Cnga1 (cyclic nucleotide gated channel subunit alpha 1)

Gene: Cnga1 (cyclic nucleotide gated channel subunit alpha 1) Rattus norvegicus

Analyze

Symbol:

Cnga1

Name:

cyclic nucleotide gated channel subunit alpha 1

RGD ID:

621815

Description:

Enables cGMP binding activity and intracellularly cGMP-activated cation channel activity. Involved in membrane depolarization; regulation of cytosolic calcium ion concentration; and spermatogenesis. Located in terminal bouton. Part of intracellular cyclic nucleotide activated cation channel complex. Human ortholog(s) of this gene implicated in retinitis pigmentosa and retinitis pigmentosa 49. Orthologous to human CNGA1 (cyclic nucleotide gated channel subunit alpha 1); PARTICIPATES IN altered visual phototransduction pathway; calcium/calcium-mediated signaling pathway; retinitis pigmentosa pathway; INTERACTS WITH 1,2-dimethylhydrazine; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cGMP-gated cation channel alpha-1; Cncg; CNG channel alpha-1; CNG-1; CNG1; cyclic nucleotide gated channel alpha 1; cyclic nucleotide-gated cation channel; cyclic nucleotide-gated cation channel 1; cyclic nucleotide-gated channel alpha-1; cyclic nucleotide-gated channel, photoreceptor; HCN; rod photoreceptor cGMP-gated cation channel subunit alpha; rod photoreceptor cGMP-gated channel subunit alpha

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CNGA1 (cyclic nucleotide gated channel subunit alpha 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cnga1 (cyclic nucleotide gated channel alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cnga1 (cyclic nucleotide gated channel subunit alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CNGA1 (cyclic nucleotide gated channel subunit alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CNGA1 (cyclic nucleotide gated channel subunit alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cnga1 (cyclic nucleotide gated channel subunit alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CNGA1 (cyclic nucleotide gated channel subunit alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103246137 (cyclic nucleotide gated channel subunit alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cnga1 (cyclic nucleotide gated channel subunit alpha 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CNGA1 (cyclic nucleotide gated channel subunit alpha 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cnga1 (cyclic nucleotide gated channel alpha 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cnga1a	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CngA	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	che-6	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	tax-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cnga1b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cng-2	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	cnga1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Is Marker For:

Strains: SD

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	35,920,948 - 35,959,065 (+)	NCBI		GRCr8
mRatBN7.2	14	35,566,947 - 35,605,065 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	35,567,125 - 35,605,065 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	35,932,350 - 35,970,416 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	37,237,096 - 37,275,170 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	35,725,471 - 35,763,536 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	38,155,771 - 38,171,107 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	38,155,759 - 38,171,010 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	37,966,503 - 37,981,839 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	38,017,762 - 38,033,098 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	38,021,111 - 38,036,448 (+)	NCBI
Celera	14	34,842,269 - 34,857,640 (+)	NCBI		Celera
Cytogenetic Map	14	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cone-rod dystrophy (ISO)

fundus dystrophy (ISO)

genetic disease (ISO)

macular degeneration (ISO)

prostate cancer (ISO)

retinitis pigmentosa (ISO)

retinitis pigmentosa 49 (ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cyclosporin A (ISO)

dibutyl phthalate (EXP)

endosulfan (ISO)

folic acid (ISO)

gamma-hexachlorocyclohexane (EXP)

nickel atom (ISO)

O-methyleugenol (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

progesterone (ISO)

sodium arsenite (ISO)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium ion transmembrane transport (IEA)

calcium ion transport (ISS)

membrane depolarization (IDA)

monoatomic cation transmembrane transport (IBA)

regulation of cytosolic calcium ion concentration (IDA)

sodium ion transmembrane transport (IEA)

sodium ion transport (ISS)

spermatogenesis (IEP)

visual perception (IEA)

Cellular Component

intracellular cyclic nucleotide activated cation channel complex (IBA,IDA)

membrane (ISO)

photoreceptor outer segment (ISO)

photoreceptor outer segment membrane (IEA,ISO)

plasma membrane (IBA,IEA)

rod photoreceptor outer segment (ISS)

terminal bouton (IDA)

