Symbol:
Mbl2
Name:
mannose-binding lectin (protein C) 2
RGD ID:
731472
MGI Page
MGI
Description:
Predicted to enable several functions, including calcium-dependent protein binding activity; monosaccharide binding activity; and phosphatidylinositol-4-phosphate binding activity. Acts upstream of or within defense response to other organism and positive regulation of phagocytosis. Located in extracellular space. Is expressed in early conceptus and embryo. Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); bacterial infectious disease (multiple); fungal infectious disease (multiple); liver disease (multiple); and lung disease (multiple). Orthologous to human MBL2 (mannose binding lectin 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
L-MBP; mannan-binding protein; mannose binding lectin (C); mannose binding lectin, liver (C); mannose-binding protein C; MB; MBL; MBL-; MBL-C; MBP-; MBP-C; RA-reactive factor P28A subunit; RARF/P28A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MBL2 (mannose binding lectin 2)
HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Mbl2 (mannose binding lectin 2)
RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Mbl2 (mannose binding lectin 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MBL2 (mannose binding lectin 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MBL1 (mannose binding lectin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MBL2 (mannose binding lectin 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MBL2 (mannose binding lectin 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mbl2 (mannose binding lectin 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Mbl2 (mannose binding lectin 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MBL2 (mannose binding lectin 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
hbl2 (hexose-binding lectin 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Danio rerio (zebrafish):
hbl4 (hexose-binding lectin 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|SonicParanoid)
Danio rerio (zebrafish):
hbl1 (hexose-binding lectin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG7763
Alliance
DIOPT (Hieranoid|InParanoid)
Danio rerio (zebrafish):
mbl2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
lectin-28C
Alliance
DIOPT (Hieranoid|InParanoid)
Drosophila melanogaster (fruit fly):
CG43797
Alliance
DIOPT (InParanoid|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 30,210,306 - 30,217,087 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 30,210,342 - 30,217,087 (+) Ensembl GRCm39 Ensembl GRCm38 19 30,232,906 - 30,239,687 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 30,232,942 - 30,239,687 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 30,307,447 - 30,314,172 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 30,298,954 - 30,305,679 (+) NCBI MGSCv36 mm8 Celera 19 31,010,980 - 31,017,684 (+) NCBI Celera Cytogenetic Map 19 C1 NCBI cM Map 19 25.14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mbl2 Mouse (+)-schisandrin B multiple interactions ISO Mbl2 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of MBL2 mRNA] CTD PMID:31150632 Mbl2 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MBL2 mRNA CTD PMID:36331819 Mbl2 Mouse (S)-amphetamine decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 Dextroamphetamine results in decreased expression of MBL2 mRNA CTD PMID:16715494 Mbl2 Mouse 1,1-dichloroethene decreases expression EXP 6480464 vinylidene chloride results in decreased expression of MBL2 mRNA CTD PMID:26682919 Mbl2 Mouse 1-naphthyl isothiocyanate multiple interactions ISO MBL2 (Homo sapiens) 6480464 [1-Naphthylisothiocyanate co-treated with Cholic Acids] affects the expression of MBL2 mRNA CTD PMID:27344345 Mbl2 Mouse 17beta-estradiol decreases expression ISO MBL2 (Homo sapiens) 6480464 Estradiol results in decreased expression of MBL2 mRNA CTD PMID:20106945 Mbl2 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of MBL2 mRNA CTD PMID:39298647 Mbl2 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO MBL2 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Mbl2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MBL2 mRNA CTD PMID:16120747 and PMID:23864506 Mbl2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MBL2 mRNA CTD PMID:21215274 and PMID:21724226 Mbl2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO MBL2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of MBL2 mRNA CTD PMID:11489354 more ... Mbl2 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO MBL2 (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of MBL2 mRNA CTD PMID:26159488 Mbl2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO MBL2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of MBL2 mRNA CTD PMID:22298810 Mbl2 Mouse 2,4,6-tribromophenol decreases expression ISO MBL2 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Mbl2 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Mbl2 Mouse 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of MBL2 mRNA CTD PMID:21607683 Mbl2 Mouse 3,3',4,4',5-pentachlorobiphenyl increases expression ISO MBL2 (Homo sapiens) 6480464 3 more ... CTD PMID:19692669 Mbl2 Mouse 3,3',4,4'-tetrachlorobiphenyl multiple interactions EXP 6480464 3 more ... CTD PMID:19467301 Mbl2 Mouse 3,3',5,5'-tetrabromobisphenol A increases expression ISO MBL2 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of MBL2 protein CTD PMID:31675489 Mbl2 Mouse 3H-1,2-dithiole-3-thione decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 1 and 2-dithiol-3-thione results in decreased expression of MBL2 mRNA CTD PMID:19162173 Mbl2 Mouse 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of MBL2 mRNA CTD PMID:18648102 Mbl2 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of MBL2 mRNA CTD PMID:39298647 Mbl2 Mouse aflatoxin B1 affects expression ISO MBL2 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of MBL2 protein CTD PMID:20106945 Mbl2 Mouse aflatoxin B1 decreases methylation ISO MBL2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MBL2 gene CTD PMID:27153756 Mbl2 Mouse aflatoxin B1 decreases expression ISO MBL2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of MBL2 mRNA CTD PMID:22100608 Mbl2 Mouse all-trans-retinol multiple interactions ISO MBL2 (Homo sapiens) 6480464 MBL2 gene polymorphism affects the susceptibility to [Vitamin A co-treated with beta Carotene] CTD PMID:16960176 Mbl2 Mouse ammonium chloride affects expression ISO Mbl2 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of MBL2 mRNA CTD PMID:16483693 Mbl2 Mouse azathioprine decreases expression ISO MBL2 (Homo sapiens) 6480464 Azathioprine results in decreased expression of MBL2 mRNA CTD PMID:22623647 Mbl2 Mouse benzo[a]pyrene increases expression ISO MBL2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MBL2 mRNA CTD PMID:20106945 more ... Mbl2 Mouse benzo[a]pyrene decreases expression ISO MBL2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MBL2 mRNA CTD PMID:32234424 Mbl2 Mouse benzo[a]pyrene increases methylation ISO MBL2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MBL2 exon CTD PMID:27901495 Mbl2 Mouse benzo[a]pyrene affects methylation ISO MBL2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MBL2 promoter CTD PMID:27901495 Mbl2 Mouse beta-carotene multiple interactions ISO MBL2 (Homo sapiens) 6480464 MBL2 gene polymorphism affects the susceptibility to [Vitamin A co-treated with beta Carotene] CTD PMID:16960176 Mbl2 Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of MBL2 mRNA CTD PMID:28085963 Mbl2 Mouse bisphenol A decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of MBL2 mRNA CTD PMID:25181051 Mbl2 Mouse bisphenol A increases expression ISO Mbl2 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of MBL2 mRNA CTD PMID:32145629 Mbl2 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MBL2 mRNA CTD PMID:30245210 and PMID:33221593 Mbl2 Mouse bisphenol A affects expression ISO Mbl2 (Rattus norvegicus) 6480464 bisphenol A affects the expression of MBL2 mRNA CTD PMID:30903817 Mbl2 Mouse bortezomib increases response to substance ISO MBL2 (Homo sapiens) 6480464 MBL2 gene SNP results in increased susceptibility to Bortezomib CTD PMID:20864405 Mbl2 Mouse buspirone decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 Buspirone results in decreased expression of MBL2 mRNA CTD PMID:24136188 Mbl2 Mouse buta-1,3-diene decreases expression EXP 6480464 1 and 3-butadiene results in decreased expression of MBL2 mRNA CTD PMID:29038090 Mbl2 Mouse cannabidiol decreases expression EXP 6480464 Cannabidiol results in decreased expression of MBL2 mRNA CTD PMID:31052254 Mbl2 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of MBL2 mRNA CTD PMID:25620056 Mbl2 Mouse cerium trichloride decreases expression ISO MBL2 (Homo sapiens) 6480464 cerous chloride results in decreased