Mouse carbamazepine affects expression ISO CSNK2A1 (Homo sapiens) 6480464 Carbamazepine affects the expression of CSNK2A1 mRNA CTD PMID:24752500 Csnk2a1 Mouse chloroprene increases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Chloroprene results in increased expression of CSNK2A1 mRNA CTD PMID:23125180 Csnk2a1 Mouse cilostazol multiple interactions EXP 6480464 (E)-3-(2 more ... CTD PMID:24254769 Csnk2a1 Mouse cilostazol increases phosphorylation EXP 6480464 cilostazol results in increased phosphorylation of CSNK2A1 protein CTD PMID:24254769 Csnk2a1 Mouse cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of CSNK2A1 mRNA CTD PMID:21151649 Csnk2a1 Mouse clobetasol increases expression EXP 6480464 Clobetasol results in increased expression of CSNK2A1 mRNA CTD PMID:27462272 Csnk2a1 Mouse clozapine decreases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Clozapine results in decreased expression of CSNK2A1 mRNA CTD PMID:16715494 Csnk2a1 Mouse cocaine decreases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Cocaine results in decreased expression of CSNK2A1 mRNA CTD PMID:12117546 Csnk2a1 Mouse copper atom multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of CSNK2A1 mRNA CTD PMID:30911355 Csnk2a1 Mouse copper(0) multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of CSNK2A1 mRNA CTD PMID:30911355 Csnk2a1 Mouse copper(II) sulfate increases expression ISO CSNK2A1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of CSNK2A1 mRNA CTD PMID:19549813 Csnk2a1 Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos and Crocidolite results in decreased expression of CSNK2A1 mRNA CTD PMID:29279043 Csnk2a1 Mouse cyclosporin A increases expression ISO CSNK2A1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of CSNK2A1 mRNA CTD PMID:20106945 more ... Csnk2a1 Mouse decabromodiphenyl ether decreases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 decabromobiphenyl ether results in decreased expression of CSNK2A1 mRNA CTD PMID:23640034 Csnk2a1 Mouse decabromodiphenyl ether decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of CSNK2A1 protein CTD PMID:31675489 Csnk2a1 Mouse Dibutyl phosphate affects expression ISO CSNK2A1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CSNK2A1 mRNA CTD PMID:37042841 Csnk2a1 Mouse diclofenac affects expression ISO CSNK2A1 (Homo sapiens) 6480464 Diclofenac affects the expression of CSNK2A1 mRNA CTD PMID:24752500 Csnk2a1 Mouse dieldrin decreases response to substance ISO CSNK2A1 (Homo sapiens) 6480464 CSNK2A1 gene mutant form results in decreased susceptibility to Dieldrin CTD PMID:32421776 Csnk2a1 Mouse dorsomorphin multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CSNK2A1 mRNA CTD PMID:27188386 Csnk2a1 Mouse elemental selenium decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 Selenium results in decreased expression of CSNK2A1 mRNA CTD PMID:19244175 Csnk2a1 Mouse emodin increases expression EXP 6480464 Emodin results in increased expression of CSNK2A1 mRNA CTD PMID:21319176 Csnk2a1 Mouse enzyme inhibitor multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of CSNK2A1 protein CTD PMID:23301498 Csnk2a1 Mouse ethyl methanesulfonate decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of CSNK2A1 mRNA CTD PMID:23649840 Csnk2a1 Mouse finasteride increases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Finasteride results in increased expression of CSNK2A1 mRNA CTD PMID:24136188 Csnk2a1 Mouse flutamide increases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Flutamide results in increased expression of CSNK2A1 mRNA CTD PMID:24136188 Csnk2a1 Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CSNK2A1 mRNA CTD PMID:22206623 Csnk2a1 Mouse formaldehyde decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of CSNK2A1 mRNA CTD PMID:23649840 Csnk2a1 Mouse formaldehyde multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 Formaldehyde affects the localization of and affects the phosphorylation of CSNK2A1 protein more ... CTD PMID:36534342 Csnk2a1 Mouse geldanamycin increases expression ISO CSNK2A1 (Homo sapiens) 6480464 geldanamycin results in increased expression of CSNK2A1 mRNA CTD PMID:26705709 Csnk2a1 Mouse gentamycin increases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of CSNK2A1 mRNA CTD PMID:22061828 Csnk2a1 Mouse guanosine 5'-[beta,gamma-imido]triphosphate affects binding ISO CSNK2A1 (Homo sapiens) 6480464 Guanylyl Imidodiphosphate binds to CSNK2A1 protein CTD PMID:34344863 Csnk2a1 Mouse haloperidol decreases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Haloperidol results in decreased expression of CSNK2A1 mRNA CTD PMID:16715494 Csnk2a1 Mouse ionomycin multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 Ionomycin promotes the reaction [EGF protein promotes the reaction [CSNK2A1 protein binds to SLC39A7 protein]] CTD PMID:22317921 Csnk2a1 Mouse ivermectin decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CSNK2A1 protein CTD PMID:32959892 Csnk2a1 Mouse KT 5720 multiple interactions EXP 6480464 KT 5720 inhibits the reaction [cilostazol results in increased phosphorylation of CSNK2A1 protein] CTD PMID:24254769 Csnk2a1 Mouse methapyrilene increases methylation ISO CSNK2A1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of CSNK2A1 intron CTD PMID:30157460 Csnk2a1 Mouse methyl methanesulfonate decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of CSNK2A1 mRNA CTD PMID:23649840 Csnk2a1 Mouse methylmercury(1+) multiple interactions ISO Csnk2a1 (Rattus norvegicus) 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of CSNK2A1 mRNA CTD PMID:17905399 Csnk2a1 Mouse N-Vinyl-2-pyrrolidone multiple interactions ISO Csnk2a1 (Rattus norvegicus) 6480464 [N-vinyl-2-pyrrolidinone binds to N-vinyl-2-pyrrolidinone] which results in increased expression of CSNK2A1 mRNA CTD PMID:22037397 Csnk2a1 Mouse nickel sulfate decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of CSNK2A1 mRNA CTD PMID:22714537 Csnk2a1 Mouse nicotine increases expression ISO CSNK2A1 (Homo sapiens) 6480464 Nicotine results in increased expression of CSNK2A1 protein CTD PMID:35929799 Csnk2a1 Mouse nicotine multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 CHRNA7 affects the reaction [Nicotine results in increased expression of CSNK2A1 protein] more ... CTD PMID:35929799 Csnk2a1 Mouse ochratoxin A decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of CSNK2A1 mRNA CTD PMID:30559759 Csnk2a1 Mouse ozone multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of CSNK2A1 mRNA more ... CTD PMID:32699268 and PMID:35430440 Csnk2a1 Mouse paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CSNK2A1 protein CTD PMID:19679878 Csnk2a1 Mouse PCB138 affects expression ISO CSNK2A1 (Homo sapiens) 6480464 2 more ... CTD PMID:21703328 Csnk2a1 Mouse phenobarbital increases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Phenobarbital results in increased expression of CSNK2A1 mRNA CTD PMID:22037397 Csnk2a1 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of CSNK2A1 mRNA CTD PMID:23091169 Csnk2a1 Mouse phenylephrine decreases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Phenylephrine results in decreased expression of CSNK2A1 mRNA CTD PMID:18158353 Csnk2a1 Mouse potassium dichromate decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 Potassium Dichromate results in decreased expression of CSNK2A1 mRNA CTD PMID:11678601 Csnk2a1 Mouse pyrithione multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 