Symbol:
Rab3b
Name:
RAB3B, member RAS oncogene family
RGD ID:
620922
Description:
Predicted to enable several functions, including GDP binding activity; GTP-dependent protein binding activity; and myosin V binding activity. Predicted to be involved in several processes, including positive regulation of dopamine uptake involved in synaptic transmission; regulation of synaptic vesicle cycle; and regulation of vesicle size. Predicted to act upstream of or within peptidyl-cysteine methylation and regulation of exocytosis. Is active in synaptic vesicle membrane. Orthologous to human RAB3B (RAB3B, member RAS oncogene family); INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 2,3,7,8-tetrachlorodibenzodioxine; 3',5'-cyclic AMP.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ras-related protein Rab-3B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RAB3B (RAB3B, member RAS oncogene family) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Rab3b (RAB3B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rab3b (RAB3B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RAB3B (RAB3B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RAB3B (RAB3B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rab3b (RAB3B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RAB3B (RAB3B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RAB3B (RAB3B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rab3b (RAB3B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RAB3C (RAB3C, member RAS oncogene family) HGNC
OrthoDB
Homo sapiens (human):
RAB3A (RAB3A, member RAS oncogene family) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
RAB3B (RAB3B, member RAS oncogene family)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rab3b (RAB3B, member RAS oncogene family)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rab3b (RAB3B, member RAS oncogene family)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rab-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rab3
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
rab3b
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 128,859,034 - 128,926,087 (+) NCBI GRCr8 mRatBN7.2 5 123,629,562 - 123,697,410 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 123,644,423 - 123,697,401 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 126,253,240 - 126,320,296 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 127,976,344 - 128,043,394 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 128,027,632 - 128,094,680 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 128,501,789 - 128,568,170 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 128,501,847 - 128,568,188 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 132,343,152 - 132,408,838 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 130,185,155 - 130,284,038 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 130,229,349 - 130,288,894 (+) NCBI Celera 5 122,364,678 - 122,431,394 (+) NCBI Celera Cytogenetic Map 5 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rab3b Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane multiple interactions EXP 6480464 2,2-bis(4-hydroxyphenyl)-1,1,1-trichloroethane affects the reaction [Cyclic AMP affects the expression of RAB3B mRNA]; 2,2-bis(4-hydroxyphenyl)-1,1,1-trichloroethane affects the more ... CTD PMID:19414516 Rab3b Rat 1,2-dimethylhydrazine decreases expression ISO RGD:736583 6480464 1,2-Dimethylhydrazine results in decreased expression of RAB3B mRNA CTD PMID:22206623 Rab3b Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:736583 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of RAB3B mRNA] CTD PMID:22206623 Rab3b Rat 17beta-estradiol multiple interactions ISO RGD:736582 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of RAB3B mRNA CTD PMID:30165855 Rab3b Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:736582 6480464 Dihydrotestosterone results in increased expression of RAB3B mRNA CTD PMID:29581250 Rab3b Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO RGD:736583 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of RAB3B mRNA CTD PMID:31388691 Rab3b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:736583 6480464 Tetrachlorodibenzodioxin affects the expression of RAB3B mRNA CTD PMID:21570461|PMID:26377647 Rab3b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RAB3B