expression of MBL2 mRNA CTD PMID:28954213 Mbl2 Mouse cerium trichloride multiple interactions ISO MBL2 (Homo sapiens) 6480464 [cerous chloride co-treated with lanthanum chloride] results in decreased expression of MBL2 mRNA CTD PMID:28954213 Mbl2 Mouse CGP 52608 multiple interactions ISO MBL2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MBL2 gene] CTD PMID:28238834 Mbl2 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of MBL2 mRNA CTD PMID:37019170 Mbl2 Mouse cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of MBL2 protein CTD PMID:31493026 Mbl2 Mouse clofibrate multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of MBL2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of MBL2 mRNA] CTD PMID:17585979 Mbl2 Mouse clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of MBL2 mRNA CTD PMID:17585979 Mbl2 Mouse clofibric acid affects expression ISO Mbl2 (Rattus norvegicus) 6480464 Clofibric Acid affects the expression of MBL2 mRNA CTD PMID:17602206 Mbl2 Mouse cobalt dichloride decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 cobaltous chloride results in decreased expression of MBL2 mRNA CTD PMID:24386269 Mbl2 Mouse copper(II) sulfate decreases expression ISO MBL2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MBL2 mRNA CTD PMID:19549813 Mbl2 Mouse coumarin decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 coumarin results in decreased expression of MBL2 mRNA CTD PMID:18480146 Mbl2 Mouse cyclosporin A multiple interactions ISO MBL2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Cholic Acids] affects the expression of MBL2 mRNA CTD PMID:27344345 Mbl2 Mouse cyclosporin A decreases expression ISO MBL2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MBL2 mRNA CTD PMID:20106945 more ... Mbl2 Mouse decabromodiphenyl ether increases expression ISO MBL2 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of MBL2 protein CTD PMID:31675489 Mbl2 Mouse dexamethasone decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 Dexamethasone results in decreased expression of MBL2 mRNA CTD PMID:20032058 Mbl2 Mouse dexamethasone multiple interactions ISO Mbl2 (Rattus norvegicus) 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of MBL2 mRNA] CTD PMID:20032058 Mbl2 Mouse dioxygen increases expression ISO MBL2 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of MBL2 mRNA CTD PMID:35883890 Mbl2 Mouse endosulfan multiple interactions ISO MBL2 (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of MBL2 mRNA CTD PMID:26159488 Mbl2 Mouse flutamide decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 Flutamide results in decreased expression of MBL2 mRNA CTD PMID:24136188 and PMID:24793618 Mbl2 Mouse furan increases methylation ISO Mbl2 (Rattus norvegicus) 6480464 furan results in increased methylation of MBL2 gene CTD PMID:22079235 Mbl2 Mouse furan decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 furan results in decreased expression of MBL2 mRNA CTD PMID:25539665 and PMID:26194646 Mbl2 Mouse glafenine decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 Glafenine results in decreased expression of MBL2 mRNA CTD PMID:24136188 Mbl2 Mouse lanthanum trichloride decreases expression ISO MBL2 (Homo sapiens) 6480464 lanthanum chloride results in decreased expression of MBL2 mRNA CTD PMID:28954213 Mbl2 Mouse lanthanum trichloride multiple interactions ISO MBL2 (Homo sapiens) 6480464 [cerous chloride co-treated with lanthanum chloride] results in decreased expression of MBL2 mRNA CTD PMID:28954213 Mbl2 Mouse Lasiocarpine decreases expression ISO MBL2 (Homo sapiens) 6480464 lasiocarpine results in decreased expression of MBL2 mRNA CTD PMID:32234424 Mbl2 Mouse leflunomide increases expression ISO MBL2 (Homo sapiens) 6480464 leflunomide results in increased expression of MBL2 mRNA CTD PMID:28988120 Mbl2 Mouse lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of MBL2 mRNA CTD PMID:24056979 Mbl2 Mouse lipopolysaccharide multiple interactions EXP 6480464 methyldithiocarbamate inhibits the reaction [Lipopolysaccharides results in increased expression of MBL2 mRNA] CTD PMID:24056979 Mbl2 Mouse metam multiple interactions EXP 6480464 methyldithiocarbamate inhibits the reaction [Lipopolysaccharides results in increased expression of MBL2 mRNA] CTD PMID:24056979 Mbl2 Mouse methapyrilene decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 Methapyrilene results in decreased expression of MBL2 mRNA CTD PMID:30467583 Mbl2 Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of MBL2 mRNA CTD PMID:34813904 Mbl2 Mouse N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of MBL2 mRNA CTD PMID:21607683 Mbl2 Mouse N-nitrosodiethylamine decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 Diethylnitrosamine results in decreased expression of MBL2 mRNA CTD PMID:19638242 Mbl2 Mouse N-Nitrosopyrrolidine decreases expression ISO MBL2 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of MBL2 mRNA CTD PMID:32234424 Mbl2 Mouse nefazodone decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 nefazodone results in decreased expression of MBL2 mRNA CTD PMID:24136188 Mbl2 Mouse nickel dichloride affects expression ISO Mbl2 (Rattus norvegicus) 6480464 nickel chloride affects the expression of MBL2 mRNA CTD PMID:22110744 Mbl2 Mouse nimesulide decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 nimesulide results in decreased expression of MBL2 mRNA CTD PMID:24136188 Mbl2 Mouse nitrofen increases expression ISO Mbl2 (Rattus norvegicus) 6480464 nitrofen results in increased expression of MBL2 mRNA CTD PMID:33484710 Mbl2 Mouse O-methyleugenol decreases expression ISO MBL2 (Homo sapiens) 6480464 methyleugenol results in decreased expression of MBL2 mRNA CTD PMID:32234424 Mbl2 Mouse ozone increases expression ISO Mbl2 (Rattus norvegicus) 6480464 Ozone results in increased expression of MBL2 mRNA CTD PMID:26667333 Mbl2 Mouse ozone multiple interactions EXP 6480464 [MBL1 co-treated with MBL2] promotes the reaction [[Air Pollutants results in increased abundance of Ozone] which results in increased expression of CCL22 mRNA] more ... CTD PMID:27106289 Mbl2 Mouse paracetamol multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of MBL2 mRNA more ... CTD PMID:17585979 and PMID:29246445 Mbl2 Mouse paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MBL2 mRNA CTD PMID:29246445 Mbl2 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of MBL2 mRNA CTD PMID:17562736 Mbl2 Mouse parathion increases expression EXP 6480464 Parathion results in increased expression of MBL2 mRNA CTD PMID:34813904 Mbl2 Mouse perfluorodecanoic acid decreases expression ISO MBL2 (Homo sapiens) 6480464 perfluorodecanoic acid results in decreased expression of MBL2 mRNA CTD PMID:23567314 Mbl2 Mouse perfluorododecanoic acid decreases expression ISO MBL2 (Homo sapiens) 6480464 perfluorododecanoic acid results in decreased expression of MBL2 mRNA CTD PMID:23567314 Mbl2 Mouse perfluoroheptanoic acid increases expression ISO MBL2 (Homo sapiens) 6480464 perfluoro-n-heptanoic acid results in increased expression of MBL2 mRNA CTD PMID:23567314 Mbl2 Mouse perfluorohexanesulfonic acid increases expression ISO MBL2 (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in increased expression of MBL2 mRNA CTD PMID:23567314 Mbl2 Mouse perfluorohexanoic acid increases expression ISO MBL2 (Homo sapiens) 6480464 perfluorohexanoic acid results in increased expression of MBL2 mRNA CTD PMID:23567314 Mbl2 Mouse perfluorononanoic acid decreases expression EXP 6480464 perfluoro-n-nonanoic acid results in decreased expression of MBL2 mRNA CTD PMID:25543169 Mbl2 Mouse perfluorononanoic acid decreases expression ISO MBL2 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of MBL2 mRNA CTD PMID:32588087 Mbl2 Mouse perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of MBL2 mRNA CTD PMID:19429403 and PMID:20936131 Mbl2 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MBL2 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of MBL2 mRNA CTD PMID:36331819 Mbl2 Mouse perfluorooctane-1-sulfonic acid increases expression ISO MBL2 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of MBL2 mRNA CTD PMID:23567314 and PMID:25812627 Mbl2 Mouse perfluorooctanoic acid multiple interactions EXP 6480464 PPARA protein promotes the reaction [perfluorooctanoic acid results in decreased expression of MBL2 mRNA] CTD PMID:18467677 Mbl2 Mouse perfluorooctanoic acid increases expression ISO MBL2 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of MBL2 mRNA CTD PMID:25812627 Mbl2 Mouse perfluorooctanoic acid decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 perfluorooctanoic acid results in decreased expression of MBL2 mRNA CTD PMID:19162173 Mbl2 Mouse perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of MBL2 mRNA CTD PMID:18467677 more ... Mbl2 Mouse phorbol 13-acetate 