Mb (myoglobin) - Rat Genome Database

Name: Mb
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Mb (myoglobin) Rattus norvegicus

Analyze

Symbol:

Name:

myoglobin

RGD ID:

620411

Description:

Enables oxygen binding activity. Involved in several processes, including oxygen transport; response to hydrogen peroxide; and slow-twitch skeletal muscle fiber contraction. Used to study acute kidney failure. Orthologous to human MB (myoglobin); INTERACTS WITH (R,R,R)-alpha-tocopherol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Glng; globin g

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MB (myoglobin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mb (myoglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mb (myoglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MB (myoglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MB (myoglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mb (myoglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MB (myoglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MB (myoglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mb (myoglobin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LIN37 (lin-37 DREAM MuvB core complex component)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MB (myoglobin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mb (myoglobin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mb (myoglobin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	glb-14	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder)
Caenorhabditis elegans (roundworm):	glb-34	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	glob1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder)

Allele / Splice:

Mb^em6Mcwi

Genetic Models:

WKY-Mb^em6Mcwi

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	108,759,903 - 108,767,134 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	108,759,904 - 108,767,383 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	110,502,181 - 110,509,413 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	7	112,725,771 - 112,733,003 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	7	112,687,217 - 112,694,445 (-)	NCBI	Rnor_WKY
Rnor_6.0	7	118,101,633 - 118,108,864 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	118,101,634 - 118,108,864 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	118,094,391 - 118,101,622 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	115,087,558 - 115,094,789 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	115,121,788 - 115,129,019 (-)	NCBI
Celera	7	105,108,137 - 105,115,366 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute kidney failure (IDA,ISO)

adenylosuccinase lyase deficiency (ISO)

Coronary Disease (ISO)

COVID-19 (ISO)

Crush Syndrome (IDA)

genetic disease (ISO)

Hypoxia (IDA)

Myocardial Ischemia (IDA,ISO)

Myocardial Reperfusion Injury (IDA,ISO)

Reperfusion Injury (ISO)

Sarcoplasmic Body Myopathy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R,R,R)-alpha-tocopherol (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

acetamiprid (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

atorvastatin calcium (EXP,ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

Benzo[k]fluoranthene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bromobenzene (EXP)

C60 fullerene (EXP)

carbon nanotube (ISO)

carvacrol (EXP)

cerium trichloride (ISO)

cerivastatin (EXP)

CGP 52608 (ISO)

ciprofloxacin (ISO)

clofibrate (ISO)

cobalt dichloride (EXP)

copper atom (ISO)

copper(0) (ISO)

corticosterone (EXP)

cumene hydroperoxide (ISO)

cypermethrin (ISO)

dexamethasone (ISO)

dioxygen (ISO)

dobutamine (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

Echimidine (EXP)

entinostat (ISO)

ethanol (EXP)

gallic acid (ISO)

genistein (EXP,ISO)

glycerol (EXP)

glyphosate (EXP)

graphite (ISO)

Heliotrine (EXP)

hydrogen peroxide (ISO)

imidacloprid (EXP)

Indeno[1,2,3-cd]pyrene (ISO)

isoprenaline (EXP)

ivermectin (ISO)

lead diacetate (ISO)

lipopolysaccharide (ISO)

lutein (ISO)

methapyrilene (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

nickel atom (ISO)

O-methyleugenol (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorononanoic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pioglitazone (ISO)

pluronic P-123 (EXP)

Poloxamer (EXP)

potassium dichromate (ISO)

rosuvastatin calcium (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

SB 431542 (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

simvastatin (EXP)

sinapic acid (EXP)

sodium arsenite (ISO)

sodium nitrate (ISO)

succinylcholine (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tetrachloromethane (EXP)

titanium dioxide (ISO)

triamcinolone (EXP)

triclosan (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

very-low-density lipoprotein triglyceride (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

brown fat cell differentiation (ISO)

enucleate erythrocyte differentiation (ISO)

heart development (ISO)

oxygen transport (IBA,IDA,IEA)

response to hormone (IDA)

response to hydrogen peroxide (IDA)

response to hypoxia (ISO)

slow-twitch skeletal muscle fiber contraction (IEP)