mRNA CTD PMID:33387578 Rab3b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:736583 6480464 Tetrachlorodibenzodioxin results in increased expression of RAB3B mRNA CTD PMID:19933214|PMID:25975270|PMID:26290441 Rab3b Rat 2-bromohexadecanoic acid multiple interactions ISO RGD:736582 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Rab3b Rat 2-hydroxypropanoic acid decreases expression ISO RGD:736582 6480464 Lactic Acid results in decreased expression of RAB3B mRNA CTD PMID:30851411 Rab3b Rat 3',5'-cyclic AMP multiple interactions EXP 6480464 2,2-bis(4-hydroxyphenyl)-1,1,1-trichloroethane affects the reaction [Cyclic AMP affects the expression of RAB3B mRNA] CTD PMID:19414516 Rab3b Rat 3,3',5-triiodo-L-thyronine increases expression ISO RGD:736582 6480464 Triiodothyronine results in increased expression of RAB3B mRNA CTD PMID:15507505 Rab3b Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:736582 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Rab3b Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of RAB3B mRNA CTD PMID:30047161 Rab3b Rat aflatoxin B1 affects expression ISO RGD:736582 6480464 Aflatoxin B1 affects the expression of RAB3B protein CTD PMID:20106945 Rab3b Rat all-trans-retinoic acid increases expression ISO RGD:736582 6480464 Tretinoin results in increased expression of RAB3B mRNA CTD PMID:23724009 Rab3b Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of RAB3B mRNA CTD PMID:35163327 Rab3b Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of RAB3B mRNA CTD PMID:30047161 Rab3b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RAB3B mRNA CTD PMID:16483693 Rab3b Rat arsenite(3-) affects expression ISO RGD:736582 6480464 arsenite affects the expression of RAB3B mRNA CTD PMID:22959463 Rab3b Rat atrazine increases expression ISO RGD:736582 6480464 Atrazine results in increased expression of RAB3B mRNA CTD PMID:22378314 Rab3b Rat benzo[a]pyrene increases expression ISO RGD:736582 6480464 Benzo(a)pyrene results in increased expression of RAB3B mRNA CTD PMID:20106945|PMID:21632981|PMID:22316170 Rab3b Rat benzo[a]pyrene affects methylation ISO RGD:736582 6480464 Benzo(a)pyrene affects the methylation of RAB3B promoter CTD PMID:27901495 Rab3b Rat benzo[a]pyrene increases methylation ISO RGD:736582 6480464 Benzo(a)pyrene results in increased methylation of RAB3B 5' UTR CTD PMID:27901495 Rab3b Rat benzo[a]pyrene increases expression ISO RGD:736583 6480464 Benzo(a)pyrene results in increased expression of RAB3B mRNA CTD PMID:15034205|PMID:32417428 Rab3b Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 Rab3b Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:736583 6480464 Diethylhexyl Phthalate results in decreased expression of RAB3B mRNA CTD PMID:34319233 Rab3b Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:736583 6480464 [Streptozocin co-treated with Diethylhexyl Phthalate] results in decreased expression of RAB3B mRNA CTD PMID:31606821 Rab3b Rat bisphenol A multiple interactions ISO RGD:736582 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Rab3b Rat bisphenol A decreases expression ISO RGD:736582 6480464 bisphenol A results in decreased expression of RAB3B protein CTD PMID:31675489 Rab3b Rat butanal increases expression ISO RGD:736582 6480464 butyraldehyde results in increased expression of RAB3B mRNA CTD PMID:26079696 Rab3b Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 Rab3b Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of RAB3B mRNA CTD PMID:19167457 Rab3b Rat cadmium atom multiple interactions ISO RGD:736582 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Rab3b Rat cadmium dichloride increases expression ISO RGD:736582 6480464 Cadmium Chloride results in increased expression of RAB3B mRNA CTD PMID:38382870 Rab3b Rat cadmium dichloride multiple interactions ISO RGD:736582 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Rab3b Rat carbon nanotube increases expression ISO RGD:736583 6480464 Nanotubes, Carbon results in increased expression of RAB3B mRNA CTD PMID:25554681 Rab3b Rat CGP 52608 multiple interactions ISO RGD:736582 6480464 CGP 52608 promotes the reaction [RORA protein binds to RAB3B gene] CTD PMID:28238834 Rab3b Rat chlorpyrifos increases expression ISO RGD:736583 6480464 Chlorpyrifos results in increased expression of RAB3B mRNA CTD PMID:32715474|PMID:37019170 Rab3b Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of