12-myristate multiple interactions ISO MBL2 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of MBL2 mRNA CTD PMID:16979875 Mbl2 Mouse pirinixic acid multiple interactions ISO MBL2 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of MBL2 mRNA CTD PMID:19710929 Mbl2 Mouse pirinixic acid decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 pirinixic acid results in decreased expression of MBL2 mRNA CTD PMID:19162173 Mbl2 Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of MBL2 mRNA and PPARA protein promotes the reaction [pirinixic acid results in decreased expression of MBL2 mRNA] CTD PMID:18467677 and PMID:19710929 Mbl2 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of MBL2 mRNA CTD PMID:18467677 Mbl2 Mouse potassium dichromate affects expression EXP 6480464 Potassium Dichromate affects the expression of MBL2 mRNA CTD PMID:23608068 Mbl2 Mouse pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of MBL2 mRNA CTD PMID:27413110 and PMID:28903501 Mbl2 Mouse senecionine increases expression EXP 6480464 senecionine results in increased expression of MBL2 protein CTD PMID:35357534 Mbl2 Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of MBL2 mRNA CTD PMID:25270620 Mbl2 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of MBL2 mRNA CTD PMID:37682722 Mbl2 Mouse sodium arsenite decreases expression ISO MBL2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MBL2 mRNA CTD PMID:29301061 Mbl2 Mouse sodium arsenite affects expression ISO MBL2 (Homo sapiens) 6480464 sodium arsenite affects the expression of MBL2 mRNA CTD PMID:29319823 Mbl2 Mouse sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of MBL2 mRNA CTD PMID:22155349 Mbl2 Mouse sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of MBL2 protein CTD PMID:28918527 Mbl2 Mouse testosterone multiple interactions ISO Mbl2 (Rattus norvegicus) 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of MBL2 mRNA] CTD PMID:20032058 Mbl2 Mouse tetrachloromethane multiple interactions ISO Mbl2 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of MBL2 mRNA] CTD PMID:31150632 Mbl2 Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MBL2 mRNA CTD PMID:31919559 Mbl2 Mouse tetrachloromethane decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of MBL2 mRNA CTD PMID:31150632 Mbl2 Mouse thioacetamide decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of MBL2 mRNA CTD PMID:23411599 and PMID:34492290 Mbl2 Mouse titanium dioxide affects expression EXP 6480464 titanium dioxide affects the expression of MBL2 mRNA CTD PMID:23557971 Mbl2 Mouse trichloroethene decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of MBL2 mRNA CTD PMID:33387578 Mbl2 Mouse troglitazone increases expression ISO MBL2 (Homo sapiens) 6480464 troglitazone results in increased expression of MBL2 mRNA CTD PMID:25572481 Mbl2 Mouse troglitazone decreases expression ISO Mbl2 (Rattus norvegicus) 6480464 troglitazone results in decreased expression of MBL2 mRNA CTD PMID:21515302 Mbl2 Mouse urethane decreases expression ISO MBL2 (Homo sapiens) 6480464 Urethane results in decreased expression of MBL2 mRNA CTD PMID:28818685 Mbl2 Mouse valproic acid decreases expression ISO MBL2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MBL2 mRNA CTD PMID:29154799 Mbl2 Mouse zinc atom multiple interactions ISO MBL2 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of MBL2 mRNA CTD PMID:16979875 Mbl2 Mouse zinc(0) multiple interactions ISO MBL2 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of MBL2 mRNA CTD PMID:16979875
Imported Annotations - KEGG (archival)
(+)-schisandrin B (ISO) (1->4)-beta-D-glucan (EXP) (S)-amphetamine (ISO) 1,1-dichloroethene (EXP) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2-acetamidofluorene (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3',4,4'-tetrachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3H-1,2-dithiole-3-thione (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP) aflatoxin B1 (ISO) all-trans-retinol (ISO) ammonium chloride (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) beta-carotene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bortezomib (ISO) buspirone (ISO) buta-1,3-diene (EXP) cannabidiol (EXP) carbon nanotube (EXP) cerium trichloride (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) cisplatin (EXP) clofibrate (EXP) clofibric acid (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) dioxygen (ISO) endosulfan (ISO) flutamide (ISO) furan (ISO) glafenine (ISO) lanthanum trichloride (ISO) Lasiocarpine (ISO) leflunomide (ISO) lipopolysaccharide (EXP) metam (EXP) methapyrilene (ISO) methidathion (EXP) N-nitrosodiethylamine (EXP,ISO) N-Nitrosopyrrolidine (ISO) nefazodone (ISO) nickel dichloride (ISO) nimesulide (ISO) nitrofen (ISO) O-methyleugenol (ISO) ozone (EXP,ISO) paracetamol (EXP) parathion (EXP) perfluorodecanoic acid (ISO) perfluorododecanoic acid (ISO) perfluoroheptanoic acid (ISO) perfluorohexanesulfonic acid (ISO) perfluorohexanoic acid (ISO) perfluorononanoic acid (EXP,ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP,ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (EXP,ISO) potassium dichromate (EXP) pregnenolone 16alpha-carbonitrile (EXP) senecionine (EXP) sodium arsenite (EXP,ISO) sodium dichromate (EXP) sodium fluoride (EXP) testosterone (ISO) tetrachloromethane (EXP,ISO) thioacetamide (ISO) titanium dioxide (EXP) trichloroethene (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
antiviral innate immune response (IEA,ISO) cell surface pattern recognition receptor signaling pathway (IEA,ISO) complement activation, classical pathway (IEA) complement activation, lectin pathway (IDA,IGI,IMP,ISO) defense response to Gram-positive bacterium (IGI,ISO) innate immune response (ISO) killing by host of symbiont cells (IGI) negative regulation of viral process (IEA,ISO) positive regulation of complement activation (ISO) positive regulation of opsonization (IEA,ISO) positive regulation of phagocytosis (IBA,IGI) positive regulation of protein processing (ISO) proteolysis (IEA,ISO) surfactant homeostasis (IBA)
1.
MBL2 gene polymorphisms protect against development of thrombocytopenia associated with severe dengue phenotype.
Acioli-Santos B, etal., Hum Immunol. 2008 Feb;69(2):122-8. doi: 10.1016/j.humimm.2008.01.005. Epub 2008 Feb 12.
2.
Relation among mannose-binding lectin 2 genotype, beta-cell autoantibodies, and risk for type 1 diabetes in Finnish children.
Aittoniemi J, etal., Hum Immunol. 2008 Feb;69(2):108-11. doi: 10.1016/j.humimm.2008.01.007. Epub 2008 Feb 20.
3.
Genotypes of the mannan-binding lectin gene and susceptibility to visceral leishmaniasis and clinical complications.
Alonso DP, etal., J Infect Dis. 2007 Apr 15;195(8):1212-7. Epub 2007 Mar 5.
4.
Mannan-binding lectin MBL2 gene polymorphism in chronic hepatitis C: association with the severity of liver fibrosis and response to interferon therapy.
Alves Pedroso ML, etal., Clin Exp Immunol. 2008 May;152(2):258-64. doi: 10.1111/j.1365-2249.2008.03614.x. Epub 2008 Mar 10.
5.
Mannose-binding lectin serum levels are low in persons with clinically active coccidioidomycosis.
Ampel NM, etal., Mycopathologia. 2009 Apr;167(4):173-80. Epub 2008 Dec 14.
6.
Polymorphisms in immunoregulatory genes and the risk of histologic chorioamnionitis in Caucasoid women: a case control study.
Annells MF, etal., BMC Pregnancy Childbirth. 2005 Feb 21;5(1):4.
7.
Mannan-binding lectin deficiency in pediatric patients with inflammatory bowel disease.
Bak-Romaniszyn L, etal., Scand J Gastroenterol. 2011 Oct;46(10):1275-8. doi: 10.3109/00365521.2011.594087. Epub 2011 Jun 27.
8.
The polymorphisms of the MBL2 and MIF genes associated with Pediatric Cochlear Implant Patients.
Baysal E, etal., Int J Pediatr Otorhinolaryngol. 2013 Mar;77(3):338-40. doi: 10.1016/j.ijporl.2012.11.020. Epub 2012 Dec 14.
9.
Polymorphisms in the mannose-binding lectin gene as determinants of age-defined risk of coronary artery lesions in Kawasaki disease.
Biezeveld MH, etal., Arthritis Rheum. 2006 Jan;54(1):369-76.
10.
Association of the wild-type A/A genotype of MBL2 codon 54 with asthma in a North Indian population.
Birbian N, etal., Dis Markers. 2012;32(5):301-8. doi: 10.3233/DMA-2012-0892.
11.
Epidemiology of chronic wound patients and relation to serum levels of mannan-binding lectin.
Bitsch M, etal., Acta Derm Venereol. 2009 Nov;89(6):607-11. doi: 10.2340/00015555-0730.
12.
Association between bronchopulmonary dysplasia and MBL2 and IL1-RN polymorphisms.
Cakmak BC, etal., Pediatr Int. 2012 Dec;54(6):863-8. doi: 10.1111/j.1442-200X.2012.03714.x. Epub 2012 Nov 21.
13.
Role played by human mannose-binding lectin polymorphisms in pulmonary tuberculosis.
Capparelli R, etal., J Infect Dis. 2009 Mar 1;199(5):666-72.
14.
Prevalence of atopic symptoms among blood donor carriers of mannose-binding lectin variant alleles.