2-dimethylamino-4 more ... CTD PMID:22317921 Csnk2a1 Mouse quercetin affects binding ISO CSNK2A1 (Homo sapiens) 6480464 Quercetin analog binds to CSNK2A1 protein CTD PMID:21798748 Csnk2a1 Mouse quercetin decreases activity ISO CSNK2A1 (Homo sapiens) 6480464 Quercetin results in decreased activity of CSNK2A1 protein CTD PMID:32328700 Csnk2a1 Mouse quercitrin affects expression ISO CSNK2A1 (Homo sapiens) 6480464 quercitrin affects the expression of CSNK2A1 mRNA CTD PMID:25193878 Csnk2a1 Mouse retinyl acetate increases expression EXP 6480464 retinol acetate results in increased expression of CSNK2A1 mRNA CTD PMID:16772331 Csnk2a1 Mouse rotenone increases expression ISO CSNK2A1 (Homo sapiens) 6480464 Rotenone results in increased expression of CSNK2A1 mRNA CTD PMID:32368861 Csnk2a1 Mouse rotenone multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 CSNK2A1 protein affects the reaction [Rotenone results in decreased expression of FUNDC1 protein] more ... CTD PMID:37156403 Csnk2a1 Mouse Salinomycin decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 salinomycin results in decreased expression of CSNK2A1 mRNA CTD PMID:19682730 Csnk2a1 Mouse SB 431542 multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CSNK2A1 mRNA CTD PMID:27188386 Csnk2a1 Mouse selenium atom decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 Selenium results in decreased expression of CSNK2A1 mRNA CTD PMID:19244175 Csnk2a1 Mouse silmitasertib multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 silmitasertib affects the reaction [Formaldehyde affects the phosphorylation of CSNK2A1 protein] more ... CTD PMID:21174434 and PMID:36534342 Csnk2a1 Mouse sodium arsenite increases expression ISO CSNK2A1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CSNK2A1 mRNA and sodium arsenite results in increased expression of CSNK2A1 protein CTD PMID:18572023 and PMID:38568856 Csnk2a1 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of CSNK2A1 protein CTD PMID:29044176 Csnk2a1 Mouse staurosporine multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 Staurosporine affects the reaction [Formaldehyde affects the phosphorylation of CSNK2A1 protein] CTD PMID:36534342 Csnk2a1 Mouse sulindac decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 Sulindac results in decreased expression of CSNK2A1 mRNA CTD PMID:11906190 Csnk2a1 Mouse sulindac increases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 Sulindac results in increased expression of CSNK2A1 mRNA CTD PMID:24136188 Csnk2a1 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of CSNK2A1 mRNA CTD PMID:17555576 Csnk2a1 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of CSNK2A1 gene CTD PMID:35295148 Csnk2a1 Mouse trichloroethene multiple interactions ISO Csnk2a1 (Rattus norvegicus) 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of CSNK2A1 mRNA CTD PMID:17905399 Csnk2a1 Mouse triphenyl phosphate affects expression ISO CSNK2A1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CSNK2A1 mRNA CTD PMID:37042841 Csnk2a1 Mouse undecane decreases expression ISO Csnk2a1 (Rattus norvegicus) 6480464 undecane results in decreased expression of CSNK2A1 protein CTD PMID:17337753 Csnk2a1 Mouse valproic acid decreases methylation ISO CSNK2A1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of CSNK2A1 gene CTD PMID:29154799 Csnk2a1 Mouse valproic acid multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CSNK2A1 mRNA CTD PMID:27188386 Csnk2a1 Mouse valproic acid decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CSNK2A1 mRNA CTD PMID:23179753 and PMID:26272509 Csnk2a1 Mouse valproic acid increases expression ISO CSNK2A1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CSNK2A1 