Molecular Function

calcium channel activity (IEA)

cAMP binding (IEA,ISO,ISS)

cGMP binding (IBA,IDA,IEA,ISO)

intracellularly cAMP-activated cation channel activity (IBA,ISO,ISS)

intracellularly cGMP-activated cation channel activity (IBA,IDA,IEA,ISO)

intracellularly cyclic nucleotide-activated monoatomic cation channel activity (TAS)

protein binding (ISO)

protein-containing complex binding (IBA)

sodium channel activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

altered visual phototransduction pathway (ISO)

calcium transport pathway (TAS)

calcium/calcium-mediated signaling pathway (ISO)

retinitis pigmentosa pathway (ISO)

visual phototransduction pathway (IEA,TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	Calcium signalling remodelling and disease.	Berridge MJ Biochem Soc Trans. 2012 Apr;40(2):297-309. doi: 10.1042/BST20110766.
2.	Functional expression of the heteromeric "olfactory" cyclic nucleotide-gated channel in the hippocampus: a potential effector of synaptic plasticity in brain neurons.	Bradley J, etal., J Neurosci 1997 Mar 15;17(6):1993-2005.
3.	Developmental febrile seizures modulate hippocampal gene expression of hyperpolarization-activated channels in an isoform- and cell-specific manner.	Brewster A, etal., J Neurosci 2002 Jun 1;22(11):4591-9.
4.	Genes and mutations causing retinitis pigmentosa.	Daiger SP, etal., Clin Genet. 2013 Aug;84(2):132-41. doi: 10.1111/cge.12203. Epub 2013 Jun 19.
5.	Cloning and widespread distribution of the rat rod-type cyclic nucleotide-gated cation channel.	Ding C, etal., Am J Physiol 1997 Apr;272(4 Pt 1):C1335-44.
6.	Expression of subunits for the cAMP-sensitive 'olfactory' cyclic nucleotide-gated ion channel in the cochlea: implications for signal transduction.	Drescher MJ, etal., Brain Res Mol Brain Res 2002 Jan 31;98(1-2):1-14.
7.	Mutations in the gene encoding the alpha subunit of the rod cGMP-gated channel in autosomal recessive retinitis pigmentosa.	Dryja TP, etal., Proc Natl Acad Sci U S A 1995 Oct 24;92(22):10177-81.
8.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
10.	Cyclic nucleotide-gated ion channels.	Kaupp UB and Seifert R, Physiol Rev. 2002 Jul;82(3):769-824.
11.	Functional cGMP-gated channels in cerebellar granule cells.	Lopez-Jimenez ME, etal., J Cell Physiol. 2012 May;227(5):2252-63. doi: 10.1002/jcp.22964.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
15.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
16.	Functional role of cyclic nucleotide-gated channels in rat medial vestibular nucleus neurons.	Podda MV, etal., J Physiol. 2008 Feb 1;586(3):803-15. Epub 2007 Nov 29.
17.	GOA pipeline	RGD automated data pipeline
18.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	NO activates the olfactory cyclic nucleotide-gated conductance independent from cGMP in isolated rat olfactory receptor neurons.	Schmachtenberg O, etal., Brain Res 2003 Aug 1;980(1):146-50.
21.	Stage- and cell-specific expression of soluble guanylyl cyclase alpha and beta subunits, cGMP-dependent protein kinase I alpha and beta, and cyclic nucleotide-gated channel subunit 1 in the rat testis.	Shi F, etal., J Androl. 2005 Mar-Apr;26(2):258-63.
22.	Photoreceptor degeneration: genetic and mechanistic dissection of a complex trait.	Wright AF, etal., Nat Rev Genet. 2010 Apr;11(4):273-84. doi: 10.1038/nrg2717.
23.	The heteromeric cyclic nucleotide-gated channel adopts a 3A:1B stoichiometry.	Zhong H, etal., Nature 2002 Nov 14;420(6912):193-8.