Cardinale F, etal., Int J Immunopathol Pharmacol. 2008 Jul-Sep;21(3):735-8.
15.
Deficient serum mannose-binding lectin levels and MBL2 polymorphisms increase the risk of single and recurrent Cryptosporidium infections in young children.
Carmolli M, etal., J Infect Dis. 2009 Nov 15;200(10):1540-7. doi: 10.1086/606013.
16.
High polymorphism of the MBL2 gene in patients with atopic dermatitis.
Carrera MC, etal., Ann Allergy Asthma Immunol. 2010 Jul;105(1):39-42. doi: 10.1016/j.anai.2010.03.017.
17.
L-ficolin (ficolin-2) insufficiency is associated with combined allergic and infectious respiratory disease in children.
Cedzynski M, etal., Mol Immunol. 2009 Dec;47(2-3):415-9. Epub 2009 Sep 19.
18.
Influence of mannose-binding lectin gene polymorphisms on the invasiveness of cytomegalovirus disease after solid organ transplantation.
Cervera C, etal., Transplant Proc. 2009 Jul-Aug;41(6):2259-61.
19.
Mannose-binding lectin polymorphisms and recurrent respiratory tract infection in Chinese children.
Chen J, etal., Eur J Pediatr. 2009 Nov;168(11):1305-13. Epub 2009 Jan 24.
20.
Modulating effects of mannose binding lectin genotype on arterial stiffness in children after Kawasaki disease.
Cheung YF, etal., Pediatr Res. 2004 Oct;56(4):591-6. Epub 2004 Aug 4.
21.
Mannose-binding lectin in chronic hepatitis B virus infection.
Chong WP, etal., Hepatology. 2005 Nov;42(5):1037-45. doi: 10.1002/hep.20891.
22.
Mannose-binding lectin-2 genotypes and recurrent late pregnancy losses.
Christiansen OB, etal., Hum Reprod. 2009 Feb;24(2):291-9. doi: 10.1093/humrep/den377. Epub 2008 Oct 16.
23.
Resistance of MBL gene-knockout mice to experimental systemic aspergillosis.
Clemons KV, etal., Immunol Lett. 2010 Feb 16;128(2):105-7. doi: 10.1016/j.imlet.2009.12.021. Epub 2010 Jan 12.
24.
Mannose-binding lectin gene polymorphisms as a susceptibility factor for chronic necrotizing pulmonary aspergillosis.
Crosdale DJ, etal., J Infect Dis. 2001 Sep 1;184(5):653-6. Epub 2001 Jul 24.
25.
Increased serum complement component 3 and mannose-binding lectin levels in adult Chinese patients with chronic rhinosinusitis.
Cui YH, etal., Rhinology. 2009 Jun;47(2):187-91.
26.
Mannan-binding lectin and ficolin deposition in skin lesions of pemphigus.
de Messias-Reason IJ, etal., Arch Dermatol Res. 2011 Sep;303(7):521-5. doi: 10.1007/s00403-011-1132-1. Epub 2011 Feb 16.
27.
The mannose-binding lectin-pathway is involved in complement activation in the course of renal ischemia-reperfusion injury.
de Vries B, etal., Am J Pathol. 2004 Nov;165(5):1677-88.
28.
Mannose-binding lectin deficiency is associated with early onset of polyarticular juvenile rheumatoid arthritis: a cohort study.
Dolman KM, etal., Arthritis Res Ther. 2008;10(2):R32. doi: 10.1186/ar2386. Epub 2008 Mar 11.
29.
Serum levels and H/L gene polymorphism of mannose-binding lectin in primary open angle glaucoma.
Dursun O, etal., Curr Eye Res. 2012 Mar;37(3):212-7. doi: 10.3109/02713683.2011.639124.
30.
Lack of genetic association of promoter and structural variants of mannan-binding lectin (MBL2) gene with susceptibility to generalized vitiligo.
Dwivedi M, etal., Br J Dermatol. 2009 Jul;161(1):63-9. doi: 10.1111/j.1365-2133.2009.09140.x. Epub 2009 Apr 16.
31.
Mannose-binding lectin in chronic hepatitis C in children.
Dzwonek AB, etal., Scand J Gastroenterol. 2015;50(10):1276-84. doi: 10.3109/00365521.2015.1006673. Epub 2015 May 8.
32.
Mannose-binding lectin genotypes in susceptibility to community-acquired pneumonia.
Endeman H, etal., Chest. 2008 Dec;134(6):1135-40. Epub 2008 Jul 18.
33.
Association of mannose-binding lectin-2 gene polymorphism with the development of hepatitis C-induced hepatocellular carcinoma.
Eurich D, etal., Liver Int. 2011 Aug;31(7):1006-12. doi: 10.1111/j.1478-3231.2011.02522.x. Epub 2011 Apr 15.
34.
Protection from inflammatory disease in insulin resistance: the role of mannan-binding lectin.
Fernandez-Real JM, etal., Diabetologia. 2006 Oct;49(10):2402-11. Epub 2006 Aug 29.
35.
Mannose-binding lectin is present in the infected airway: a possible pulmonary defence mechanism.
Fidler KJ, etal., Thorax. 2009 Feb;64(2):150-5. Epub 2008 Nov 6.
36.
Association of MBL2 gene exon 1 variants with autoimmune thyroid disease in Brazilian patients.
Filho CB, etal., Int J Immunogenet. 2012 Aug;39(4):357-61. doi: 10.1111/j.1744-313X.2012.01102.x. Epub 2012 Feb 23.
37.
Bipolar and panic disorders may be associated with hereditary defects in the innate immune system.
Foldager L, etal., J Affect Disord. 2014 Aug;164:148-54. doi: 10.1016/j.jad.2014.04.017. Epub 2014 Apr 19.
38.
Association of mannose-binding lectin gene polymorphisms with antiphospholipid syndrome, cardiovascular disease and chronic damage in patients with systemic lupus erythematosus.
Font J, etal., Rheumatology (Oxford). 2007 Jan;46(1):76-80. Epub 2006 Jun 26.
39.
Mannan-binding lectin modulates the response to HSV-2 infection.
Gadjeva M, etal., Clin Exp Immunol. 2004 Nov;138(2):304-11.
40.
Mannose-binding lectin and mannose-binding lectin-associated serine protease 2 in susceptibility, severity, and outcome of pneumonia in adults.
Garcia-Laorden MI, etal., J Allergy Clin Immunol. 2008 Aug;122(2):368-74, 374.e1-2. Epub 2008 Jun 25.
41.
Association of mannose-binding lectin gene heterogeneity with severity of lung disease and survival in cystic fibrosis.
Garred P, etal., J Clin Invest. 1999 Aug;104(4):431-7.
42.
Complement defects in patients with chronic rhinosinusitis.
Gaunsbaek MQ, etal., PLoS One. 2012;7(11):e47383. doi: 10.1371/journal.pone.0047383. Epub 2012 Nov 7.
43.
Mannose-binding lectin gene polymorphism, vulvovaginal candidiasis, and bacterial vaginosis.
Giraldo PC, etal., Obstet Gynecol. 2007 May;109(5):1123-8.
44.
Mannose-binding lectin gene polymorphism is a modulating factor in repeated respiratory infections.
Gomi K, etal., Chest. 2004 Jul;126(1):95-9.
45.
Polymorphisms in the mannose binding lectin-2 gene and acute respiratory distress syndrome.
Gong MN, etal., Crit Care Med. 2007 Jan;35(1):48-56.
46.
Development of pulmonary abnormalities in patients with common variable immunodeficiency: associations with clinical and immunologic factors.
Gregersen S, etal., Ann Allergy Asthma Immunol. 2010 Jun;104(6):503-10.
47.
Genetic variants of mannose-binding lectin 2 gene influence progression and prognosis of patients with hepatitis B virus infection in China.
Gu X, etal., Clin Res Hepatol Gastroenterol. 2016 Nov;40(5):614-621. doi: 10.1016/j.clinre.2015.12.015. Epub 2016 Feb 5.
48.
Association of hepatitis C virus infection and liver fibrosis severity with the variants alleles of MBL2 gene in a Brazilian population.
Halla MC, etal., Hum Immunol. 2010 Sep;71(9):883-7. doi: 10.1016/j.humimm.2010.05.021. Epub 2010 Jun 1.
49.
A variant in the promoter of MBL2 is associated with protection against visceral leishmaniasis in Morocco.
Hamdi S, etal., Infect Genet Evol. 2013 Jan;13:162-7. doi: 10.1016/j.meegid.2012.09.002. Epub 2012 Sep 18.
50.
Deficient mannose-binding lectin-mediated complement activation despite mannose-binding lectin-sufficient genotypes in an outbreak of Legionella pneumophila pneumonia.