RAB3B mRNA CTD PMID:23558232 Rab3b Rat cisplatin multiple interactions ISO RGD:736582 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of RAB3B mRNA CTD PMID:27392435 Rab3b Rat cisplatin multiple interactions EXP 6480464 trichostatin A inhibits the reaction [Cisplatin results in decreased expression of RAB3B mRNA] CTD PMID:23558232 Rab3b Rat copper(II) sulfate increases expression ISO RGD:736582 6480464 Copper Sulfate results in increased expression of RAB3B mRNA CTD PMID:19549813 Rab3b Rat cyclosporin A increases expression ISO RGD:736582 6480464 Cyclosporine results in increased expression of RAB3B mRNA CTD PMID:20106945|PMID:21632981|PMID:25562108 Rab3b Rat decabromodiphenyl ether multiple interactions EXP 6480464 [Flame Retardants co-treated with pentabromodiphenyl ether co-treated with decabromobiphenyl ether co-treated with hexabromocyclododecane] results in more ... CTD PMID:32207525 Rab3b Rat dexamethasone multiple interactions ISO RGD:736582 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Rab3b Rat dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 Rab3b Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of RAB3B mRNA CTD PMID:18636392 Rab3b Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 Rab3b Rat diethylstilbestrol increases expression ISO RGD:736582 6480464 Diethylstilbestrol results in increased expression of RAB3B mRNA CTD PMID:36621641 Rab3b Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 Rab3b Rat diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 Rab3b Rat disodium selenite increases expression ISO RGD:736582 6480464 Sodium Selenite results in increased expression of RAB3B mRNA CTD PMID:18514395 Rab3b Rat dorsomorphin multiple interactions ISO RGD:736582 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Rab3b Rat doxorubicin affects response to substance ISO RGD:736582 6480464 RAB3B protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Rab3b Rat doxorubicin increases expression ISO RGD:736582 6480464 Doxorubicin results in increased expression of RAB3B mRNA CTD PMID:30031762 Rab3b Rat ethanol increases expression ISO RGD:736583 6480464 Ethanol results in increased expression of RAB3B mRNA CTD PMID:30319688 Rab3b Rat ethanol affects splicing ISO RGD:736583 6480464 Ethanol affects the splicing of RAB3B mRNA CTD PMID:30319688 Rab3b Rat fenamidone decreases expression ISO RGD:736583 6480464 fenamidone results in decreased expression of RAB3B mRNA CTD PMID:27029645 Rab3b Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of RAB3B mRNA CTD PMID:18035473 Rab3b Rat folic acid multiple interactions ISO RGD:736583 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of RAB3B mRNA] CTD PMID:22206623 Rab3b Rat geldanamycin increases expression ISO RGD:736582 6480464 geldanamycin results in increased expression of RAB3B mRNA CTD PMID:26705709 Rab3b Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of RAB3B mRNA CTD PMID:22061828 Rab3b Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RAB3B mRNA CTD PMID:33387578 Rab3b Rat GSK-J4 increases expression ISO RGD:736582 6480464 GSK-J4 results in increased expression of RAB3B mRNA CTD PMID:29301935 Rab3b Rat hydroquinone increases expression ISO RGD:736582 6480464 hydroquinone results in increased expression of RAB3B mRNA CTD PMID:31256213 Rab3b Rat indometacin multiple interactions ISO RGD:736582 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Rab3b Rat ivermectin decreases expression ISO RGD:736582 6480464 Ivermectin results in decreased expression of RAB3B protein CTD PMID:32959892 Rab3b Rat ketoconazole increases expression ISO RGD:736582 6480464 Ketoconazole results in increased expression of RAB3B mRNA CTD PMID:36621641 Rab3b Rat L-ascorbic acid multiple interactions ISO RGD:736582 6480464 [Quercetin co-treated with Ascorbic Acid] results in increased expression of RAB3B mRNA CTD PMID:17639512 Rab3b Rat L-ascorbic acid increases expression EXP 6480464 Ascorbic Acid results in increased expression of RAB3B mRNA CTD PMID:15372504 Rab3b Rat lead(0) affects expression ISO RGD:736582 6480464 Lead affects the expression of RAB3B mRNA CTD PMID:28903495 Rab3b Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of RAB3B mRNA CTD PMID:30047161 Rab3b Rat methylmercury chloride increases expression ISO RGD:736582 6480464 methylmercuric chloride results in increased expression of RAB3B mRNA CTD PMID:26272509|PMID:28001369 Rab3b Rat nickel atom decreases expression ISO RGD:736582 6480464 Nickel results in decreased expression of RAB3B mRNA CTD PMID:24768652|PMID:25583101 Rab3b Rat okadaic acid increases expression ISO RGD:736582 6480464 Okadaic Acid results in increased expression of RAB3B mRNA CTD PMID:38832940 Rab3b Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of RAB3B mRNA CTD PMID:18636392 Rab3b Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of RAB3B mRNA CTD PMID:33387578 Rab3b Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of RAB3B mRNA CTD PMID:32680482 Rab3b Rat pentanal increases expression ISO RGD:736582 6480464 pentanal results in increased expression of RAB3B mRNA CTD PMID:26079696 Rab3b Rat perfluorohexanesulfonic acid decreases expression ISO RGD:736583 6480464 perfluorohexanesulfonic acid results in decreased expression of RAB3B mRNA CTD PMID:37995155 Rab3b Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of RAB3B mRNA CTD PMID:35163327 Rab3b Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of RAB3B mRNA CTD PMID:35163327 Rab3b Rat phenylephrine decreases expression EXP 6480464 Phenylephrine results in decreased expression of RAB3B mRNA CTD PMID:18158353 Rab3b Rat pirinixic acid multiple interactions ISO RGD:736582 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Rab3b Rat progesterone decreases expression ISO RGD:736582 6480464 Progesterone results in decreased expression of RAB3B mRNA CTD PMID:20864642 Rab3b Rat propanal increases expression ISO RGD:736582 6480464 propionaldehyde results in increased expression of RAB3B mRNA CTD PMID:26079696 Rab3b Rat quercetin multiple interactions ISO RGD:736582 6480464 [Quercetin co-treated with Ascorbic Acid] results in increased expression of RAB3B mRNA CTD PMID:17639512 Rab3b Rat quercetin increases expression ISO RGD:736582 6480464 Quercetin results in increased expression of RAB3B mRNA CTD PMID:21632981 Rab3b Rat rac-lactic acid decreases expression ISO RGD:736582 6480464 Lactic Acid results in decreased expression of RAB3B mRNA CTD PMID:30851411 Rab3b Rat SB 431542 multiple interactions ISO RGD:736582 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Rab3b Rat Se-methyl-L-selenocysteine increases expression ISO RGD:736582 6480464 selenomethylselenocysteine results in increased expression of RAB3B mRNA CTD PMID:18514395 Rab3b Rat Se-methylselenocysteine increases expression ISO RGD:736582 6480464 selenomethylselenocysteine results in increased expression of RAB3B mRNA CTD PMID:18514395 Rab3b Rat silicon dioxide increases expression ISO RGD:736582 6480464 Silicon Dioxide analog results in increased expression of RAB3B mRNA; Silicon Dioxide results in increased more ... CTD PMID:25351596|PMID:25895662 Rab3b Rat sodium arsenite increases expression ISO RGD:736582 6480464 sodium arsenite results in increased expression of RAB3B mRNA CTD PMID:38568856 Rab3b Rat sodium fluoride increases expression ISO RGD:736583 6480464 Sodium Fluoride results in increased expression of RAB3B protein CTD PMID:27548804 Rab3b Rat streptozocin multiple interactions ISO RGD:736583 6480464 [Streptozocin co-treated with Diethylhexyl Phthalate] results in decreased expression of RAB3B mRNA CTD PMID:31606821 Rab3b Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of RAB3B mRNA CTD PMID:30047161 Rab3b Rat temozolomide decreases expression ISO RGD:736582 6480464 Temozolomide results in decreased expression of RAB3B mRNA CTD PMID:31758290 Rab3b Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of RAB3B mRNA CTD PMID:16239168 Rab3b Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of RAB3B protein CTD PMID:35544339 Rab3b Rat thimerosal affects expression ISO RGD:736582 6480464 Thimerosal affects the expression of RAB3B mRNA CTD PMID:27188386 Rab3b Rat titanium dioxide decreases methylation ISO RGD:736583 6480464 titanium dioxide results in decreased methylation of RAB3B gene CTD PMID:35295148 Rab3b Rat torcetrapib increases expression ISO RGD:736582 6480464 torcetrapib results in increased expression of RAB3B mRNA CTD PMID:23228038 Rab3b Rat triadimefon decreases expression ISO RGD:736582 6480464 triadimefon results in decreased expression of RAB3B mRNA CTD PMID:26705709 Rab3b Rat tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of RAB3B mRNA CTD PMID:21683754 Rab3b Rat trichostatin A multiple interactions EXP 6480464 trichostatin A inhibits the reaction [Cisplatin results in decreased expression of RAB3B mRNA] CTD PMID:23558232 Rab3b Rat trichostatin A multiple interactions ISO RGD:736582 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Rab3b Rat trichostatin A decreases expression ISO RGD:736582 6480464 trichostatin A results in decreased expression of RAB3B mRNA CTD PMID:26272509 Rab3b Rat trichostatin A increases expression ISO RGD:736582 6480464 trichostatin A results in increased expression of RAB3B mRNA CTD PMID:26705709 Rab3b Rat urethane increases expression ISO RGD:736582 6480464 Urethane results in increased expression of RAB3B mRNA CTD PMID:28818685 Rab3b Rat valproic acid affects expression ISO RGD:736583 6480464 Valproic Acid affects the expression of RAB3B mRNA CTD PMID:17963808 Rab3b Rat valproic acid increases expression ISO RGD:736582 6480464 Valproic Acid results in increased expression of RAB3B mRNA CTD PMID:19101580|PMID:23179753|PMID:26705709|PMID:27188386 Rab3b Rat valproic acid affects expression ISO RGD:736582 6480464 Valproic Acid affects the expression of RAB3B mRNA CTD PMID:25979313 Rab3b Rat valproic acid increases expression ISO RGD:736583 6480464 Valproic Acid results in increased expression of RAB3B mRNA CTD PMID:21427059 Rab3b Rat vorinostat decreases expression ISO RGD:736582 6480464 vorinostat results in decreased expression of RAB3B mRNA CTD PMID:27188386 Rab3b Rat zidovudine multiple interactions ISO RGD:736582 6480464 [Zidovudine co-treated with IFNA1 protein] results in decreased expression of RAB3B mRNA CTD PMID:20370541
1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-bromohexadecanoic acid (ISO) 2-hydroxypropanoic acid (ISO) 3',5'-cyclic AMP (EXP) 3,3',5-triiodo-L-thyronine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (ISO) butanal (ISO) Butylbenzyl phthalate (EXP) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cisplatin (EXP,ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) decabromodiphenyl ether (EXP) dexamethasone (ISO) dibutyl phthalate (EXP) dichlorine (EXP) diethyl phthalate (EXP) diethylstilbestrol (ISO) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) ethanol (ISO) fenamidone (ISO) flavonoids (EXP) folic acid (ISO) geldanamycin (ISO) gentamycin (EXP) GSK-J4 (ISO) hydroquinone (ISO) indometacin (ISO) ivermectin (ISO) ketoconazole (ISO) L-ascorbic acid (EXP,ISO) lead(0) (ISO) methimazole (EXP) methylmercury chloride (ISO) nickel atom (ISO) okadaic acid (ISO) ozone (EXP) paracetamol (EXP) paraquat (EXP) pentanal (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) phenylephrine (EXP) pirinixic acid (ISO) progesterone (ISO) propanal (ISO) quercetin (ISO) rac-lactic acid (ISO) SB 431542 (ISO) Se-methyl-L-selenocysteine (ISO) Se-methylselenocysteine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium fluoride (ISO) streptozocin (ISO) sulfadimethoxine (EXP) temozolomide (ISO) tetrachloromethane (EXP) thapsigargin (EXP) thimerosal (ISO) titanium dioxide (ISO) torcetrapib (ISO) triadimefon (ISO) tributylstannane (EXP) trichostatin A (EXP,ISO) urethane (ISO) valproic acid (ISO) vorinostat (ISO) zidovudine (ISO)
Cellular Component
cytoplasm (IEA,ISO) dopaminergic synapse (IEA,ISO) endomembrane system (IEA) endosome (IBA) Golgi apparatus (IEA) membrane (IEA) perinuclear region of cytoplasm (IEA,ISO) plasma membrane (IBA,IEA) secretory granule (IEA,ISO) secretory vesicle (IEA) synaptic vesicle (IBA,IEA,ISO) synaptic vesicle membrane (EXP,IDA,IEA,IEP,ISO) vesicle (IEA,ISO)
1.
Insulin and okadaic acid induce Rab4 redistribution in adipocytes.
Cormont M, etal., J Biol Chem. 1993 Sep 15;268(26):19491-7.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Differential expression of Rab3 isoforms during differentiation of pancreatic acinar cell line AR42J.
Klengel R, etal., Biochem Biophys Res Commun 1997 Jul 30;236(3):719-22.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
Quantitative analysis of synaptic vesicle Rabs uncovers distinct yet overlapping roles for Rab3a and Rab27b in Ca2+-triggered exocytosis.
Pavlos NJ, etal., J Neurosci. 2010 Oct 6;30(40):13441-53. doi: 10.1523/JNEUROSCI.0907-10.2010.
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Molecular anatomy of a trafficking organelle.
Takamori S, etal., Cell. 2006 Nov 17;127(4):831-46.
