Symbol:
Kcnmb4
Name:
potassium calcium-activated channel subfamily M regulatory beta subunit 4
RGD ID:
620728
Description:
Enables voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential. Predicted to be involved in detection of calcium ion; neuronal action potential; and potassium ion transport. Predicted to be located in plasma membrane. Predicted to be part of voltage-gated potassium channel complex. Orthologous to human KCNMB4 (potassium calcium-activated channel subfamily M regulatory beta subunit 4); INTERACTS WITH 3,7-dihydropurine-6-thione; 6-propyl-2-thiouracil; all-trans-retinoic acid.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
BK channel subunit beta-4; BKbeta4; calcium activated potassium channel beta 4 subunit; calcium-activated potassium channel subunit beta-4; calcium-activated potassium channel, subfamily M subunit beta-4; charybdotoxin receptor subunit beta-4; k(VCA)beta-4; maxi K channel subunit beta-4; potassium channel subfamily M regulatory beta subunit 4; potassium large conductance calcium-activated channel, subfamily M, beta member 4; slo-beta-4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 53,952,150 - 54,005,101 (-) NCBI GRCr8 mRatBN7.2 7 52,066,145 - 52,119,098 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 52,066,136 - 52,119,278 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 53,972,872 - 54,025,805 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 56,175,966 - 56,228,899 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 55,953,938 - 56,006,881 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 59,461,808 - 59,514,759 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 59,461,799 - 59,514,939 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 59,472,024 - 59,525,352 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 55,751,633 - 55,807,075 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 55,772,362 - 55,827,805 (-) NCBI Celera 7 48,846,351 - 48,898,813 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kcnmb4 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1343155 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of KCNMB4 mRNA CTD PMID:22079256 Kcnmb4 Rat 1,2-dimethylhydrazine increases expression ISO RGD:732910 6480464 1,2-Dimethylhydrazine results in increased expression of KCNMB4 mRNA CTD PMID:22206623 Kcnmb4 Rat 3,7-dihydropurine-6-thione increases expression EXP 6480464 Mercaptopurine results in increased expression of KCNMB4 mRNA CTD PMID:23358152 Kcnmb4 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:732910 6480464 bisphenol S results in increased expression of KCNMB4 mRNA CTD PMID:30951980 Kcnmb4 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:732910 6480464 bisphenol S affects the methylation of KCNMB4 gene CTD PMID:31683443 Kcnmb4 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1343155 6480464 bisphenol S results in decreased methylation of KCNMB4 gene CTD PMID:31601247 Kcnmb4 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:732910 6480464 bisphenol S results in decreased methylation of KCNMB4 exon CTD PMID:33297965 Kcnmb4 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of KCNMB4 mRNA CTD PMID:24780913 Kcnmb4 Rat acetylsalicylic acid decreases expression ISO RGD:1343155 6480464 Aspirin results in decreased expression of KCNMB4 mRNA CTD PMID:11906190 Kcnmb4 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of KCNMB4 mRNA CTD PMID:20488242 Kcnmb4 Rat all-trans-retinoic acid multiple interactions ISO RGD:732910 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of KCNMB4 mRNA CTD PMID:36189433 Kcnmb4 Rat all-trans-retinoic acid increases expression ISO RGD:1343155 6480464 Tretinoin results in increased expression of KCNMB4 mRNA CTD PMID:23724009 Kcnmb4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KCNMB4 mRNA CTD PMID:16483693 Kcnmb4 Rat Ampullosporin multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in decreased expression of KCNMB4 mRNA CTD PMID:16635253 Kcnmb4 Rat arsane multiple interactions ISO RGD:1343155 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KCNMB4 more ... CTD PMID:32525701 Kcnmb4 Rat arsenic atom multiple interactions ISO RGD:1343155 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KCNMB4 more ... CTD PMID:32525701 Kcnmb4 Rat benzo[a]pyrene increases expression ISO RGD:1343155 6480464 Benzo(a)pyrene results in increased expression of KCNMB4 mRNA CTD PMID:20106945|PMID:21632981|PMID:22316170 Kcnmb4 Rat benzo[a]pyrene decreases methylation ISO RGD:1343155 6480464 Benzo(a)pyrene results in decreased methylation of KCNMB4 exon; Benzo(a)pyrene results in decreased methylation of KCNMB4 more ... CTD PMID:27901495 Kcnmb4 Rat benzo[a]pyrene increases methylation ISO RGD:1343155 6480464 Benzo(a)pyrene results in increased methylation of KCNMB4 3' UTR CTD PMID:27901495 Kcnmb4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KCNMB4 mRNA CTD PMID:25181051 Kcnmb4 Rat bisphenol A multiple interactions ISO RGD:1343155 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of KCNMB4 gene CTD PMID:31601247 Kcnmb4 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of KCNMB4 gene CTD PMID:28505145 Kcnmb4 Rat bisphenol A increases methylation ISO RGD:732910 6480464 bisphenol A results in increased methylation of KCNMB4 promoter CTD PMID:27312807 Kcnmb4 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of KCNMB4 gene CTD PMID:28505145 Kcnmb4 Rat bisphenol F increases expression ISO RGD:732910 6480464 bisphenol F results in increased expression of KCNMB4 mRNA CTD PMID:30951980 Kcnmb4 Rat butanal increases expression ISO RGD:1343155 6480464 butyraldehyde results in increased expression of KCNMB4 mRNA CTD PMID:26079696 Kcnmb4 Rat calcitriol increases expression ISO RGD:1343155 6480464 Calcitriol results in increased expression of KCNMB4 mRNA CTD PMID:21592394 Kcnmb4 Rat calcitriol multiple interactions ISO RGD:1343155 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of KCNMB4 mRNA CTD PMID:21592394 Kcnmb4 Rat calcium silicate decreases expression ISO RGD:732910 6480464 calcium silicate results in decreased expression of KCNMB4 mRNA CTD PMID:29279043 Kcnmb4 Rat carbon nanotube decreases expression ISO RGD:732910 6480464 Nanotubes, Carbon analog results in decreased expression of KCNMB4 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Kcnmb4 Rat CGP 52608 multiple interactions ISO RGD:1343155 6480464 CGP 52608 promotes the reaction [RORA protein binds to KCNMB4 gene] CTD PMID:28238834 Kcnmb4 Rat chromium(6+) affects expression ISO RGD:1343155 6480464 chromium hexavalent ion affects the expression of KCNMB4 mRNA CTD PMID:30690063 Kcnmb4 Rat cisplatin multiple interactions ISO RGD:1343155 6480464 [Cisplatin co-treated with panobinostat] affects the expression of KCNMB4 mRNA CTD PMID:21791302 Kcnmb4 Rat clobetasol increases expression ISO RGD:732910 6480464 Clobetasol results in increased expression of KCNMB4 mRNA CTD PMID:27462272 Kcnmb4 Rat copper atom multiple interactions ISO RGD:1343155 6480464 [NSC 689534 binds to Copper] which results in decreased expression of KCNMB4 mRNA CTD PMID:20971185 Kcnmb4 Rat copper(0) multiple interactions ISO RGD:1343155 6480464 [NSC 689534 binds to Copper] which results in decreased expression of KCNMB4 mRNA CTD PMID:20971185 Kcnmb4 Rat copper(II) sulfate increases expression ISO RGD:1343155 6480464 Copper Sulfate results in increased expression of KCNMB4 mRNA CTD PMID:19549813 Kcnmb4 Rat cyclosporin A decreases expression ISO RGD:1343155 6480464 Cyclosporine results in decreased expression of KCNMB4 mRNA CTD PMID:20106945 Kcnmb4 Rat cylindrospermopsin decreases expression ISO RGD:1343155 6480464 cylindrospermopsin results in decreased expression of KCNMB4 mRNA CTD PMID:24921660 Kcnmb4 Rat deoxynivalenol decreases expression ISO RGD:1343155 6480464 deoxynivalenol results in decreased expression of KCNMB4 mRNA CTD PMID:26763390 Kcnmb4 Rat dibutyl phthalate decreases expression ISO RGD:732910 6480464 Dibutyl Phthalate results in decreased expression of KCNMB4 mRNA CTD PMID:17361019|PMID:21266533 Kcnmb4 Rat diethyl malate affects expression ISO RGD:732910 6480464 diethyl malate affects the expression of KCNMB4 mRNA CTD PMID:24814887 Kcnmb4 Rat dioxygen multiple interactions ISO RGD:732910 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of KCNMB4 mRNA CTD PMID:30529165 Kcnmb4 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of KCNMB4 mRNA CTD PMID:21551480 Kcnmb4 Rat dorsomorphin multiple interactions ISO RGD:1343155 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Kcnmb4 Rat doxorubicin decreases expression ISO RGD:1343155 6480464 Doxorubicin results in decreased expression of KCNMB4 mRNA CTD PMID:29803840 Kcnmb4 Rat ethanol affects expression ISO RGD:732910 6480464 Ethanol affects the expression of KCNMB4 mRNA CTD PMID:30319688 Kcnmb4 Rat fulvestrant multiple interactions ISO RGD:1343155 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of KCNMB4 gene CTD PMID:31601247 Kcnmb4 Rat furan increases expression EXP 6480464 furan results in increased expression of KCNMB4 mRNA CTD PMID:27387713 Kcnmb4 Rat genistein multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of KCNMB4 gene CTD PMID:28505145 Kcnmb4 Rat genistein increases expression ISO RGD:732910 6480464 Genistein results in increased expression of KCNMB4 mRNA CTD PMID:32186404 Kcnmb4 Rat glyphosate decreases expression ISO RGD:732910 6480464 Glyphosate results in decreased expression of KCNMB4 mRNA CTD PMID:35897073 Kcnmb4 Rat hydrogen peroxide multiple interactions ISO RGD:1343155 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of KCNMB4 protein CTD PMID:18951874 Kcnmb4 Rat ketamine multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in decreased expression of KCNMB4 mRNA CTD PMID:16635253 Kcnmb4 Rat maneb multiple interactions ISO RGD:732910 6480464 [Maneb co-treated with Paraquat] results in decreased expression of KCNMB4 mRNA CTD PMID:36117858 Kcnmb4 Rat mercaptopurine increases expression EXP 6480464 Mercaptopurine results in increased expression of KCNMB4 mRNA CTD PMID:23358152 Kcnmb4 Rat methylisothiazolinone increases expression ISO RGD:1343155 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of KCNMB4 mRNA CTD PMID:31629900 Kcnmb4 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:732910 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of KCNMB4 mRNA CTD PMID:36189433 Kcnmb4 Rat nickel atom decreases expression ISO RGD:1343155 6480464 Nickel results in decreased expression of KCNMB4 mRNA CTD PMID:25583101 Kcnmb4 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of KCNMB4 mRNA CTD PMID:28623178 Kcnmb4 Rat ozone multiple interactions ISO RGD:732910 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of KCNMB4 more ... CTD PMID:34911549 Kcnmb4 Rat panobinostat multiple interactions ISO RGD:1343155 6480464 [Cisplatin co-treated with panobinostat] affects the expression of KCNMB4 mRNA CTD PMID:21791302 Kcnmb4 Rat paracetamol decreases expression ISO RGD:1343155 6480464 Acetaminophen results in decreased expression of KCNMB4 mRNA CTD PMID:29067470 Kcnmb4 Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of KCNMB4 mRNA CTD PMID:16854511 Kcnmb4 Rat paraquat multiple interactions ISO RGD:732910 6480464 [Maneb co-treated with Paraquat] results in decreased expression of KCNMB4 mRNA CTD PMID:36117858 Kcnmb4 Rat pentanal increases expression ISO RGD:1343155 6480464 pentanal results in increased expression of KCNMB4 mRNA CTD PMID:26079696 Kcnmb4 Rat phenylmercury acetate increases expression ISO RGD:1343155 6480464 Phenylmercuric Acetate results in increased expression of KCNMB4 mRNA CTD PMID:26272509 Kcnmb4 Rat phenylmercury acetate multiple interactions ISO RGD:1343155 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Kcnmb4 Rat potassium chromate decreases expression ISO RGD:1343155 6480464 potassium chromate(VI) results in decreased expression of KCNMB4 mRNA CTD PMID:22079256 Kcnmb4 Rat potassium chromate increases expression ISO RGD:1343155 6480464 potassium chromate(VI) results in increased expression of KCNMB4 mRNA CTD PMID:22714537 Kcnmb4 Rat potassium chromate multiple interactions ISO RGD:1343155 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of KCNMB4 mRNA CTD PMID:22079256 Kcnmb4 Rat propanal increases expression ISO RGD:1343155 6480464 propionaldehyde results in increased expression of KCNMB4 mRNA CTD PMID:26079696 Kcnmb4 Rat purine-6-thiol increases expression EXP 6480464 Mercaptopurine results in increased expression of KCNMB4 mRNA CTD PMID:23358152 Kcnmb4 Rat S-nitrosoglutathione increases expression ISO RGD:1343155 6480464 S-Nitrosoglutathione results in increased expression of KCNMB4 mRNA CTD PMID:38825487 Kcnmb4 Rat SB 431542 multiple interactions ISO RGD:1343155 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Kcnmb4 Rat silicon dioxide decreases expression ISO RGD:1343155 6480464 Silicon Dioxide analog results in decreased expression of KCNMB4 mRNA CTD PMID:25895662 Kcnmb4 Rat sodium arsenate multiple interactions ISO RGD:1343155 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KCNMB4 more ... CTD PMID:32525701 Kcnmb4 Rat sodium arsenite increases expression ISO RGD:1343155 6480464 sodium arsenite results in increased expression of KCNMB4 mRNA CTD PMID:22714537 Kcnmb4 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of KCNMB4 mRNA CTD PMID:19281266 Kcnmb4 Rat sunitinib decreases expression ISO RGD:1343155 6480464 Sunitinib results in decreased expression of KCNMB4 mRNA CTD PMID:31533062 Kcnmb4 Rat temozolomide increases expression ISO RGD:1343155 6480464 Temozolomide results in increased expression of KCNMB4 mRNA CTD PMID:31758290 Kcnmb4 Rat testosterone multiple interactions ISO RGD:1343155 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of KCNMB4 mRNA CTD PMID:21592394 Kcnmb4 Rat testosterone increases expression ISO RGD:1343155 6480464 Testosterone results in increased expression of KCNMB4 mRNA CTD PMID:21592394 Kcnmb4 Rat theophylline multiple interactions ISO RGD:1343155 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of KCNMB4 protein CTD PMID:18951874 Kcnmb4 Rat titanium dioxide decreases expression ISO RGD:732910 6480464 titanium dioxide results in decreased expression of KCNMB4 mRNA CTD PMID:29264374 Kcnmb4 Rat titanium dioxide increases methylation ISO RGD:732910 6480464 titanium dioxide results in increased methylation of KCNMB4 promoter CTD PMID:35295148 Kcnmb4 Rat titanium dioxide decreases methylation ISO RGD:732910 6480464 titanium dioxide results in decreased methylation of KCNMB4 promoter CTD PMID:35295148 Kcnmb4 Rat triphenyl phosphate affects expression ISO RGD:1343155 6480464 triphenyl phosphate affects the expression of KCNMB4 mRNA CTD PMID:37042841 Kcnmb4 Rat urethane increases expression ISO RGD:1343155 6480464 Urethane results in increased expression of KCNMB4 mRNA CTD PMID:28818685 Kcnmb4 Rat valproic acid affects expression ISO RGD:1343155 6480464 Valproic Acid affects the expression of KCNMB4 mRNA CTD PMID:25979313 Kcnmb4 Rat valproic acid multiple interactions ISO RGD:1343155 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Kcnmb4 Rat valproic acid increases expression ISO RGD:1343155 6480464 Valproic Acid results in increased expression of KCNMB4 mRNA CTD PMID:19101580|PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509|PMID:27188386|PMID:28001369|PMID:29154799
Kcnmb4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 53,952,150 - 54,005,101 (-) NCBI GRCr8 mRatBN7.2 7 52,066,145 - 52,119,098 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 52,066,136 - 52,119,278 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 53,972,872 - 54,025,805 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 56,175,966 - 56,228,899 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 55,953,938 - 56,006,881 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 59,461,808 - 59,514,759 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 59,461,799 - 59,514,939 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 59,472,024 - 59,525,352 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 55,751,633 - 55,807,075 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 55,772,362 - 55,827,805 (-) NCBI Celera 7 48,846,351 - 48,898,813 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
KCNMB4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 70,366,290 - 70,434,292 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 70,366,290 - 70,434,292 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 70,760,070 - 70,828,072 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 69,046,329 - 69,111,245 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 69,046,328 - 69,111,245 NCBI Celera 12 70,423,736 - 70,488,648 (+) NCBI Celera Cytogenetic Map 12 q15 NCBI HuRef 12 67,810,221 - 67,878,259 (+) NCBI HuRef CHM1_1 12 70,729,372 - 70,797,379 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 70,345,760 - 70,413,761 (+) NCBI T2T-CHM13v2.0
Kcnmb4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 116,251,951 - 116,309,787 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 116,253,766 - 116,309,783 (-) Ensembl GRCm39 Ensembl GRCm38 10 116,417,861 - 116,473,859 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 116,417,861 - 116,473,878 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 115,854,924 - 115,910,579 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 115,821,978 - 115,877,633 (-) NCBI MGSCv36 mm8 Celera 10 118,359,444 - 118,414,989 (-) NCBI Celera Cytogenetic Map 10 D2 NCBI cM Map 10 64.73 NCBI
Kcnmb4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 10,559,074 - 10,615,744 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 10,559,074 - 10,615,744 (+) NCBI ChiLan1.0 ChiLan1.0
KCNMB4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 78,382,018 - 78,446,671 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 78,378,419 - 78,443,070 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 67,876,582 - 67,944,318 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 70,644,953 - 70,712,211 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 70,644,953 - 70,712,211 (+) Ensembl panpan1.1 panPan2
KCNMB4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 12,211,372 - 12,251,739 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 12,125,048 - 12,184,484 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 12,318,249 - 12,377,811 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 12,316,131 - 12,378,178 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 12,184,530 - 12,244,076 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 12,431,579 - 12,491,106 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 12,555,316 - 12,614,834 (+) NCBI UU_Cfam_GSD_1.0
Kcnmb4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 45,994,814 - 46,057,717 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936545 8,052,401 - 8,115,311 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936545 8,052,407 - 8,115,310 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KCNMB4
KCNMB4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 65,944,489 - 66,008,479 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 65,944,522 - 66,007,201 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 179,675,658 - 179,740,938 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kcnmb4
.
Predicted Target Of
Count of predictions: 76 Count of miRNA genes: 67 Interacting mature miRNAs: 74 Transcripts: ENSRNOT00000030847 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 10059605 Kidm47 Kidney mass QTL 47 2.91 0.05 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 47251783 65728867 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2303629 Vencon3 Ventilatory control QTL 3 7.25 respiration trait (VT:0001943) respiration rate (CMO:0000289) 7 41109692 56793354 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1300138 Hrtrt9 Heart rate QTL 9 4.72 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 29409683 53612950 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
RH144266
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 54,000,076 - 54,000,198 (+) Marker Load Pipeline mRatBN7.2 7 52,114,073 - 52,114,195 (+) MAPPER mRatBN7.2 Rnor_6.0 7 59,509,735 - 59,509,856 NCBI Rnor6.0 Rnor_5.0 7 59,519,919 - 59,520,040 UniSTS Rnor5.0 RGSC_v3.4 7 55,801,642 - 55,801,763 UniSTS RGSC3.4 Celera 7 48,893,962 - 48,894,083 UniSTS RH 3.4 Map 7 478.31 UniSTS Cytogenetic Map 7 q22 UniSTS
AU048198
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 52,076,892 - 52,077,044 (+) MAPPER mRatBN7.2 Rnor_6.0 7 59,472,554 - 59,472,705 NCBI Rnor6.0 Rnor_5.0 7 59,482,770 - 59,482,921 UniSTS Rnor5.0 RGSC_v3.4 7 55,762,379 - 55,762,530 UniSTS RGSC3.4 Celera 7 48,857,025 - 48,857,176 UniSTS Cytogenetic Map 7 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
49
113
82
81
50
25
50
6
208
96
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000085579 ⟹ ENSRNOP00000075448
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 52,066,136 - 52,119,278 (-) Ensembl Rnor_6.0 Ensembl 7 59,461,799 - 59,514,939 (-) Ensembl
RefSeq Acc Id:
NM_023960 ⟹ NP_076450
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 53,952,150 - 54,005,101 (-) NCBI mRatBN7.2 7 52,066,145 - 52,119,098 (-) NCBI Rnor_6.0 7 59,461,808 - 59,514,759 (-) NCBI Rnor_5.0 7 59,472,024 - 59,525,352 (-) NCBI RGSC_v3.4 7 55,751,633 - 55,807,075 (-) RGD Celera 7 48,846,351 - 48,898,813 (-) RGD
Sequence:
CGAGGAGAGTGGGGGGCGATGGCGAAGCTCAGGGTGTCTTACGAGTACACGGAAGCCGAAGACAAGAGCATCCGGCTCGGCTTGTTCCTCATCGTCTCTGGCATCCTGTCGCTCTTCATCTTCGGCTT
hide sequence
RefSeq Acc Id:
NP_076450 ⟸ NM_023960
- UniProtKB:
Q9ESK8 (UniProtKB/Swiss-Prot), B1WBP1 (UniProtKB/TrEMBL)
- Sequence:
MAKLRVSYEYTEAEDKSIRLGLFLIVSGILSLFIFGFCWLSPALQDLQATAANCTVLSVQQIGEVFECTFTCGTDCRGTSQYPCVQVYVNNSESNSRALLHSDQHQLLTNPKCSYIPPCKRENQKNSE
hide sequence
Ensembl Acc Id:
ENSRNOP00000075448 ⟸ ENSRNOT00000085579
RGD ID: 13695205 Promoter ID: EPDNEW_R5729 Type: single initiation site Name: Kcnmb4_1 Description: potassium calcium-activated channel subfamily M regulatory betasubunit 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 59,514,932 - 59,514,992 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Kcnmb4
potassium calcium-activated channel subfamily M regulatory beta subunit 4
Kcnmb4
potassium channel subfamily M regulatory beta subunit 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-01-26
Kcnmb4
potassium channel subfamily M regulatory beta subunit 4
Kcnmb4
potassium large conductance calcium-activated channel, subfamily M, beta member 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Kcnmb4
potassium large conductance calcium-activated channel, subfamily M, beta member 4
calcium activated potassium channel beta 4 subunit
Name updated
1299863 APPROVED
2002-08-07
Kcnmb4
calcium activated potassium channel beta 4 subunit
Symbol and Name status set to provisional
70820 PROVISIONAL