Herpers BL, etal., Hum Immunol. 2009 Feb;70(2):125-9. doi: 10.1016/j.humimm.2008.11.002. Epub 2008 Dec 13.
51.
Therapeutic role for mannose-binding lectin in cigarette smoke-induced lung inflammation? Evidence from a murine model.
Hodge S, etal., Am J Respir Cell Mol Biol. 2010 Feb;42(2):235-42. Epub 2009 May 1.
52.
Mannose-binding lectin variant associated with severe malaria in young African children.
Holmberg V, etal., Microbes Infect. 2008 Apr;10(4):342-8. doi: 10.1016/j.micinf.2007.12.008. Epub 2007 Dec 28.
53.
Association between mannose-binding lectin gene polymorphism and pediatric cytomegalovirus infection.
Hu Y, etal., Viral Immunol. 2010 Aug;23(4):443-7.
54.
Serum mannose-binding lectin levels are decreased in behcet's disease and associated with disease severity.
Inanc N, etal., J Rheumatol. 2005 Feb;32(2):287-91.
55.
Mannose-binding lectin in severe acute respiratory syndrome coronavirus infection.
Ip WK, etal., J Infect Dis. 2005 May 15;191(10):1697-704. Epub 2005 Apr 11.
56.
Mannose-binding lectin variant alleles and HLA-DR4 alleles are associated with giant cell arteritis.
Jacobsen S, etal., J Rheumatol. 2002 Oct;29(10):2148-53.
57.
Elevated levels of mannan-binding lectin (MBL) and eosinophilia in patients of bronchial asthma with allergic rhinitis and allergic bronchopulmonary aspergillosis associate with a novel intronic polymorphism in MBL.
Kaur S, etal., Clin Exp Immunol. 2006 Mar;143(3):414-9.
58.
Protective role of mannan-binding lectin in a murine model of invasive pulmonary aspergillosis.
Kaur S, etal., Clin Exp Immunol. 2007 May;148(2):382-9. Epub 2007 Mar 5.
59.
Association of MBL2 polymorphism with asthma after bronchiolitis in infancy.
Koponen P, etal., Pediatr Int. 2012 Oct;54(5):619-22. doi: 10.1111/j.1442-200X.2012.03651.x. Epub 2012 Jul 19.
60.
Mannan-binding lectin in human serum, cerebrospinal fluid and brain tissue and its role in Alzheimer's disease.
Lanzrein AS, etal., Neuroreport. 1998 May 11;9(7):1491-5.
61.
Infections during induction therapy of childhood acute lymphoblastic leukemia--no association to mannose-binding lectin deficiency.
Lausen B, etal., Eur J Haematol. 2006 Jun;76(6):481-7. Epub 2006 Feb 23.
62.
Mannose-Binding Lectin Gene Polymorphism Contributes to Recurrence of Infective Exacerbation in COPD Patients.
Lin CL, etal., Chest. 2010 Aug 5.
63.
Impact of mannose-binding lectin 2 polymorphism on the risk of hepatocellular carcinoma: a case-control study in Chinese Han population.
Lin Y, etal., J Epidemiol. 2015;25(5):387-91. doi: 10.2188/jea.JE20140194. Epub 2015 Mar 14.
64.
Mannose-binding lectin gene polymorphic variants predispose to the development of bronchopulmonary complications but have no influence on other clinical and laboratory symptoms or signs of common variable immunodeficiency.
Litzman J, etal., Clin Exp Immunol. 2008 Sep;153(3):324-30. Epub 2008 Jul 11.
65.
The Chinese herbal formula Zhibai Dihuang Granule treat Yin-deficiency-heat syndrome rats by regulating the immune responses.
Liu CM, etal., J Ethnopharmacol. 2018 Oct 28;225:271-278. doi: 10.1016/j.jep.2018.05.001. Epub 2018 May 2.
66.
Genetically Determined MBL Deficiency Is Associated with Protection against Chronic Cardiomyopathy in Chagas Disease.
Luz PR, etal., PLoS Negl Trop Dis. 2016 Jan 8;10(1):e0004257. doi: 10.1371/journal.pntd.0004257. eCollection 2016 Jan.
67.
Mannose-binding lectin null alleles are associated with preserved epithelial cell integrity following intestinal ischemia reperfusion in man.
Matthijsen RA, etal., Mol Immunol. 2009 Jul;46(11-12):2244-8. doi: 10.1016/j.molimm.2009.04.010. Epub 2009 May 23.
68.
Use of a modeling framework to evaluate the effect of a modifier gene (MBL2) on variation in cystic fibrosis.
McDougal KE, etal., Eur J Hum Genet. 2010 Jun;18(6):680-4. Epub 2010 Jan 13.
69.
Structural polymorphism of the mannose-binding lectin 2 (MBL2 ) gene in HCV-infected patients with a serological marker for thyroid autoimmunity.
Melo FM, etal., Int J Immunogenet. 2009 Dec;36(6):377-81. doi: 10.1111/j.1744-313X.2009.00871.x. Epub 2009 Aug 24.
70.
Association of variant alleles of MBL2 gene with vasoocclusive crisis in children with sickle cell anemia.
Mendonca TF, etal., Blood Cells Mol Dis. 2010 Apr 15;44(4):224-8. doi: 10.1016/j.bcmd.2010.02.004. Epub 2010 Feb 20.
71.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
72.
MGDs mouse GO annotations
MGD data from the GO Consortium
73.
MGD IEA
MGD IEA
74.
High levels of serum mannose-binding lectin are associated with the severity of clinical signs of leptospirosis.
Miranda KA, etal., Braz J Med Biol Res. 2009 Apr;42(4):353-7.
75.
Mannose-binding Lectin (MBL) as a susceptible host factor influencing Indian Visceral Leishmaniasis.
Mishra A, etal., Parasitol Int. 2015 Dec;64(6):591-6. doi: 10.1016/j.parint.2015.08.003. Epub 2015 Aug 19.
76.
MBL2 polymorphism and risk of severe infections in multiple myeloma patients receiving high-dose melphalan and autologous stem cell transplantation.
Molle I, etal., Bone Marrow Transplant. 2006 Oct;38(8):555-60. Epub 2006 Sep 4.
77.
Mannan-binding lectin recognizes structures on ischaemic reperfused mouse kidneys and is implicated in tissue injury.
Moller-Kristensen M, etal., Scand J Immunol. 2005 May;61(5):426-34.
78.
Mannose-binding lectin gene variants and infections in patients receiving autologous stem cell transplantation.
Moreto A, etal., BMC Immunol. 2014 May 3;15:17. doi: 10.1186/1471-2172-15-17.
79.
Association between mannan-binding lectin and impaired lung function in cystic fibrosis may be age-dependent.
Muhlebach MS, etal., Clin Exp Immunol. 2006 Aug;145(2):302-7.
80.
Mannose binding lectin polymorphisms are associated with early age of disease onset and autoimmunity in common variable immunodeficiency.
Mullighan CG, etal., Scand J Immunol. 2000 Feb;51(2):111-22.
81.
Association between donor MBL promoter haplotype and graft survival and the development of BOS after lung transplantation.
Munster JM, etal., Transplantation. 2008 Dec 27;86(12):1857-63.
82.
Involvement of mannose-binding lectin in the pathogenesis of Kawasaki disease-like murine vasculitis.
Nakamura A, etal., Clin Immunol. 2014 Jul;153(1):64-72. doi: 10.1016/j.clim.2014.03.019. Epub 2014 Apr 8.
83.
Inflammation gene variants and susceptibility to albuminuria in the U.S. population: analysis in the Third National Health and Nutrition Examination Survey (NHANES III), 1991-1994.
Ned RM, etal., BMC Med Genet. 2010 Nov 5;11:155.
84.
Mannan-binding lectin deficiency increases the risk of recurrent infections in children with Down's syndrome.
Nisihara RM, etal., Hum Immunol. 2010 Jan;71(1):63-6. Epub .
85.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
86.
Childhood exposure to secondhand smoke and functional mannose binding lectin polymorphisms are associated with increased lung cancer risk.
Olivo-Marston SE, etal., Cancer Epidemiol Biomarkers Prev. 2009 Dec;18(12):3375-83.
87.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
88.
Might there be a link between mannose binding lectin and vitiligo?
Onay H, etal., Eur J Dermatol. 2007 Mar-Apr;17(2):146-8. Epub 2007 Mar 2.
89.
Genotypes coding for mannose-binding lectin deficiency correlated with cryptococcal meningitis in HIV-uninfected Chinese patients.
Ou XT, etal., J Infect Dis. 2011 Jun 1;203(11):1686-91. doi: 10.1093/infdis/jir152.
90.
Human mannose-binding lectin inhibitor prevents Shiga toxin-induced renal injury.