Rab3b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 128,859,034 - 128,926,087 (+) NCBI GRCr8 mRatBN7.2 5 123,629,562 - 123,697,410 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 123,644,423 - 123,697,401 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 126,253,240 - 126,320,296 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 127,976,344 - 128,043,394 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 128,027,632 - 128,094,680 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 128,501,789 - 128,568,170 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 128,501,847 - 128,568,188 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 132,343,152 - 132,408,838 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 130,185,155 - 130,284,038 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 130,229,349 - 130,288,894 (+) NCBI Celera 5 122,364,678 - 122,431,394 (+) NCBI Celera Cytogenetic Map 5 q34 NCBI
RAB3B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 51,907,956 - 51,990,700 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 51,907,956 - 51,990,700 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 52,373,628 - 52,456,372 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 52,157,420 - 52,228,936 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 52,096,857 - 52,168,369 NCBI Celera 1 50,660,966 - 50,743,913 (-) NCBI Celera Cytogenetic Map 1 p32.3 NCBI HuRef 1 50,490,781 - 50,573,849 (-) NCBI HuRef CHM1_1 1 52,491,166 - 52,573,953 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 51,789,104 - 51,872,214 (-) NCBI T2T-CHM13v2.0
Rab3b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 108,736,267 - 108,800,521 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 108,736,260 - 108,800,521 (+) Ensembl GRCm39 Ensembl GRCm38 4 108,879,070 - 108,943,324 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 108,879,063 - 108,943,324 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 108,551,675 - 108,615,929 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 108,377,002 - 108,441,256 (+) NCBI MGSCv36 mm8 Celera 4 107,216,795 - 107,279,795 (+) NCBI Celera Cytogenetic Map 4 C7 NCBI cM Map 4 50.67 NCBI
Rab3b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955464 7,117,883 - 7,177,534 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955464 7,117,908 - 7,177,138 (+) NCBI ChiLan1.0 ChiLan1.0
RAB3B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 174,868,518 - 174,951,571 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 174,010,062 - 174,093,098 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 51,170,956 - 51,242,828 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 52,655,120 - 52,737,856 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 52,666,713 - 52,723,975 (-) Ensembl panpan1.1 panPan2
RAB3B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 9,305,495 - 9,378,003 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 9,319,057 - 9,372,518 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 9,452,491 - 9,534,833 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 9,425,030 - 9,507,475 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 9,386,741 - 9,503,119 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 9,235,627 - 9,317,897 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 9,324,977 - 9,407,250 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 9,342,565 - 9,424,929 (+) NCBI UU_Cfam_GSD_1.0
Rab3b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 66,430,985 - 66,491,578 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936522 8,924,617 - 8,989,734 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936522 8,924,724 - 8,985,309 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RAB3B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 160,194,555 - 160,255,632 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 160,194,488 - 160,255,635 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 147,898,185 - 147,958,774 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RAB3B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 80,963,320 - 81,036,058 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 80,963,398 - 81,035,657 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 36,204,690 - 36,280,528 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rab3b
.
Predicted Target Of