mRNA CTD PMID:29154799 Csnk2a1 Mouse valproic acid affects expression ISO CSNK2A1 (Homo sapiens) 6480464 Valproic Acid affects the expression of CSNK2A1 mRNA CTD PMID:25979313 Csnk2a1 Mouse valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of CSNK2A1 mRNA CTD PMID:21427059 Csnk2a1 Mouse vinclozolin affects expression ISO Csnk2a1 (Rattus norvegicus) 6480464 vinclozolin affects the expression of CSNK2A1 mRNA CTD PMID:19015723 Csnk2a1 Mouse vitamin E decreases expression ISO CSNK2A1 (Homo sapiens) 6480464 Vitamin E results in decreased expression of CSNK2A1 mRNA CTD PMID:19244175 Csnk2a1 Mouse zinc atom multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 2-dimethylamino-4 more ... CTD PMID:22317921 Csnk2a1 Mouse zinc(0) multiple interactions ISO CSNK2A1 (Homo sapiens) 6480464 2-dimethylamino-4 more ... CTD PMID:22317921
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(S)-nicotine (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,6-dinitrotoluene (ISO) 2-methoxyethanol (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP) 4,5,6,7-TETRABROMOBENZOTRIAZOLE (ISO) 4-vinylcyclohexene dioxide (EXP) 5-aza-2'-deoxycytidine (ISO) acetamide (ISO) acetylsalicylic acid (ISO) aconitine (ISO) acrolein (ISO) acrylamide (EXP) aflatoxin B1 (ISO) alpha-pinene (ISO) alternariol (ISO) Altertoxin II (ISO) ammonium chloride (ISO) AMP-PNP (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) ATP (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) Bisphenol A diglycidyl ether (EXP) bisphenol AF (EXP,ISO) Bisphenol B (ISO) cadmium dichloride (ISO) capsaicin (ISO) carbamazepine (ISO) chloroprene (ISO) cilostazol (EXP) cisplatin (EXP) clobetasol (EXP) clozapine (ISO) cocaine (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (EXP) cyclosporin A (ISO) decabromodiphenyl ether (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) dieldrin (ISO) dorsomorphin (ISO) elemental selenium (ISO) emodin (EXP) enzyme inhibitor (ISO) ethyl methanesulfonate (ISO) finasteride (ISO) flutamide (ISO) folic acid (EXP) formaldehyde (ISO) geldanamycin (ISO) gentamycin (ISO) guanosine 5'-[beta,gamma-imido]triphosphate (ISO) haloperidol (ISO) ionomycin (ISO) ivermectin (ISO) KT 5720 (EXP) methapyrilene (ISO) methyl methanesulfonate (ISO) methylmercury(1+) (ISO) N-Vinyl-2-pyrrolidone (ISO) nickel sulfate (ISO) nicotine (ISO) ochratoxin A (ISO) ozone (ISO) paracetamol (EXP) PCB138 (ISO) phenobarbital (EXP,ISO) phenylephrine (ISO) potassium dichromate (ISO) pyrithione (ISO) quercetin (ISO) quercitrin (ISO) retinyl acetate (EXP) rotenone (ISO) Salinomycin (ISO) SB 431542 (ISO) selenium atom (ISO) silmitasertib (ISO) sodium arsenite (EXP,ISO) staurosporine (ISO) sulindac (ISO) tamoxifen (EXP) titanium dioxide (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) undecane (ISO) valproic acid (EXP,ISO) vinclozolin (ISO) vitamin E (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.
Expression of protein kinase CK2 in astroglial cells of normal and neovascularized retina.
Kramerov AA, etal., Am J Pathol. 2006 May;168(5):1722-36.
3.
Protein kinase CK2: signaling and tumorigenesis in the mammary gland.
Landesman-Bollag E, etal., Mol Cell Biochem 2001 Nov;227(1-2):153-65.
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
8.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Selective removal of mitochondria via mitophagy: distinct pathways for different mitochondrial stresses.
Wei H, etal., Biochim Biophys Acta. 2015 Oct;1853(10 Pt B):2784-90. doi: 10.1016/j.bbamcr.2015.03.013. Epub 2015 Apr 1.
12.
Differential gene expression in infarct scar and viable myocardium from rat heart following coronary ligation.
Xu YJ, etal., J Cell Mol Med. 2004 Jan-Mar;8(1):85-92.