Ozaki M, etal., Kidney Int. 2016 Jul 1. pii: S0085-2538(16)30202-2. doi: 10.1016/j.kint.2016.05.011.
91.
Mannose binding lectin and ficolin-2 polymorphisms are associated with increased risk for bacterial infections in children with B acute lymphoblastic leukemia.
Pana ZD, etal., Pediatr Blood Cancer. 2014 Jun;61(6):1017-22. doi: 10.1002/pbc.24951. Epub 2014 Jan 22.
92.
Association of HYPA haplotype in the mannose-binding lectin gene-2 with Behcet's disease.
Park KS, etal., Tissue Antigens. 2005 Mar;65(3):260-5.
93.
Human mannose-binding lectin inhibitor prevents myocardial injury and arterial thrombogenesis in a novel animal model.
Pavlov VI, etal., Am J Pathol. 2015 Feb;185(2):347-55. doi: 10.1016/j.ajpath.2014.10.015. Epub 2014 Dec 4.
94.
Gene polymorphisms and febrile neutropenia in acute leukemia--no association with IL-4, CCR-5, IL-1RA, but the MBL-2, ACE, and TLR-4 are associated with the disease in Turkish patients: a preliminary study.
Pehlivan M, etal., Genet Test Mol Biomarkers. 2014 Jul;18(7):474-81. doi: 10.1089/gtmb.2014.0004. Epub 2014 May 12.
95.
Mannose-binding lectin 2 gene polymorphism and lung damage in primary ciliary dyskinesia.
Pifferi M, etal., Pediatr Pulmonol. 2015 Feb;50(2):179-86. doi: 10.1002/ppul.23026. Epub 2014 Apr 19.
96.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
97.
Association of mannose-binding lectin gene polymorphism but not of mannose-binding serine protease 2 with chronic severe aortic regurgitation of rheumatic etiology.
Ramasawmy R, etal., Clin Vaccine Immunol. 2008 Jun;15(6):932-6. doi: 10.1128/CVI.00324-07. Epub 2008 Apr 9.
98.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
99.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
100.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
101.
MBL genotype and risk of invasive pneumococcal disease: a case-control study.
Roy S, etal., Lancet. 2002 May 4;359(9317):1569-73.
102.
High rate of early restenosis after carotid eversion endarterectomy in homozygous carriers of the normal mannose-binding lectin genotype.
Rugonfalvi-Kiss S, etal., Stroke. 2005 May;36(5):944-8. Epub 2005 Mar 24.
103.
Mannose binding lectin gene (MBL2) functional polymorphisms are associated with systemic lupus erythematosus in southern Brazilians.
Sandrin-Garcia P, etal., Hum Immunol. 2011 Jun;72(6):516-21. Epub 2011 Apr 8.
104.
Association of TNF, MBL, and VDR polymorphisms with leprosy phenotypes.
Sapkota BR, etal., Hum Immunol. 2010 Oct;71(10):992-8. doi: 10.1016/j.humimm.2010.07.001. Epub 2010 Aug 1.
105.
MBL2 and MASP2 gene polymorphisms in patients with hepatocellular carcinoma.
Segat L, etal., J Viral Hepat. 2008 May;15(5):387-91. doi: 10.1111/j.1365-2893.2007.00965.x.
106.
Mannose-binding lectin 2 gene polymorphism in recurrent herpes simplex virus 2 infection.
Seppanen M, etal., Hum Immunol. 2009 Apr;70(4):218-21. doi: 10.1016/j.humimm.2009.01.022. Epub 2009 Feb 4.
107.
Functional mannose-binding lectin haplotype variants are associated with Alzheimer's disease.
Sjölander A, etal., J Alzheimers Dis. 2013;35(1):121-7. doi: 10.3233/JAD-122044.
108.
Association between mannose-binding lectin deficiency and septic shock following acute pyelonephritis due to Escherichia coli.
Smithson A, etal., Clin Vaccine Immunol. 2007 Mar;14(3):256-61. Epub 2007 Jan 3.
109.
MBL2 genotypes and their associations with MBL levels and NICU morbidity in a cohort of Greek neonates.
Speletas M, etal., J Immunol Res. 2015;2015:478412. doi: 10.1155/2015/478412. Epub 2015 Mar 24.
110.
Association study between mannose-binding lectin haplotypes and X gene mutation of hepatitis B virus from treatment naïve patients.
Su C, etal., Aging (Albany NY). 2016 Nov 7;8(11):2862-2870. doi: 10.18632/aging.101097.
111.
Association between mannose-binding lectin variants, haplotypes and risk of hepatocellular carcinoma: A case-control study.
Su C, etal., Sci Rep. 2016 Aug 25;6:32147. doi: 10.1038/srep32147.
112.
Mannose-Binding Lectin (MBL) and MBL-associated serine protease-2 (MASP-2) in women with malignant and benign ovarian tumours.
Swierzko AS, etal., Cancer Immunol Immunother. 2014 Nov;63(11):1129-40. doi: 10.1007/s00262-014-1579-y. Epub 2014 Jul 20.
113.
Association between mannose-binding lectin and HIV infection and progression in a Chinese population.
Tan Y, etal., Mol Immunol. 2009 Dec;47(2-3):632-8. doi: 10.1016/j.molimm.2009.08.020. Epub 2009 Sep 30.
114.
MBL2 gene variants coding for mannose-binding lectin deficiency are associated with increased risk of nephritis in Danish patients with systemic lupus erythematosus.
Tanha N, etal., Lupus. 2014 Oct;23(11):1105-11. doi: 10.1177/0961203314536478. Epub 2014 May 21.
115.
Genetic polymorphisms and serum levels of mannose-binding lectin in Chinese pediatric patients with common infectious diseases.
Tao R, etal., Int J Infect Dis. 2012 May;16(5):e403-7. doi: 10.1016/j.ijid.2012.01.014. Epub 2012 Mar 22.
116.
An MBL2 haplotype and ABCB4 variants modulate the risk of liver disease in cystic fibrosis patients: a multicentre study.
Tomaiuolo R, etal., Dig Liver Dis. 2009 Nov;41(11):817-22. Epub 2009 May 20.
117.
Does MBL2 codon 54 polymorphism play a role in the pathogenesis of psoriasis?
Turan H, etal., Int J Dermatol. 2014 Jan;53(1):34-8. doi: 10.1111/j.1365-4632.2012.5657.x. Epub 2012 Nov 1.
118.
Distinct alleles of mannose-binding lectin (MBL) and surfactant proteins A (SP-A) in patients with chronic cavitary pulmonary aspergillosis and allergic bronchopulmonary aspergillosis.
Vaid M, etal., Clin Chem Lab Med. 2007;45(2):183-6.
119.
Effects of mannose-binding lectin polymorphisms on irinotecan-induced febrile neutropenia.
van der Bol JM, etal., Oncologist. 2010;15(10):1063-72. doi: 10.1634/theoncologist.2010-0033. Epub 2010 Oct 7.
120.
Mannose binding lectin and FcgammaRIIa (CD32) polymorphism in Spanish systemic lupus erythematosus patients.
Villarreal J, etal., Rheumatology (Oxford). 2001 Sep;40(9):1009-12.
121.
Mannose-binding lectin 2 rs11003123 polymorphism is associated with the development of hepatocellular carcinoma in patients with hepatitis B-related cirrhosis in the Chinese population.
Wang PS, etal., Hepatobiliary Pancreat Dis Int. 2016 Jun;15(3):282-8.
122.
Mannose binding lectin (MBL) polymorphisms associated with low MBL production in patients with dermatomyositis.
Werth VP, etal., J Invest Dermatol. 2002 Dec;119(6):1394-9.
123.
Functional polymorphisms in the mannan-binding lectin 2 gene: effect on MBL levels and otitis media.
Wiertsema SP, etal., J Allergy Clin Immunol. 2006 Jun;117(6):1344-50. Epub 2006 Apr 27.
124.
Mannose binding lectin gene deficiency increases susceptibility to traumatic brain injury in mice.
Yager PH, etal., J Cereb Blood Flow Metab. 2008 May;28(5):1030-9. doi: 10.1038/sj.jcbfm.9600605. Epub 2008 Jan 9.
125.
[Correlation between mannose-binding lectin gene codon 54 polymorphism and susceptibility of Kawasaki disease].
Yang J, etal., Zhonghua Er Ke Za Zhi. 2004 Mar;42(3):176-9.
126.
HIV-1 Disease Progression and Survival in an Adult Population in Zimbabwe: Is There an Effect of the Mannose Binding Lectin Deficiency?
Zinyama-Gutsire RB, etal., OMICS. 2015 Sep;19(9):542-52. doi: 10.1089/omi.2015.0047.