Additional References at PubMed

PMID:8860239	PMID:10725384	PMID:14681019	PMID:15634774	PMID:16272883	PMID:16940558	PMID:18565991	PMID:18654668	PMID:18850083	PMID:20592197	PMID:20890309	PMID:21559843
PMID:22759964	PMID:23032687	PMID:25633097	PMID:37889366

Genomics

Comparative Map Data

Cnga1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	35,920,948 - 35,959,065 (+)	NCBI		GRCr8
mRatBN7.2	14	35,566,947 - 35,605,065 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	35,567,125 - 35,605,065 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	35,932,350 - 35,970,416 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	37,237,096 - 37,275,170 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	35,725,471 - 35,763,536 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	38,155,771 - 38,171,107 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	38,155,759 - 38,171,010 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	37,966,503 - 37,981,839 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	38,017,762 - 38,033,098 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	38,021,111 - 38,036,448 (+)	NCBI
Celera	14	34,842,269 - 34,857,640 (+)	NCBI		Celera
Cytogenetic Map	14	p11	NCBI

CNGA1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	47,935,977 - 48,016,681 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	47,935,977 - 48,016,681 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	47,937,994 - 48,018,698 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	47,632,751 - 47,649,483 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	47,778,958 - 47,824,359	NCBI
Celera	4	48,386,872 - 48,463,813 (-)	NCBI		Celera
Cytogenetic Map	4	p12	NCBI
HuRef	4	47,257,564 - 47,334,503 (-)	NCBI		HuRef
CHM1_1	4	47,937,102 - 48,014,053 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	47,903,221 - 47,983,754 (-)	NCBI		T2T-CHM13v2.0

Cnga1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	72,761,039 - 72,800,095 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	72,761,039 - 72,801,618 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	72,603,696 - 72,642,752 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	72,603,696 - 72,644,275 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	72,994,935 - 73,033,991 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	72,882,866 - 72,898,284 (-)	NCBI		MGSCv36	mm8
Celera	5	69,852,095 - 69,891,530 (-)	NCBI		Celera
Cytogenetic Map	5	C3.2	NCBI
cM Map	5	38.44	NCBI

Cnga1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955443	639,096 - 649,606 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955443	615,061 - 649,693 (+)	NCBI	ChiLan1.0	ChiLan1.0

CNGA1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	79,844,967 - 79,929,771 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	80,106,473 - 80,186,832 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	74,196,877 - 74,213,563 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	84,865,999 - 84,945,692 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	84,910,653 - 84,945,248 (+)	Ensembl	panpan1.1		panPan2

CNGA1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	43,831,159 - 43,864,276 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	43,831,163 - 43,864,276 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	43,783,705 - 43,816,818 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	44,430,864 - 44,464,133 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	44,430,868 - 44,464,133 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	44,108,422 - 44,141,536 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	43,640,294 - 43,673,581 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	44,523,433 - 44,556,694 (-)	NCBI		UU_Cfam_GSD_1.0

Cnga1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	32,190,442 - 32,206,819 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936482	14,091,913 - 14,107,787 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936482	14,091,343 - 14,107,793 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CNGA1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	37,896,459 - 37,969,344 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	37,896,460 - 37,968,935 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	39,950,659 - 39,971,201 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103246137
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	2,273,540 - 2,313,083 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	2,293,765 - 2,312,761 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	48,276,917 - 48,325,283 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cnga1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624761	18,992,384 - 19,004,202 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624761	18,992,372 - 19,004,247 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cnga1
372 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	25
Count of miRNA genes:	24
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000006469
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1581500	Renag1	Renal agenesis QTL 1			kidney development trait (VT:0000527)	percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940)	14	8170668	68298175	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9088978	39057237	Rat
10755459	Coatc15	Coat color QTL 15		0.01681	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	14	19836944	64836944	Rat
1300154	Bp189	Blood pressure QTL 189	3.04		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	14	30883777	68757901	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30320092	80829842	Rat
2324617	Coatc2	Coat color QTL 2		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	14	30767025	39153750	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8267090	53267090	Rat
71117	Niddm17	Non-insulin dependent diabetes mellitus QTL 17	2.35		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	17593761	42336881	Rat
61420	Pia6	Pristane induced arthritis QTL 6	4.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	14	18631345	42337007	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
2313397	Coatc1	Coat color QTL1			coat/hair pigmentation trait (VT:0010463)	coat/hair color measurement (CMO:0001808)	14	18541332	63541332	Rat
631262	Tcas4	Tongue tumor susceptibility QTL 4	7.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	14	17622561	42337007	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41131407	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8267090	53267090	Rat