Molecular Function

heme binding (IEA,NAS)

metal ion binding (IEA)

oxygen binding (IBA,IDA,IEA)

oxygen carrier activity (IEA)

protein binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	Ischemia-modified albumin improves the usefulness of standard cardiac biomarkers for the diagnosis of myocardial ischemia in the emergency department setting.	Anwaruddin S, etal., Am J Clin Pathol. 2005 Jan;123(1):140-5.
2.	Immunological identification of the heart myoglobin radical formed by hydrogen peroxide.	Detweiler CD, etal., Free Radic Biol Med. 2002 Aug 1;33(3):364-9.
3.	An observational study on rhabdomyolysis in the intensive care unit. Exploring its risk factors and main complication: acute kidney injury.	El-Abdellati E, etal., Ann Intensive Care. 2013 Mar 14;3(1):8. doi: 10.1186/2110-5820-3-8.
4.	Contribution of myoglobin-induced increases in vascular resistance to shock decompensation in experimental Crush-syndrome in anesthetized rats.	Emig U, etal., Shock. 2003 Jan;19(1):79-84.
5.	Role of myoglobin in the antioxidant defense of the heart.	Flogel U, etal., FASEB J. 2004 Jul;18(10):1156-8. Epub 2004 May 7.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Renal uptake of myoglobin is mediated by the endocytic receptors megalin and cubilin.	Gburek J, etal., Am J Physiol Renal Physiol 2003 Sep;285(3):F451-8. Epub 2003 Apr 29.
8.	Thyroid hormone stimulates myoglobin gene expression in rat cardiac muscle.	Giannocco G, etal., Mol Cell Endocrinol. 2004 Oct 29;226(1-2):19-26.
9.	Role of myoglobin as a scavenger of cellular NO in myocardium.	Kreutzer U and Jue T, Am J Physiol Heart Circ Physiol 2004 Mar;286(3):H985-91.
10.	Myoglobin Translational Diffusion in Myocardium and Its Implication on Intracellular Oxygen Transport.	Lin PC, etal., J Physiol. 2006 Oct 12;.
11.	The role of myoglobin in retarding oxygen depletion in anoxic heart.	Marzouki L, etal., Arch Physiol Biochem. 2002 Dec;110(5):400-7.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	A causative role for redox cycling of myoglobin and its inhibition by alkalinization in the pathogenesis and treatment of rhabdomyolysis-induced renal failure.	Moore KP, etal., J Biol Chem. 1998 Nov 27;273(48):31731-7.
14.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.	Myoglobin gene expression attenuates hepatic ischemia reperfusion injury.	Nitta T, etal., J Surg Res. 2003 Apr;110(2):322-31.
16.	Proteomic analysis of slow- and fast-twitch skeletal muscles.	Okumura N, etal., Proteomics. 2005 Jul;5(11):2896-906.
17.	GOA pipeline	RGD automated data pipeline
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	Clinical predictors of mortality due to COVID-19 based on an analysis of data of 150 patients from Wuhan, China.	Ruan Q, etal., Intensive Care Med. 2020 May;46(5):846-848. doi: 10.1007/s00134-020-05991-x. Epub 2020 Mar 3.
20.	Virtual cooperativity in myoglobin oxygen saturation curve in skeletal muscle in vivo.	Seiyama A Dyn Med. 2006 Jan 24;5:3.
21.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
22.	Evaluation of coronary artery patency using cardiac markers.	Tanasijevic MJ J Thromb Thrombolysis. 2005 Feb;19(1):21-4.
23.	The contrast of immunohistochemical studies of myocardial fibrinogen and myoglobin in early myocardial ischemia in rats.	Xiaohong Z, etal., Leg Med (Tokyo). 2002 Mar;4(1):47-51.
24.	The clinical characteristics and outcomes of patients with diabetes and secondary hyperglycaemia with coronavirus disease 2019: A single-centre, retrospective, observational study in Wuhan.	Zhang Y, etal., Diabetes Obes Metab. 2020 May 14. doi: 10.1111/dom.14086.
25.	[Effects of myocardial ischemia reperfusion injury on L-arginine/nitric oxide system in rat heart]	Zheng HZ, etal., Sheng Li Xue Bao. 1999 Feb;51(1):25-30.

Additional References at PubMed

PMID:11304494	PMID:14656764	PMID:15048578	PMID:15489334	PMID:17218454	PMID:17293481	PMID:18492766	PMID:19308875	PMID:19545623	PMID:23533145	PMID:23608161	PMID:24256333
PMID:26945066	PMID:27329933	PMID:29476059	PMID:30658240

Genomics

Comparative Map Data

Mb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	108,759,903 - 108,767,134 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	108,759,904 - 108,767,383 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	110,502,181 - 110,509,413 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	7	112,725,771 - 112,733,003 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	7	112,687,217 - 112,694,445 (-)	NCBI	Rnor_WKY
Rnor_6.0	7	118,101,633 - 118,108,864 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	118,101,634 - 118,108,864 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	118,094,391 - 118,101,622 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	115,087,558 - 115,094,789 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	115,121,788 - 115,129,019 (-)	NCBI
Celera	7	105,108,137 - 105,115,366 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