Mbl2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 30,210,306 - 30,217,087 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 30,210,342 - 30,217,087 (+) Ensembl GRCm39 Ensembl GRCm38 19 30,232,906 - 30,239,687 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 30,232,942 - 30,239,687 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 30,307,447 - 30,314,172 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 30,298,954 - 30,305,679 (+) NCBI MGSCv36 mm8 Celera 19 31,010,980 - 31,017,684 (+) NCBI Celera Cytogenetic Map 19 C1 NCBI cM Map 19 25.14 NCBI
MBL2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 52,765,380 - 52,772,784 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 52,765,380 - 52,772,784 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 54,525,140 - 54,532,544 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 54,195,146 - 54,201,466 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 54,195,146 - 54,201,466 NCBI Celera 10 47,788,072 - 47,794,392 (-) NCBI Celera Cytogenetic Map 10 q21.1 NCBI HuRef 10 48,503,748 - 48,510,068 (-) NCBI HuRef CHM1_1 10 54,806,939 - 54,813,257 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 53,612,365 - 53,619,761 (-) NCBI T2T-CHM13v2.0
Mbl2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 237,429,873 - 237,465,567 (+) NCBI GRCr8 mRatBN7.2 1 228,016,439 - 228,024,736 (+) NCBI mRatBN7.2 mRatBN7.2 UTH_Rnor_SHR_Utx 1 236,419,619 - 236,424,489 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 243,349,309 - 243,354,179 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 236,171,876 - 236,176,773 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 248,435,069 - 248,442,669 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 248,723,397 - 248,729,962 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 255,681,084 - 255,688,683 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 233,978,931 - 233,983,824 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 234,140,682 - 234,147,846 (+) NCBI Celera 1 225,160,772 - 225,165,665 (+) NCBI Celera Cytogenetic Map 1 q52 NCBI
Mbl2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955425 7,702,137 - 7,709,006 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955425 7,704,371 - 7,708,951 (-) NCBI ChiLan1.0 ChiLan1.0
MBL2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 65,063,616 - 65,068,335 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 65,070,156 - 65,073,657 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 49,401,364 - 49,409,328 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 51,537,129 - 51,543,041 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 51,527,758 - 51,543,432 (-) Ensembl panpan1.1 panPan2
MBL1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 29,419,886 - 29,424,377 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 29,544,300 - 29,548,802 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 29,721,980 - 29,726,589 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 29,721,981 - 29,726,540 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 29,591,559 - 29,596,084 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 29,794,211 - 29,798,774 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 30,148,194 - 30,152,765 (-) NCBI UU_Cfam_GSD_1.0
MBL2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 97,102,823 - 97,108,083 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 97,103,926 - 97,107,635 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 105,632,322 - 105,636,031 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MBL2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 78,389,534 - 78,394,753 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 78,389,947 - 78,396,079 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 39,340,958 - 39,345,030 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mbl2 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 72 Count of miRNA genes: 67 Interacting mature miRNAs: 72 Transcripts: ENSMUST00000025797 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301271 Datd_m dopamine transporter density (mouse) Not determined 19 1 32340234 Mouse 13506250 Renmq1_m renal mercury accumulation QTL 1 (mouse) 19 27385594 61385705 Mouse 10412251 Mnp_m modifier of Niemann Pick type C1 (mouse) Not determined 19 20234314 54234461 Mouse 1357596 Tgct3_m testicular germ cell tumor 3 (mouse) Not determined 19 21984091 32912719 Mouse 11039522 Tbbr4_m Trypanosoma brucei brucei response 4 (mouse) 19 5313326 39313470 Mouse 1301336 Alcp23_m alcohol preference locus 23 (mouse) Not determined 19 15912607 49912719 Mouse 1558876 W3q14_m weight 3 weeks QTL 14 (mouse) Not determined 19 22313326 53911504 Mouse 1302019 Pgia23_m proteoglycan induced arthritis 23 (mouse) Not determined 19 9787453 43787602 Mouse 1301633 Alcp24_m alcohol preference locus 24 (mouse) Not determined 19 15912607 49912719 Mouse 14928311 Manh85_m mandible shape 85 (mouse) 19 11914789 45914789 Mouse 1357568 Tgct4_m testicular germ cell tumor 4 (mouse) Not determined 19 27771985 35295381 Mouse 1301451 Ath16_m atherosclerosis 16 (mouse) Not determined 19 25426917 59427005 Mouse 1300683 Fembm7_m femoral bone morphometry 7 (mouse) Not determined 19 30141224 61420004 Mouse 4141659 Pbwg20_m postnatal body weight growth 20 (mouse) Not determined 19 21378705 55378928 Mouse 1301942 Pas13_m pulmonary adenoma susceptibility 13 (mouse) Not determined 19 30141231 61420004 Mouse 10413881 Moe2_m modifier of epilepsy 2 (mouse) 19 14923016 48923138 Mouse 1302004 Lfp2_m long free running period 2 (mouse) Not determined 19 18295162 52295381 Mouse 1300923 Bits4_m bitterness sensitivity 4 (mouse) Not determined 19 3323216 37323348 Mouse 12790634 Ebm1_m Epidermolysis Bullosa modifier 1 (mouse) 19 24988439 58988439 Mouse 4141138 Femwf11_m femur work to failure 11 (mouse) Not determined 28140348 61420004 Mouse 1301410 Cd8mts6_m CD8 memory T cell subset 6 (mouse) Not determined 19 30141231 61420004 Mouse 4142343 Moen2_m modifier of engrailed QTL 2 (mouse) Not determined 19 20234314 54234461 Mouse 1302123 Tlsr8_m thymic lymphoma suppressor region 8 (mouse) Not determined 19 25136002 42388916 Mouse 4142406 Pbctlp1_m peripheral blood cytotoxic T lymphocyte percentage 1 (mouse) Not determined 1 32875174 Mouse 1300904 Chab5_m cholesterol absorption 5 (mouse) Not determined 19 1653764 35653927 Mouse 26884385 Skwq14_m skull length QTL 14, 16 week (mouse) 19 3250000 35877400 Mouse 1301800 Faq10_m fluctuating asymmetry QTL 10 (mouse) Not determined 19 3323216 37323348 Mouse 1300591 Pas3_m pulmonary adenoma susceptibility 3 (mouse) Not determined 19 3323216 37323348 Mouse 1302063 Eae19_m experimental allergic encephalomyelitis 19 (mouse) Not determined 19 18295162 52295381 Mouse 1302126 Skull26_m skull morphology 26 (mouse) Not determined 19 3323216 37323348 Mouse 1301228 Iba4_m induction of brown adipocytes 4 (mouse) Not determined 19 9305715 43305821 Mouse
D11440
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 19 30,239,514 - 30,239,593 UniSTS GRCm38 MGSCv37 19 30,314,004 - 30,314,083 UniSTS GRCm37 Celera 19 31,017,516 - 31,017,595 UniSTS Cytogenetic Map 19 C1 UniSTS cM Map 19 25.0 UniSTS Whitehead/MRC_RH 19 304.24 UniSTS
Mbl2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 19 C1 UniSTS cM Map 19 25.14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000025797 ⟹ ENSMUSP00000025797
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 30,210,342 - 30,217,087 (+) Ensembl GRCm38.p6 Ensembl 19 30,232,942 - 30,239,687 (+) Ensembl
RefSeq Acc Id:
NM_001365058 ⟹ NP_001351987
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 19 30,210,328 - 30,217,087 (+) NCBI GRCm38 19 30,232,928 - 30,239,687 (+) NCBI
Sequence:
ACTTTGAGGCATCTGTTCTGGTGGAAGAGGAGCTTCCTTGCCTCCTGAGTCTTTGCTGTGCCAAAGCCCTGAAATATCATATCTGTGTGAAAATAGGATTGGGGCTGCTGATGGTGGCACACATGTGA GAGCCTTCTGAACATAGTGTCTCCGCTCGTTCTCAACCCCTAGGCCATCAGACACTGGTGAGGAGCATGTCCATTTTCACATCCTTCCTTCTGCTGTGTGTGGTGACAGTGGTTTATGCAGAGACCTT AACCGAAGGTGTTCAAAATTCCTGCCCTGTGGTTACCTGCAGTTCTCCAGGCCTGAATGGCTTCCCAGGCAAAGATGGACGTGACGGTGCCAAGGGAGAAAAGGGAGAACCAGGTCAAGGGCTCAGAG GCTTGCAAGGCCCTCCTGGAAAAGTAGGACCTACAGGACCCCCAGGGAATCCGGGGTTAAAAGGAGCAGTGGGACCGAAAGGAGACCGTGGGGACAGAGCAGAATTTGATACTAGCGAAATTGATTCA GAAATTGCAGCCCTACGATCAGAGCTGAGAGCCCTGAGAAACTGGGTGCTCTTCTCTCTGAGTGAAAAAGTTGGAAAGAAGTATTTTGTGAGCAGTGTTAAAAAGATGAGCCTTGACAGAGTGAAGGC CCTGTGCTCCGAATTCCAGGGCTCTGTGGCCACTCCCAGGAATGCTGAGGAAAACTCGGCCATCCAGAAAGTGGCCAAAGATATTGCCTACTTGGGCATCACAGATGTGAGGGTTGAAGGCAGTTTTG AGGATCTGACAGGAAACAGAGTGCGCTATACTAATTGGAATGATGGGGAGCCCAACAACACGGGCGATGGGGAAGACTGTGTGGTGATCTTGGGAAATGGCAAGTGGAACGATGTCCCCTGCTCTGAC TCTTTTTTGGCAATCTGTGAATTCTCTGACTGAGGGTGCTTGTTTCTCAGCCCTCCTTGATTCTTTAGGGTACTCCTGACGTCCGCAGTTTGTTCTGAAAAATAAAATATGGGAAAATATAAACAATT CAACATTGGTTACCCAATGCATTCTCTTGTGAAGGTGTAGAAATAAAGTGAGTTTAGTTTTCATTTAT
hide sequence
RefSeq Acc Id:
NM_010776 ⟹ NP_034906
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 19 30,210,328 - 30,217,087 (+) NCBI GRCm38 19 30,232,928 - 30,239,687 (+) NCBI MGSCv37 19 30,307,447 - 30,314,172 (+) RGD Celera 19 31,010,980 - 31,017,684 (+) RGD cM Map 19 ENTREZGENE
Sequence:
ACTTTGAGGCATCTGTTCTGGTGGAAGAGGAGCTTCCTTGCCTCCTGAGTCTTTGCTGTGCCAAAGCCCTGAAATATCATATCTGGCCATCAGACACTGGTAAGTTGGAGGTGTGAACTTGTTTGGCT CTCCCTGCCTGCAGTGACACCAGAGACCTGGACACCAGTGACCTCCCTCAGAAGGGCGTCTCCTGCACGTGAGGAGCATGTCCATTTTCACATCCTTCCTTCTGCTGTGTGTGGTGACAGTGGTTTAT GCAGAGACCTTAACCGAAGGTGTTCAAAATTCCTGCCCTGTGGTTACCTGCAGTTCTCCAGGCCTGAATGGCTTCCCAGGCAAAGATGGACGTGACGGTGCCAAGGGAGAAAAGGGAGAACCAGGTCA AGGGCTCAGAGGCTTGCAAGGCCCTCCTGGAAAAGTAGGACCTACAGGACCCCCAGGGAATCCGGGGTTAAAAGGAGCAGTGGGACCGAAAGGAGACCGTGGGGACAGAGCAGAATTTGATACTAGCG AAATTGATTCAGAAATTGCAGCCCTACGATCAGAGCTGAGAGCCCTGAGAAACTGGGTGCTCTTCTCTCTGAGTGAAAAAGTTGGAAAGAAGTATTTTGTGAGCAGTGTTAAAAAGATGAGCCTTGAC AGAGTGAAGGCCCTGTGCTCCGAATTCCAGGGCTCTGTGGCCACTCCCAGGAATGCTGAGGAAAACTCGGCCATCCAGAAAGTGGCCAAAGATATTGCCTACTTGGGCATCACAGATGTGAGGGTTGA AGGCAGTTTTGAGGATCTGACAGGAAACAGAGTGCGCTATACTAATTGGAATGATGGGGAGCCCAACAACACGGGCGATGGGGAAGACTGTGTGGTGATCTTGGGAAATGGCAAGTGGAACGATGTCC CCTGCTCTGACTCTTTTTTGGCAATCTGTGAATTCTCTGACTGAGGGTGCTTGTTTCTCAGCCCTCCTTGATTCTTTAGGGTACTCCTGACGTCCGCAGTTTGTTCTGAAAAATAAAATATGGGAAAA TATAAACAATTCAACATTGGTTACCCAATGCATTCTCTTGTGAAGGTGTAGAAATAAAGTGAGTTTAGTTTTCATTTAT
hide sequence
RefSeq Acc Id:
XM_006526730 ⟹ XP_006526793
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 19 30,210,306 - 30,217,086 (+) NCBI GRCm38 19 30,232,906 - 30,239,686 (+) NCBI
Sequence:
AGTCAGGTTTAGCTCCTCCCTCACTTTGAGGCATCTGTTCTGGTGGAAGAGGAGCTTCCTTGCCTCCTGAGTCTTTGCTGTGCCAAAGCCCTGAAATATCATATCTGGCCATCAGACACTGGTGAGGA GCATGTCCATTTTCACATCCTTCCTTCTGCTGTGTGTGGTGACAGTGGTTTATGCAGAGACCTTAACCGAAGGTGTTCAAAATTCCTGCCCTGTGGTTACCTGCAGTTCTCCAGGCCTGAATGGCTTC CCAGGCAAAGATGGACGTGACGGTGCCAAGGGAGAAAAGGGAGAACCAGGTCAAGGGCTCAGAGGCTTGCAAGGCCCTCCTGGAAAAGTAGGACCTACAGGACCCCCAGGGAATCCGGGGTTAAAAGG AGCAGTGGGACCGAAAGGAGACCGTGGGGACAGAGCAGAATTTGATACTAGCGAAATTGATTCAGAAATTGCAGCCCTACGATCAGAGCTGAGAGCCCTGAGAAACTGGGTGCTCTTCTCTCTGAGTG AAAAAGTTGGAAAGAAGTATTTTGTGAGCAGTGTTAAAAAGATGAGCCTTGACAGAGTGAAGGCCCTGTGCTCCGAATTCCAGGGCTCTGTGGCCACTCCCAGGAATGCTGAGGAAAACTCGGCCATC CAGAAAGTGGCCAAAGATATTGCCTACTTGGGCATCACAGATGTGAGGGTTGAAGGCAGTTTTGAGGATCTGACAGGAAACAGAGTGCGCTATACTAATTGGAATGATGGGGAGCCCAACAACACGGG CGATGGGGAAGACTGTGTGGTGATCTTGGGAAATGGCAAGTGGAACGATGTCCCCTGCTCTGACTCTTTTTTGGCAATCTGTGAATTCTCTGACTGAGGGTGCTTGTTTCTCAGCCCTCCTTGATTCT TTAGGGTACTCCTGACGTCCGCAGTTTGTTCTGAAAAATAAAATATGGGAAAATATAAACAATTCAACATTGGTTACCCAATGCATTCTCTTGTGAAGGTGTAGAAATAAAGTGAGTTTAGTTTTCAT TTA
hide sequence
RefSeq Acc Id:
NP_034906 ⟸ NM_010776
- Peptide Label:
precursor
- UniProtKB:
P41317 (UniProtKB/Swiss-Prot), Q3UEK1 (UniProtKB/TrEMBL)
- Sequence:
MSIFTSFLLLCVVTVVYAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSE KVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
hide sequence
RefSeq Acc Id:
XP_006526793 ⟸ XM_006526730
- Peptide Label:
isoform X1
- UniProtKB:
P41317 (UniProtKB/Swiss-Prot), Q3UEK1 (UniProtKB/TrEMBL)
- Sequence:
MSIFTSFLLLCVVTVVYAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSE KVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
hide sequence
RefSeq Acc Id:
NP_001351987 ⟸ NM_001365058
- Peptide Label:
precursor
- UniProtKB:
P41317 (UniProtKB/Swiss-Prot), Q3UEK1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000025797 ⟸ ENSMUST00000025797
RGD ID: 13679248
Promoter ID: EPDNEW_M23772
Type: multiple initiation site
Name: Mbl2_1
Description: Mus musculus mannose-binding lectin 2 , mRNA.
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Mouse Assembly Chr Position (strand) Source GRCm38 19 30,232,933 - 30,232,993 EPDNEW
RGD ID: 6830191
Promoter ID: MM_KWN:26822
Type: Non-CpG
SO ACC ID: SO:0000170
Source: MPROMDB
Tissues & Cell Lines: Liver
Transcripts: ENSMUST00000025797
Position: Mouse Assembly Chr Position (strand) Source MGSCv36 19 30,307,166 - 30,307,666 (+) MPROMDB
RGD ID: 6847569
Promoter ID: MM_ACW:26534
Type: Non-CpG
SO ACC ID: SO:0000170
Source: MPROMDB
Tissues & Cell Lines: Liver
Transcripts: MBL2.CSEP07, MBL2.ESEP07
Position: Mouse Assembly Chr Position (strand) Source MGSCv36 19 30,309,166 - 30,309,666 (+) MPROMDB