Csnk2a1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 152,068,468 - 152,123,772 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 152,068,759 - 152,123,772 (+) Ensembl GRCm39 Ensembl GRCm38 2 152,226,535 - 152,281,856 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 152,226,839 - 152,281,852 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 152,052,576 - 152,107,588 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 151,918,392 - 151,973,288 (+) NCBI MGSCv36 mm8 Celera 2 158,043,147 - 158,095,936 (+) NCBI Celera Cytogenetic Map 2 G3 NCBI cM Map 2 74.83 NCBI
CSNK2A1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 472,498 - 543,790 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 472,498 - 543,835 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 453,142 - 524,434 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 411,338 - 472,482 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 411,337 - 472,482 NCBI Celera 20 558,168 - 619,315 (-) NCBI Celera Cytogenetic Map 20 p13 NCBI HuRef 20 414,534 - 475,783 (-) NCBI HuRef CHM1_1 20 463,361 - 524,481 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 516,232 - 587,494 (-) NCBI T2T-CHM13v2.0
Csnk2a1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 161,170,295 - 161,217,073 (+) NCBI GRCr8 mRatBN7.2 3 140,709,984 - 140,756,757 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 140,709,991 - 140,756,696 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 144,614,755 - 144,658,895 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 153,198,587 - 153,242,728 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 150,938,676 - 150,982,746 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 147,713,808 - 147,760,375 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 147,713,821 - 147,757,862 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 154,061,948 - 154,108,516 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 142,564,754 - 142,609,311 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 142,470,349 - 142,514,931 (+) NCBI Celera 3 139,476,391 - 139,506,459 (+) NCBI Celera Cytogenetic Map 3 q41 NCBI
Csnk2a1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955597 326,601 - 397,112 (-) NCBI ChiLan1.0 ChiLan1.0
CSNK2A1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 1,569,710 - 1,632,281 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 1,568,135 - 1,629,104 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 689,494 - 752,092 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 459,070 - 521,126 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 456,629 - 521,126 (-) Ensembl panpan1.1 panPan2
CSNK2A1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 20,333,593 - 20,390,341 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 19,985,091 - 20,044,278 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 21,024,162 - 21,083,612 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 21,024,195 - 21,083,217 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 20,299,232 - 20,358,675 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 20,405,477 - 20,464,884 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 20,835,744 - 20,895,178 (+) NCBI UU_Cfam_GSD_1.0
Csnk2a1
CSNK2A1
CSNK2A1
Csnk2a1
.
Predicted Target Of
Count of predictions: 1417 Count of miRNA genes: 686 Interacting mature miRNAs: 881 Transcripts: ENSMUST00000099224, ENSMUST00000124791, ENSMUST00000133119, ENSMUST00000136063, ENSMUST00000141597 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301907 Rends_m renal disease susceptibility (mouse) Not determined 2 135699221 169699361 Mouse 1301783 Bhr1_m bronchial hyperresponsiveness 1 (mouse) Not determined 2 142593476 178442452 Mouse 12790983 Bwq12_m body weight QTL 12 (mouse) 2 148238204 181755017 Mouse 1301019 Bmd6_m bone mineral density 6 (mouse) Not determined 2 151778297 181755017 