Count of predictions: 278 Count of miRNA genes: 179 Interacting mature miRNAs: 200 Transcripts: ENSRNOT00000010645 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1298070 Scl18 Serum cholesterol level QTL 18 3.7 blood LDL cholesterol amount (VT:0000181) calculated plasma low density lipoprotein cholesterol level (CMO:0001245) 5 79584860 124584860 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 1582230 Bw78 Body weight QTL 78 3.2 0.0016 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 119085612 128034027 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1598859 Cm66 Cardiac mass QTL 66 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 79584860 124584860 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1358909 Kidm25 Kidney mass QTL 25 1.87 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 90067849 128034027 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298086 Bp156 Blood pressure QTL 156 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 84132602 129132602 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 1358889 Bp261 Blood pressure QTL 261 2.86 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 90067849 128034027 Rat 1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 7794739 Bp372 Blood pressure QTL 372 0.0058 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 117913688 125222967 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 1598846 Bp293 Blood pressure QTL 293 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 79584860 124584860 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH128978
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 123,697,183 - 123,697,368 (+) MAPPER mRatBN7.2 Rnor_6.0 5 128,567,944 - 128,568,128 NCBI Rnor6.0 Rnor_5.0 5 132,408,612 - 132,408,796 UniSTS Rnor5.0 RGSC_v3.4 5 130,283,815 - 130,283,999 UniSTS RGSC3.4 Celera 5 122,431,171 - 122,431,355 UniSTS RH 3.4 Map 5 812.5 UniSTS Cytogenetic Map 5 q35 UniSTS
RH136876
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 123,697,117 - 123,697,267 (+) MAPPER mRatBN7.2 Rnor_6.0 5 128,567,878 - 128,568,027 NCBI Rnor6.0 Rnor_5.0 5 132,408,546 - 132,408,695 UniSTS Rnor5.0 RGSC_v3.4 5 130,283,749 - 130,283,898 UniSTS RGSC3.4 Celera 5 122,431,105 - 122,431,254 UniSTS RH 3.4 Map 5 812.7 UniSTS Cytogenetic Map 5 q35 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
61
60
30
24
30
6
187
95
93
45
59
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010645 ⟹ ENSRNOP00000010645
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 123,644,423 - 123,697,401 (+) Ensembl Rnor_6.0 Ensembl 5 128,501,847 - 128,568,188 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000098899 ⟹ ENSRNOP00000078014
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 123,644,423 - 123,688,140 (+) Ensembl
RefSeq Acc Id:
NM_031091 ⟹ NP_112353
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 128,859,091 - 128,926,087 (+) NCBI mRatBN7.2 5 123,630,402 - 123,697,407 (+) NCBI Rnor_6.0 5 128,501,833 - 128,568,167 (+) NCBI Rnor_5.0 5 132,343,152 - 132,408,838 (+) NCBI RGSC_v3.4 5 130,185,155 - 130,284,038 (+) RGD Celera 5 122,364,678 - 122,431,394 (+) RGD
Sequence:
TCAACCCTCCGTAGCCGAGGTGGGAACCAGACCCGCCCCGCCTGCCTCTCGTCCACTACTGCCAGGTGCAACAGTCCGGCTGCAGTGTGCCGCGAGCCAGCTCTTATCCGAGATGGCCTCAGTAACTG
hide sequence
RefSeq Acc Id:
XM_006238531 ⟹ XP_006238593
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 128,859,034 - 128,926,087 (+) NCBI mRatBN7.2 5 123,630,351 - 123,697,410 (+) NCBI Rnor_6.0 5 128,501,789 - 128,568,170 (+) NCBI Rnor_5.0 5 132,343,152 - 132,408,838 (+) NCBI
Sequence:
GGGCCTGGACCCAGCGGGAACCCAACCCATCTTCTGCCAGAGCCTCAACCCTCCGTAGCCGAGG
hide sequence
RefSeq Acc Id:
XM_063288471 ⟹ XP_063144541
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 128,859,078 - 128,926,087 (+) NCBI
RefSeq Acc Id:
XM_063288472 ⟹ XP_063144542
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 128,859,093 - 128,926,087 (+) NCBI
RefSeq Acc Id:
NP_112353 ⟸ NM_031091
- UniProtKB:
Q63941 (UniProtKB/Swiss-Prot), A6JYX0 (UniProtKB/TrEMBL)
- Sequence:
MASVTDGNTGIRDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNA
hide sequence
RefSeq Acc Id:
XP_006238593 ⟸ XM_006238531
- Peptide Label:
isoform X1
- UniProtKB:
Q6P9W6 (UniProtKB/TrEMBL)
- Sequence:
MASVTDGNTGIRDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNA
hide sequence
Ensembl Acc Id:
ENSRNOP00000010645 ⟸ ENSRNOT00000010645
Ensembl Acc Id:
ENSRNOP00000078014 ⟸ ENSRNOT00000098899
RefSeq Acc Id:
XP_063144541 ⟸ XM_063288471
- Peptide Label:
isoform X1
- UniProtKB:
Q6P9W6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144542 ⟸ XM_063288472
- Peptide Label:
isoform X2
- UniProtKB:
Q63941 (UniProtKB/Swiss-Prot), A6JYX0 (UniProtKB/TrEMBL)
RGD ID: 13693906 Promoter ID: EPDNEW_R4430 Type: initiation region Name: Rab3b_1 Description: RAB3B, member RAS oncogene family SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 128,501,835 - 128,501,895 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Rab3b
RAB3B, member RAS oncogene family
Rab3B protein
Name updated
1299863 APPROVED
2002-08-07
Rab3b
Rab3B protein
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_regulation
mRNA expression is induced by dexamethasone in pancreatic acinar cells
729749