MB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	35,606,764 - 35,623,354 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	22	35,606,764 - 35,637,951 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	36,002,811 - 36,019,401 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	34,332,757 - 34,349,347 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	34,327,310 - 34,338,055	NCBI
Celera	22	19,806,063 - 19,822,655 (-)	NCBI		Celera
Cytogenetic Map	22	q12.3	NCBI
HuRef	22	18,963,313 - 18,979,770 (-)	NCBI		HuRef
CHM1_1	22	35,961,646 - 35,978,237 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	22	36,065,732 - 36,082,323 (-)	NCBI		T2T-CHM13v2.0

Mb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	76,899,687 - 76,934,868 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	76,899,687 - 76,934,870 (-)	Ensembl		GRCm39 Ensembl
GRCm38	15	77,015,487 - 77,050,668 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	77,015,487 - 77,050,670 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	76,845,917 - 76,881,098 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	76,842,742 - 76,877,923 (-)	NCBI		MGSCv36	mm8
Celera	15	78,503,595 - 78,538,817 (-)	NCBI		Celera
Cytogenetic Map	15	D3	NCBI
cM Map	15	36.36	NCBI

Mb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	43,215,007 - 43,222,052 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955405	43,215,404 - 43,221,606 (-)	NCBI	ChiLan1.0	ChiLan1.0

MB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	22	48,243,181 - 48,253,616 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	16,612,519 - 16,645,333 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	34,452,451 - 34,485,581 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	34,452,451 - 34,463,224 (-)	Ensembl	panpan1.1		panPan2

MB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	28,573,819 - 28,583,526 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	28,552,749 - 28,583,522 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	28,513,611 - 28,523,318 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	29,360,185 - 29,369,892 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	29,356,425 - 29,369,888 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	29,085,598 - 29,095,292 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	29,394,667 - 29,404,374 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	29,575,155 - 29,584,857 (+)	NCBI		UU_Cfam_GSD_1.0

Mb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	11,880,637 - 11,887,251 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	4,890,871 - 4,897,665 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936492	4,890,871 - 4,897,665 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MB
(Sus scrofa - pig)

No map positions available.

MB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	18,369,234 - 18,385,922 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	18,369,174 - 18,380,270 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	107,562,452 - 107,578,780 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624750	259,041 - 266,238 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624750	259,559 - 266,124 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mb
17 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	66
Count of miRNA genes:	50
Interacting mature miRNAs:	61
Transcripts:	ENSRNOT00000006184
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	80221299	109401111	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	94811326	116294265	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat

Markers in Region

RH134536

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	108,759,948 - 108,760,150 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	118,101,679 - 118,101,880	NCBI	Rnor6.0
Rnor_5.0	7	118,094,437 - 118,094,638	UniSTS	Rnor5.0
RGSC_v3.4	7	115,087,604 - 115,087,805	UniSTS	RGSC3.4
Celera	7	105,108,183 - 105,108,384	UniSTS
RH 3.4 Map	7	800.0	UniSTS
Cytogenetic Map	7	q34	UniSTS

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	108,761,978 - 108,762,175 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	118,103,709 - 118,103,905	NCBI	Rnor6.0
Rnor_5.0	7	118,096,467 - 118,096,663	UniSTS	Rnor5.0
RGSC_v3.4	7	115,089,634 - 115,089,830	UniSTS	RGSC3.4
Celera	7	105,110,213 - 105,110,409	UniSTS
Cytogenetic Map	7	q34	UniSTS

Genetic Models

This gene Mb is modified in the following models/strains

WKY-Mb^em6Mcwi

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High		29					7	10					7
Medium		14	17	8	6	8	1	1	2		3	9	1
Low	1		9	2	11	2			11	15	20	2
Below cutoff	1		10	10	2	10			4	16	15

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_021588	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF197916	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF278533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC070511	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214668	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214682	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214690	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214793	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215312	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215441	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215511	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215560	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215564	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215685	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215754	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215802	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215857	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215880	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215902	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215998	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216064	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216127	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216153	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216280	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216299	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216306	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216312	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216335	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216443	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216504	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216709	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216731	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216841	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217326	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217355	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217450	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217496	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223624	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223774	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223853	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223938	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224558	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224833	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224856	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224921	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224937	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000186	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LT548174	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000006184 ⟹ ENSRNOP00000006184

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	108,759,904 - 108,767,350 (-)	Ensembl
Rnor_6.0 Ensembl	7	118,101,634 - 118,108,864 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000116985 ⟹ ENSRNOP00000092328

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	108,759,904 - 108,767,383 (-)	Ensembl

RefSeq Acc Id:

NM_021588 ⟹ NP_067599

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	7	108,759,903 - 108,767,134 (-)	NCBI
Rnor_6.0	7	118,101,633 - 118,108,864 (-)	NCBI
Rnor_5.0	7	118,094,391 - 118,101,622 (-)	NCBI
RGSC_v3.4	7	115,087,558 - 115,094,789 (-)	RGD
Celera	7	105,108,137 - 105,115,366 (-)	RGD