Markers in Region

RH142314

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	35,589,400 - 35,590,305 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	38,155,781 - 38,156,685	NCBI	Rnor6.0
Rnor_5.0	14	37,966,513 - 37,967,417	UniSTS	Rnor5.0
RGSC_v3.4	14	38,017,772 - 38,018,676	UniSTS	RGSC3.4
Celera	14	34,842,279 - 34,843,183	UniSTS
Cytogenetic Map	14	p11	UniSTS

RH135428

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	35,604,683 - 35,604,880 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	38,171,063 - 38,171,259	NCBI	Rnor6.0
Rnor_5.0	14	37,981,795 - 37,981,991	UniSTS	Rnor5.0
RGSC_v3.4	14	38,033,054 - 38,033,250	UniSTS	RGSC3.4
Celera	14	34,857,596 - 34,857,792	UniSTS
Cytogenetic Map	14	p11	UniSTS

Related Rat Strains

The following Strains have been annotated to Cnga1

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	hemolymphoid system	nervous system	renal system	reproductive system	respiratory system
High
Medium							7
Low	1		14	8	45		20	1
Below cutoff		2	2	10	23	15	10	6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111383	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U48803	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70257	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U76220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U93851	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006469 ⟹ ENSRNOP00000006469

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	35,567,125 - 35,605,065 (+)	Ensembl
Rnor_6.0 Ensembl	14	38,155,759 - 38,171,010 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104815 ⟹ ENSRNOP00000079731

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	35,567,125 - 35,605,065 (+)	Ensembl

RefSeq Acc Id:

NM_053497 ⟹ NP_445949

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	35,920,948 - 35,959,065 (+)	NCBI
mRatBN7.2	14	35,566,947 - 35,605,065 (+)	NCBI
Rnor_6.0	14	38,155,771 - 38,171,107 (+)	NCBI
Rnor_5.0	14	37,966,503 - 37,981,839 (+)	NCBI
RGSC_v3.4	14	38,017,762 - 38,033,098 (+)	RGD
Celera	14	34,842,269 - 34,857,640 (+)	RGD

Sequence:

show sequence

ATGAAAAAGGTGATTATCAACACGTGGCATTCCTTCGTAAATATCCCCAACGTGGTTGTACCAG
CTATCGAAAAGGAAATTCGACGCATGGAAAATGGGGCGTGCAGCTCATTTTCTGACAATGACAA
TGGCTCTCTGTCTGAAGAATCAGAGAATGAGGACTCTCTCTTTAGAAGCAACTCATACAGAAGG
CGAGGACCATCCCAGAGGGAGCATTACTTGCCAGGCACCATGGCTCTTTTCAATGTTAACAACA
GCAGCAACAAAGACCAAGACCCAAAGGAGAAAAAGAAAAAGAAAAAGGAAAAGAAGAGCAAGGC
CGATGATAAAAAGGAAAGTAAAAAGGACCCAGAGAAGAAAAAAAAGAAGGAAAAGGAAAAAGAG
AAGAAAAAGGAGGAGAAACCCAAAGAAAAGAAAGAAGGGGAGAAAAAAGAAGTTGTGGTTATTG
ATCCCTCAGGAAACATGTACTACAACTGGCTGTTTTGTATCACTTTACCTGTGATGTACAACTG
GACGATGATTATTGCAAGAGCATGTTTTGATGAACTCCAGTCTGATTACCTAGAATATTGGCTC
ATTTTTGATTACGTATCAGATGTAGTCTACCTTGCTGATATGTTTGTACGGACAAGGACAGGTT
ACCTGGAACAAGGGTTGCTAGTGAAAGACAAACTGAAACTCATAGAGAAGTACAAAGCAAACCT
GCAGTTTAAACTTGACGTTCTGTCAGTGATACCGACCGACCTGCTGTATTTCAAGTTTGGGTGG
AACTATCCAGAAATCAGGTTGAACCGGCTGTTAAGAATCTCTCGGATGTTTGAGTTCTTCCAGA
GGACAGAGACAAGGACCAACTACCCGAACATCTTTAGGATCTCAAACCTTGTGATGTACATTGT
CATCATCATCCACTGGAACGCGTGTGTGTACTACTCCATCTCAAAAGCTATTGGATTTGGGAAT
GACACATGGGTCTACCCTGATGTTAATGATCCTGAATTTGGCCGTTTGGCTAGAAAATACGTCT
ACAGCCTTTATTGGTCTACCTTGACTTTGACGACCATTGGAGAAACCCCACCCCCCGTGCTGGA
TTCCGAGTATGTCTTTGTGGTGGTAGACTTCTTAATTGGAGTTTTAATTTTTGCCACCATTGTC
GGTAACATAGGCTCCATGATTTCCAATATGAATGCAGCCCGGGCAGAATTTCAATCAAGAGTTG
ATGCTATCAAACAGTACATGAATTTTCGAAATGTGAGCAAAGACATGGAAAAGAGAGTTATTAA
ATGGTTTGACTACCTGTGGACTAACAAAAAGACAGTCGATGAGAGAGAAGTTCTGAGATACCTC
CCTGACAAACTCAGGGCAGAGATTGCCATCAATGTTCACCTAGACACGTTAAAAAAGGTTCGTA
TCTTTGCTGACTGTGAGGCTGGTCTGTTGGTGGAGTTGGTGTTGAAATTACAACCCCAGGTGTA
CAGTCCTGGAGATTACATATGCAAGAAAGGGGACATTGGGCGGGAGATGTACATCATCAAGGAA
GGCAAACTTGCTGTGGTGGCAGACGACGGAATCACACAGTTTGTGGTGTTGAGTGACGGCAGCT
ACTTTGGCGAGATCAGCATTCTTAACATCAAAGGCAGCAAGGCTGGCAACCGAAGAACAGCCAA
TATTAAGAGCATTGGCTACTCGGACCTGTTCTGCCTCTCAAAGGATGACCTCATGGAAGCTCTT
ACAGAGTACCCAGATGCCAAAACTATGTTGGAGGAGAAAGGGAGGCAGATCTTAATGAAAGACG
GTCTACTGGATATAAACATTGCGAATTTGGGCAGTGACCCTAAAGACCTGGAAGAGAAGGTCAC
TCGAATGGAGGGGTCAGTGGACCTCCTGCAAACACGATTTGCCCGAATCTTGGCTGAGTATGAA
TCGATGCAGCAGAAACTCAAGCAAAGATTAACCAAGGTTGAGAAATTCTTGAAACCACTTATTG
AAACTGAATTTTCAGCCCTTGAGGAACCCGGAGGAGAAAGTGAACCCACAGAGTCTCTACAGGG
CTAAAAAAAAACCTGGCCAATAGCAAAAACCATGCACGCCGTGTGATCCTTTTGAGCGCTTGAC
CAGAGACAATTGAGAATTGGGAGAAAAGAGTTCTCT

hide sequence

RefSeq Acc Id:

XM_039092516 ⟹ XP_038948444

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	35,942,894 - 35,959,060 (+)	NCBI
mRatBN7.2	14	35,589,082 - 35,605,065 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_445949	(Get FASTA)	NCBI Sequence Viewer
	XP_038948444	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA92110	(Get FASTA)	NCBI Sequence Viewer
	AAB09565	(Get FASTA)	NCBI Sequence Viewer
	AAC17594	(Get FASTA)	NCBI Sequence Viewer
	AAC53139	(Get FASTA)	NCBI Sequence Viewer
	EDL89991	(Get FASTA)	NCBI Sequence Viewer
	EDL89992	(Get FASTA)	NCBI Sequence Viewer
	EDL89993	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006469.3
	ENSRNOP00000079731.1
GenBank Protein	Q62927	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445949 ⟸ NM_053497

- UniProtKB:

Q62927 (UniProtKB/Swiss-Prot), O08659 (UniProtKB/Swiss-Prot), F1LQN0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKKVIINTWHSFVNIPNVVVPAIEKEIRRMENGACSSFSDNDNGSLSEESENEDSLFRSNSYRR
RGPSQREHYLPGTMALFNVNNSSNKDQDPKEKKKKKKEKKSKADDKKESKKDPEKKKKKEKEKE
KKKEEKPKEKKEGEKKEVVVIDPSGNMYYNWLFCITLPVMYNWTMIIARACFDELQSDYLEYWL
IFDYVSDVVYLADMFVRTRTGYLEQGLLVKDKLKLIEKYKANLQFKLDVLSVIPTDLLYFKFGW
NYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGN
DTWVYPDVNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVLDSEYVFVVVDFLIGVLIFATIV
GNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLRYL
PDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKE
GKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEAL
TEYPDAKTMLEEKGRQILMKDGLLDINIANLGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYE
SMQQKLKQRLTKVEKFLKPLIETEFSALEEPGGESEPTESLQG

hide sequence

Ensembl Acc Id:

ENSRNOP00000006469 ⟸ ENSRNOT00000006469

RefSeq Acc Id:	XP_038948444 ⟸ XM_039092516
- Peptide Label:	isoform X1
- UniProtKB:	Q62927 (UniProtKB/Swiss-Prot), O08659 (UniProtKB/Swiss-Prot), F1LQN0 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000079731 ⟸ ENSRNOT00000104815

Protein Domains

Cyclic nucleotide-binding

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62927-F1-model_v2	AlphaFold	Q62927	1-683	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621815	AgrOrtholog
BioCyc Gene	G2FUF-15851	BioCyc
Ensembl Genes	ENSRNOG00000004778	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006469.5	UniProtKB/TrEMBL
	ENSRNOT00000104815.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.287.70	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	1.20.5.170	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.60.120.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Helix hairpin bin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	CLZ_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	cNMP-bd-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	cNMP-bd_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	cNMP-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ion_trans_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RmlC-like_jellyroll	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:85259	UniProtKB/Swiss-Prot
NCBI Gene	85259	ENTREZGENE
PANTHER	CYCLIC NUCLEOTIDE-GATED CATION CHANNEL SUBUNIT A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR45638:SF9	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CLZ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	cNMP_binding	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ion_trans	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cnga1	PhenoGen
PROSITE	CNMP_BINDING_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CNMP_BINDING_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CNMP_BINDING_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004778	RatGTEx
SMART	cNMP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF51206	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Voltage-gated potassium channels	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZP66_RAT	UniProtKB/TrEMBL
	A6JD69_RAT	UniProtKB/TrEMBL
	A6JD70_RAT	UniProtKB/TrEMBL
	A6JD71_RAT	UniProtKB/TrEMBL
	CNGA1_RAT	UniProtKB/Swiss-Prot
	F1LQN0	ENTREZGENE, UniProtKB/TrEMBL
	O08659	ENTREZGENE
	Q62927	ENTREZGENE
UniProt Secondary	O08659	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-07-02	Cnga1	cyclic nucleotide gated channel subunit alpha 1	Cnga1	cyclic nucleotide gated channel alpha 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Cnga1	cyclic nucleotide gated channel alpha 1		cyclic nucleotide-gated cation channel	Name updated	1299863	APPROVED
2004-09-10	Cnga1	cyclic nucleotide-gated cation channel	Cncg		Symbol and Name updated	1299863	APPROVED
2002-08-07	Cncg	cyclic nucleotide-gated cation channel			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_disease	contains a leucine-zipper-homology domain named CLZ and mediates an inter-subunit interaction	632402
gene_disease	associated with febrile seizures and limbic epilepsy	625755
gene_expression	mRNA and protein expression seen early on postnatal day 2 and showed age specific changes in hippocampus and during the developmental phase of hippocampal connectivity	625755
gene_expression	expressed in neurons of brain, hippocampus and heart	625755
gene_expression	mRNA and proteins are expressed in isoform specific and neuron selective manner	625755
gene_process	role in mediation of hyperpolarization-activated currents, mediates neuronal membrane potential involved in pacemaker activity, and promotes synchronization of thalamus and hippocampal neuronal networks	625755
gene_regulation	regulated by constant hippocampal circuit activity in a duration dependent manner	625755
gene_regulation	transcriptional regulation is associated with excitability of the hippocampal network and in heart is regulated by thyroid hormone	625755

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)