Mouse 12910799 Pwgrq2_m pre-weaning growth rate QTL 2 (mouse) 2 118589253 160611165 Mouse 1558939 Gnf1_m growth and fatness 1 (mouse) Not determined 2 143773445 169117924 Mouse 13825247 Agoc2_m agouti coat color QTL 2 (mouse) 2 151841920 159841920 Mouse 12910795 Pwbwq5_m post-weaning body weight QTL 5 (mouse) 2 118589253 160611165 Mouse 1300867 Lore2_m loss of righting induced by ethanol 2 (mouse) Not determined 2 144515861 180896594 Mouse 1558917 Gct8_m granulosa cell tumorigenesis 8 (mouse) Not determined 2 149236907 181755017 Mouse 27226761 Feml18_m femur length 18, 16 week (mouse) 2 94230345 154241920 Mouse 12910812 Pwgrq1_m pre-weaning growth rate QTL 1 (mouse) 2 118589253 160611165 Mouse 12910814 Pwbwq1_m pre-weaning body weight QTL 1 (mouse) 2 118589253 160611165 Mouse 1300751 Bdt1_m bone density traits 1 (mouse) Not determined 2 149988902 181755017 Mouse 10045885 Cplaq15_m circadian period of locomotor activity 15 (mouse) Not determined 2 110916118 154354667 Mouse 10054066 Bwq9_m body weight QTL 9 (mouse) Not determined 2 135699221 169699361 Mouse 1301822 Pgia2_m proteoglycan induced arthritis 2 (mouse) Not determined 2 123937311 157937424 Mouse 10043956 Gnf5_m growth and fatness 5 (mouse) Not determined 2 135699221 169699361 Mouse 1558842 Tailq2_m tail length QTL 2 (mouse) Not determined 2 151640941 162737074 Mouse 5491197 Mobq5_m multigenic obesity QTL 5 (mouse) Not determined 2 65269746 162518926 Mouse 10412080 Hylaq2_m Hyperlocomotor activity related QTL 2 (mouse) Not determined 2 151640941 164119146 Mouse 5491196 Mobq6_m multigenic obesity QTL 6 (mouse) Not determined 2 85724269 180896594 Mouse 1357862 Epfq1_m epididymal fat pad weight QTL 1 (mouse) Not determined 2 151640941 162737074 Mouse 1301031 Bdln3_m body length 3 (mouse) Not determined 2 127664019 161664118 Mouse 11341717 Rvfs1_m Rift Valley fever susceptibility 1 (mouse) 2 135432544 173449616 Mouse 4141703 Chlq13_m circulating hormone level QTL 13 (mouse) Not determined 2 135699221 169699361 Mouse 1357484 Bsbob_m BSB obesity (mouse) Not determined 2 143773445 165665019 Mouse 27226788 Feml13_m femur length 13, 10 week (mouse) 2 102630345 159941920 Mouse 4142211 Nilac3_m nicotine induced locomotor activity 3 (mouse) Not determined 2 148664893 181755017 Mouse 1301294 Hrtfm5_m heart failure modifier 5 (mouse) Not determined 2 122883015 156883131 Mouse 11038701 Ltpr2e_m Leishmania tropica response 2e (mouse) 2 150212221 181755017 Mouse 11038702 Ltpr2_m Leishmania tropica response 2 (mouse) 2 103095716 167212356 Mouse 4142450 Lmr16_m leishmaniasis resistance 16 (mouse) Not determined 2 150212221 181755017 Mouse 1301085 Lrnx10_m learning-contextual 10 (mouse) Not determined 2 150212221 181755017 Mouse 11353826 Bdln10_m body length 10 (mouse) 2 140441482 174441482 Mouse 1300806 Aod4_m autoimmune ovarian dysgenesis 4 (mouse) Not determined 2 145228719 179228841 Mouse 4141033 Wg2d_m weight gain in high growth mice 2d (mouse) Not determined 143773445 160303008 Mouse 1357772 Scfq1_m subcutaneous fat pad weight QTL 1 (mouse) Not determined 2 151640941 162737074 Mouse 1301961 Bts1_m bladder tumor susceptibility 1 (mouse) Not determined 2 132024159 166024330 Mouse 1301618 Bglu1_m blood glucose level 1 (mouse) Not determined 2 117942930 174324863 Mouse 27226749 Femd10_m femur midshaft diameter 10, 16 week (mouse) 2 124441920 168241920 Mouse 1302143 Bwq5_m body weight (mouse) Not determined 2 127664019 161664118 Mouse 1302013 Tbbmd3_m total body bone mineral density 3 (mouse) Not determined 2 145196949 179197085 Mouse 12880427 V25Dq3_m vitamin D inactive form serum level QTL 3 (mouse) 2 129341920 163341920 Mouse 13504830 Bacsq1_m baculum shape QTL 1 (mouse) 2 145716184 161016184 Mouse 12801456 Intmrm1_m intima/media ratio modifier 1 (mouse) 2 142428347 176428450 Mouse 11049566 Lmr28e_m leishmaniasis resistance 28e (mouse) 2 133144911 167145058 Mouse 12801461 Intim1_m intima modifier 1 (mouse) 2 142428347 176428450 Mouse 11049567 Lmr28f_m leishmaniasis resistance 28f (mouse) 2 133144911 167145058 Mouse 1301865 Hdlq19_m HDL QTL 19 (mouse) Not determined 2 145518775 179518926 Mouse 12910520 Scgq3_m spontaneous crescentic glomerulonephritis QTL 3 (mouse) 2 151709273 174389124 Mouse 1300846 Pbwg11_m postnatal body weight growth 11 (mouse) Not determined 2 138966600 172966729 Mouse
16.MMHAP54FLF1.seq
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 G3 UniSTS Whitehead_YAC 1 UniSTS
U51866
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 152,279,134 - 152,279,216 UniSTS GRCm38 GRCm38 1 156,525,456 - 156,525,538 UniSTS GRCm38 MGSCv37 2 152,104,870 - 152,104,952 UniSTS GRCm37 MGSCv37 1 158,455,587 - 158,455,669 UniSTS GRCm37 Celera 2 158,093,218 - 158,093,300 UniSTS Celera 1 158,923,534 - 158,923,616 UniSTS Cytogenetic Map 1 G3 UniSTS Cytogenetic Map 14 A2 UniSTS Cytogenetic Map 2 G3 UniSTS Whitehead_YAC 1 UniSTS
Csnk2a1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 152,280,637 - 152,281,798 UniSTS GRCm38 MGSCv37 2 152,106,373 - 152,107,534 UniSTS GRCm37 Celera 2 158,094,721 - 158,095,882 UniSTS Cytogenetic Map 2 G3 UniSTS
Csnk2a1-rs4
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 G3 UniSTS cM Map UN UniSTS cM Map 2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000099224 ⟹ ENSMUSP00000096829
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 152,068,759 - 152,123,772 (+) Ensembl GRCm38.p6 Ensembl 2 152,226,839 - 152,281,852 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000124791 ⟹ ENSMUSP00000122505
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 152,068,816 - 152,102,749 (+) Ensembl GRCm38.p6 Ensembl 2 152,226,896 - 152,260,829 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000133119 ⟹ ENSMUSP00000116853
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 152,068,828 - 152,099,316 (+) Ensembl GRCm38.p6 Ensembl 2 152,226,908 - 152,257,396 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000136063
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 152,068,796 - 152,115,260 (+) Ensembl GRCm38.p6 Ensembl 2 152,226,876 - 152,273,340 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000141597
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 152,068,833 - 152,094,762 (+) Ensembl GRCm38.p6 Ensembl 2 152,226,913 - 152,252,842 (+) Ensembl
RefSeq Acc Id:
NM_001416965 ⟹ NP_001403894
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 152,068,758 - 152,123,767 (+) NCBI
RefSeq Acc Id:
NM_001416966 ⟹ NP_001403895
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 152,068,758 - 152,123,767 (+) NCBI
RefSeq Acc Id:
NM_001416967 ⟹ NP_001403896
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 152,068,468 - 152,123,767 (+) NCBI
RefSeq Acc Id:
NM_001416968 ⟹ NP_001403897
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 152,068,758 - 152,123,767 (+) NCBI
RefSeq Acc Id:
NM_001416969 ⟹ NP_001403898
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 152,068,758 - 152,123,767 (+) NCBI
RefSeq Acc Id:
NM_001416970 ⟹ NP_001403899
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 152,068,758 - 152,123,767 (+) NCBI
RefSeq Acc Id:
NM_001416971 ⟹ NP_001403900
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 152,068,758 - 152,123,767 (+) NCBI
RefSeq Acc Id:
NM_001416972 ⟹ NP_001403901
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 152,068,758 - 152,123,767 (+) NCBI
RefSeq Acc Id:
NM_001416973 ⟹ NP_001403902
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 152,068,758 - 152,123,767 (+) NCBI
RefSeq Acc Id:
NM_001416974 ⟹ NP_001403903
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 152,068,758 - 152,123,767 (+) NCBI
RefSeq Acc Id:
NM_007788 ⟹ NP_031814
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 152,068,758 - 152,123,767 (+) NCBI GRCm38 2 152,226,840 - 152,281,852 (+) NCBI MGSCv37 2 152,052,576 - 152,107,588 (+) RGD Celera 2 158,043,147 - 158,095,936 (+) RGD cM Map 2 ENTREZGENE
Sequence:
GAGGGGGCTTCCGCTTCCGGCAGCGGAGGCTGCAGCCTCGCTCTGGTCCCTGCGGCTGGCGGCCGAGCCGTGTGTCTCCTCCTCCGCCGCCGCCATATTGTCTGTGTGAAGCTAGGGGAGCGCGGCTA
hide sequence
RefSeq Acc Id:
XM_011239272 ⟹ XP_011237574
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 152,088,345 - 152,123,772 (+) NCBI GRCm38 2 152,248,690 - 152,281,856 (+) NCBI
Sequence:
ACATTCTGATTTTTTTATTTTAAACAGTCTCATGTAGCCCAGGCTAGCTTTGAACTGTCAGTCCTGCTCCACCTTCATAATTGCTGGGGTTGTAGGTATATTCCACCATACCTAGTCCAGTGTCACTT
hide sequence
RefSeq Acc Id:
XM_030247074 ⟹ XP_030102934
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 152,069,425 - 152,123,772 (+) NCBI GRCm38 2 152,228,434 - 152,281,856 (+) NCBI
Sequence:
AATTGGGGCCGAACGGGTGGAGTTGAGGGCTCCCTGGGAACCTGGGTGGAGGAGGAGATGTGGT
hide sequence
RefSeq Acc Id:
NP_031814 ⟸ NM_007788
- Peptide Label:
isoform 1
- UniProtKB:
Q8R0X4 (UniProtKB/Swiss-Prot), Q60737 (UniProtKB/Swiss-Prot), Q61177 (UniProtKB/TrEMBL)
- Sequence:
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTL
hide sequence
RefSeq Acc Id:
XP_011237574 ⟸ XM_011239272
- Peptide Label:
isoform X1
- UniProtKB:
Q8R0X4 (UniProtKB/Swiss-Prot), Q60737 (UniProtKB/Swiss-Prot), Q61177 (UniProtKB/TrEMBL)
- Sequence:
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEK
hide sequence
RefSeq Acc Id:
XP_030102934 ⟸ XM_030247074
- Peptide Label:
isoform X1
- UniProtKB:
Q60737 (UniProtKB/Swiss-Prot), Q8R0X4 (UniProtKB/Swiss-Prot), Q61177 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000096829 ⟸ ENSMUST00000099224
Ensembl Acc Id:
ENSMUSP00000122505 ⟸ ENSMUST00000124791
Ensembl Acc Id:
ENSMUSP00000116853 ⟸ ENSMUST00000133119
RefSeq Acc Id:
NP_001403896 ⟸ NM_001416967
- Peptide Label:
isoform 1
- UniProtKB:
Q60737 (UniProtKB/Swiss-Prot), Q8R0X4 (UniProtKB/Swiss-Prot), Q61177 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001403895 ⟸ NM_001416966
- Peptide Label:
isoform 1
- UniProtKB:
Q60737 (UniProtKB/Swiss-Prot), Q8R0X4 (UniProtKB/Swiss-Prot), Q61177 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001403894 ⟸ NM_001416965
- Peptide Label:
isoform 1
- UniProtKB:
Q60737 (UniProtKB/Swiss-Prot), Q8R0X4 (UniProtKB/Swiss-Prot), Q61177 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001403900 ⟸ NM_001416971
- Peptide Label:
isoform 1
- UniProtKB:
Q60737 (UniProtKB/Swiss-Prot), Q8R0X4 (UniProtKB/Swiss-Prot), Q61177 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001403899 ⟸ NM_001416970
- Peptide Label:
isoform 1
- UniProtKB:
Q60737 (UniProtKB/Swiss-Prot), Q8R0X4 (UniProtKB/Swiss-Prot), Q61177 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001403897 ⟸ NM_001416968
- Peptide Label:
isoform 1
- UniProtKB:
Q60737 (UniProtKB/Swiss-Prot), Q8R0X4 (UniProtKB/Swiss-Prot), Q61177 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001403898 ⟸ NM_001416969
- Peptide Label:
isoform 1
- UniProtKB:
Q60737 (UniProtKB/Swiss-Prot), Q8R0X4 (UniProtKB/Swiss-Prot), Q61177 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001403902 ⟸ NM_001416973
- Peptide Label:
isoform 3
- UniProtKB:
Q61177 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001403903 ⟸ NM_001416974
- Peptide Label:
isoform 4
- UniProtKB:
Q61177 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001403901 ⟸ NM_001416972
- Peptide Label:
isoform 2
- UniProtKB:
Q61177 (UniProtKB/TrEMBL)
RGD ID: 6831082 Promoter ID: MM_KWN:32346 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000109850, OTTMUST00000037681, OTTMUST00000037682, OTTMUST00000037683, OTTMUST00000037684, OTTMUST00000076133, UC008NEY.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 152,052,376 - 152,052,917 (+) MPROMDB
RGD ID: 6879164 Promoter ID: EPDNEW_M3033 Type: initiation region Name: Csnk2a1_1 Description: Mus musculus casein kinase 2, alpha 1 polypeptide , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 2 152,226,873 - 152,226,933 EPDNEW