Sequence:

show sequence

CTCCTTTTGTCCTCTTTAGAAGCCACCATGGGGCTCAGTGATGGGGAGTGGCAGATGGTGCTGA
ACATCTGGGGGAAAGTGGAGGGCGACCTTGCTGGCCATGGACAGGAAGTCCTCATCAGTCTATT
TAAGGCTCACCCCGAGACCCTGGAAAAGTTCGACAAGTTCAAGAACCTGAAATCCGAGGAAGAG
ATGAAGAGTTCAGAGGACCTGAAGAAGCACGGCTGCACCGTGCTCACAGCCCTGGGTACCATCC
TGAAGAAGAAGGGACAACATGCTGCTGAGATCCAGCCTCTGGCCCAGTCCCACGCCACCAAGCA
CAAGATCCCGGTCAAGTACCTGGAGTTTATCTCAGAAGTCATCATCCAAGTCCTGAAGAAGAGA
TATTCCGGGGACTTTGGAGCAGATGCTCAGGGCGCCATGAGCAAGGCCCTGGAGCTGTTCCGGA
ATGACATTGCTGCCAAGTACAAGGAGCTGGGCTTCCAGGGCTGAGCCATGGGCTCCCACTGTCC
AGCCCAGCAAGCTGGGACCCAATGTTGTGTAGAAGGTAGAGTGTGCTGTGCCCTAGGTTAGCAG
AGAACAGAAGAGGGGAGCATAGTGTGGCATCTACCCACACCCCTGGGGACAGAGCTCTGGGCAG
CATTGTCCTGGAACCCAGAGGTGCAAAGTGGCCTCTGCTTCCTCAGCTCTGCTGGGTCATGCTC
AGGTCTCCTGTCACCTAAGTCCCAACCCACTTTCCTCCTGGTTTTGGGAAAAATCTCTTTTCCA
CTGTCACATTTGACCCCAAATGCAAGTCACCAGCTAGCAGACACTGACCTTTGAAGGAGACAGA
GGGTTACTTAGAGGGAGTGGAGGGTGGAAAGTGGGCAGGTGAGCATCGGAAGTCTCCAGCTGCT
TAGCTTCCCCCTGACCCACCTGGTTTCAATAAAACATCCTGCAACTCCTCAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_067599	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF05848	(Get FASTA)	NCBI Sequence Viewer
	AAH70511	(Get FASTA)	NCBI Sequence Viewer
	EDM15922	(Get FASTA)	NCBI Sequence Viewer
	EDM15923	(Get FASTA)	NCBI Sequence Viewer
	Q9QZ76	(Get FASTA)	NCBI Sequence Viewer
	SAI82221	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_067599 ⟸ NM_021588
- UniProtKB:	Q9QZ76 (UniProtKB/Swiss-Prot), A0A1K0FUB2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKK HGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA QGAMSKALELFRNDIAAKYKELGFQG hide sequence

RefSeq Acc Id:

ENSRNOP00000006184 ⟸ ENSRNOT00000006184

RefSeq Acc Id:

ENSRNOP00000092328 ⟸ ENSRNOT00000116985

Protein Domains

Globin family profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QZ76-F1-model_v2	AlphaFold	Q9QZ76	1-154	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695443

Promoter ID:

EPDNEW_R5968

Type:

single initiation site

Name:

Mb_1

Description:

myoglobin

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	118,108,894 - 118,108,954	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620411	AgrOrtholog
BioCyc Gene	G2FUF-32892	BioCyc
Ensembl Genes	ENSRNOG00000004583	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000006184	ENTREZGENE
	ENSRNOP00000006184.3	UniProtKB/Swiss-Prot
	ENSRNOP00000092328.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006184	ENTREZGENE
	ENSRNOT00000006184.7	UniProtKB/Swiss-Prot
	ENSRNOT00000116985.1	UniProtKB/TrEMBL
Gene3D-CATH	6.10.140.2100	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	6.10.140.2110	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7103504	IMAGE-MGC_LOAD
InterPro	Globin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Globin-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Myoglobin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:59108	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:91707	IMAGE-MGC_LOAD
NCBI Gene	59108	ENTREZGENE
PANTHER	MYOGLOBIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR47132	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Globin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Mb	PhenoGen
PRINTS	MYOGLOBIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	GLOBIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF46458	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A1K0FUB2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AHY4_RAT	UniProtKB/TrEMBL
	MYG_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Mb	myoglobin			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Mb	myoglobin			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_process	may act as a scavenger of cellular Nitric Oxide in the myocardium	1300476

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM