Symbol:
Ptafr
Name:
platelet-activating factor receptor
RGD ID:
61897
Description:
Enables mitogen-activated protein kinase binding activity. Involved in several processes, including positive regulation of biosynthetic process; positive regulation of transport; and regulation of cellular extravasation. Predicted to be located in plasma membrane. Used to study several diseases, including acute kidney failure; neutropenia; perinatal necrotizing enterocolitis; pleurisy; and transient cerebral ischemia. Biomarker of conjunctivitis; sciatic neuropathy; and transient cerebral ischemia. Orthologous to human PTAFR (platelet activating factor receptor); PARTICIPATES IN calcium/calcium-mediated signaling pathway; Staphylococcus aureus infection pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
PAF-R; PAFr
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PTAFR (platelet activating factor receptor) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ptafr (platelet-activating factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ptafr (platelet activating factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PTAFR (platelet activating factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PTAFR (platelet activating factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ptafr (platelet activating factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PTAFR (platelet activating factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PTAFR (platelet activating factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ptafr (platelet activating factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Ptafr (platelet-activating factor receptor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PTAFR (platelet activating factor receptor)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ptafr (platelet-activating factor receptor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ptafr
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 150,049,322 - 150,079,060 (+) NCBI GRCr8 mRatBN7.2 5 144,765,770 - 144,795,057 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 144,765,976 - 144,795,251 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 147,473,683 - 147,495,127 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 149,243,260 - 149,264,707 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 149,231,360 - 149,253,019 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 150,746,284 - 150,775,675 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 150,754,021 - 150,775,672 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 154,414,542 - 154,443,798 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 152,565,687 - 152,587,342 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 152,575,728 - 152,597,381 (-) NCBI Celera 5 143,199,712 - 143,221,168 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ptafr Rat (-)-demecolcine increases expression ISO RGD:733075 6480464 Demecolcine results in increased expression of PTAFR mRNA CTD PMID:23649840 Ptafr Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:733075 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PTAFR mRNA CTD PMID:22079256 Ptafr Rat (S)-nicotine decreases expression ISO RGD:733075 6480464 Nicotine results in decreased expression of PTAFR mRNA CTD PMID:18247414 Ptafr Rat (S)-nicotine increases expression ISO RGD:733075 6480464 Nicotine results in increased expression of PTAFR mRNA CTD PMID:23825647 Ptafr Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of PTAFR mRNA CTD PMID:25380136 Ptafr Rat 1-O-palmitoyl-2-O-(5-oxovaleryl)-sn-glycero-3-phosphocholine affects binding ISO RGD:733075 6480464 1-palmitoyl-2-(5-oxovaleroyl)-sn-glycero-3-phosphorylcholine binds to PTAFR protein CTD PMID:16386258 Ptafr Rat 1-O-palmitoyl-2-O-(5-oxovaleryl)-sn-glycero-3-phosphocholine multiple interactions ISO RGD:733075 6480464 1-palmitoyl-2-(5-oxovaleroyl)-sn-glycero-3-phosphorylcholine inhibits the reaction [Platelet Activating Factor binds to PTAFR protein] CTD PMID:16386258 Ptafr Rat 17beta-estradiol affects expression ISO RGD:733075 6480464 Estradiol affects the expression of PTAFR mRNA CTD PMID:21826169 Ptafr Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PTAFR mRNA CTD PMID:32741896 Ptafr Rat 17beta-estradiol multiple interactions ISO RGD:733075 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of PTAFR mRNA CTD PMID:30165855 Ptafr Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PTAFR mRNA CTD PMID:32741896 Ptafr Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PTAFR mRNA CTD PMID:34747641 Ptafr Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PTAFR mRNA CTD PMID:33387578 Ptafr Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:62190 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of PTAFR mRNA CTD PMID:38648751 Ptafr Rat 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine multiple interactions ISO RGD:733075 6480464 1-palmitoyl-2-(5-oxovaleroyl)-sn-glycero-3-phosphorylcholine inhibits the reaction [Platelet Activating Factor binds to PTAFR protein]; BN 50730 inhibits the more ... CTD PMID:11529688|PMID:16386258 Ptafr Rat 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine increases expression EXP 6480464 Platelet Activating Factor results in increased expression of PTAFR mRNA CTD PMID:10447766|PMID:9065783 Ptafr Rat 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine increases phosphorylation EXP 6480464 Platelet Activating Factor results in increased phosphorylation of PTAFR protein CTD PMID:11297424 Ptafr Rat 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine multiple interactions EXP 6480464 bepafant inhibits the reaction [Platelet Activating Factor results in increased expression of PTAFR mRNA]; Carbon more ... CTD PMID:11297424|PMID:18205269|PMID:9065783 Ptafr Rat 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine increases expression ISO RGD:733075 6480464 Platelet Activating Factor results in increased expression of PTAFR mRNA CTD PMID:16386258 Ptafr Rat 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine affects binding ISO RGD:733075 6480464 Platelet Activating Factor binds to PTAFR protein CTD PMID:11529688|PMID:16386258 Ptafr Rat 2-naphthylamine decreases expression ISO RGD:733075 6480464 2-Naphthylamine results in decreased expression of PTAFR mRNA CTD PMID:18247414 Ptafr Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PTAFR mRNA CTD PMID:31881176 Ptafr Rat acrolein multiple interactions ISO RGD:733075 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268 Ptafr Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PTAFR mRNA CTD PMID:28959563 Ptafr Rat actinomycin D multiple interactions ISO RGD:733075 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of PTAFR mRNA CTD PMID:38460933 Ptafr Rat actinomycin D increases expression ISO RGD:733075 6480464 Dactinomycin results in increased expression of PTAFR mRNA CTD PMID:38460933 Ptafr Rat aflatoxin B1 increases expression ISO RGD:733075 6480464 Aflatoxin B1 results in increased expression of PTAFR mRNA CTD PMID:21641981|PMID:22100608 Ptafr Rat aflatoxin B1 increases methylation ISO RGD:733075 6480464 Aflatoxin B1 results in increased methylation of PTAFR gene CTD PMID:27153756 Ptafr Rat albuterol increases expression ISO RGD:733075 6480464 Albuterol results in increased expression of PTAFR protein CTD PMID:18362475 Ptafr Rat aldehydo-D-glucose multiple interactions ISO RGD:62190 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Ptafr Rat all-trans-retinoic acid increases expression ISO RGD:733075 6480464 Tretinoin results in increased expression of PTAFR mRNA CTD PMID:33167477 Ptafr Rat all-trans-retinoic acid multiple interactions ISO RGD:62190 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of PTAFR mRNA CTD PMID:36189433 Ptafr Rat alpha-pinene multiple interactions ISO RGD:733075 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268 Ptafr Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PTAFR mRNA CTD PMID:16483693 Ptafr Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PTAFR mRNA CTD PMID:30779732 Ptafr Rat antirheumatic drug decreases expression ISO RGD:733075 6480464 Antirheumatic Agents results in decreased expression of PTAFR mRNA CTD PMID:24449571 Ptafr Rat Apafant multiple interactions ISO RGD:733075 6480464 [WEB 2086 binds to and results in decreased activity of PTAFR protein] which results in more ... CTD PMID:7602232|PMID:8666909 Ptafr Rat arachidonic acid multiple interactions EXP 6480464 [Docosahexaenoic Acids co-treated with Arachidonic Acid] affects the expression of PTAFR mRNA; Arachidonic Acid inhibits more ... CTD PMID:17515866 Ptafr Rat aristolochic acid A increases expression ISO RGD:733075 6480464 aristolochic acid I results in increased expression of PTAFR mRNA CTD PMID:33212167 Ptafr Rat asbestos increases expression ISO RGD:733075 6480464 Asbestos results in increased expression of PTAFR mRNA CTD PMID:22398240 Ptafr Rat avobenzone increases expression ISO RGD:733075 6480464 avobenzone results in increased expression of PTAFR mRNA CTD PMID:31016361 Ptafr Rat Azoxymethane multiple interactions ISO RGD:62190 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PTAFR more ... CTD PMID:29950665 Ptafr Rat benzo[a]pyrene decreases expression ISO RGD:733075 6480464 Benzo(a)pyrene results in decreased expression of PTAFR mRNA CTD PMID:18247414 Ptafr Rat benzo[a]pyrene decreases methylation ISO RGD:733075 6480464 Benzo(a)pyrene results in decreased methylation of PTAFR promoter CTD PMID:27901495 Ptafr Rat benzo[a]pyrene affects methylation ISO RGD:733075 6480464 Benzo(a)pyrene affects the methylation of PTAFR 5' UTR CTD PMID:27901495 Ptafr Rat benzo[a]pyrene increases expression ISO RGD:733075 6480464 Benzo(a)pyrene results in increased expression of PTAFR mRNA CTD PMID:21871943|PMID:35870112 Ptafr Rat bisphenol A affects expression ISO RGD:733075 6480464 bisphenol A affects the expression of PTAFR mRNA CTD PMID:21826169 Ptafr Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PTAFR mRNA CTD PMID:34947998 Ptafr Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PTAFR mRNA CTD PMID:25181051 Ptafr Rat bleomycin A2 multiple interactions ISO RGD:62190 6480464 Cannabidiol analog inhibits the reaction [Bleomycin results in increased expression of PTAFR mRNA]; lenabasum inhibits more ... CTD PMID:30825431 Ptafr Rat bleomycin A2 increases expression ISO RGD:62190 6480464 Bleomycin results in increased expression of PTAFR mRNA CTD PMID:30825431 Ptafr Rat cadmium atom multiple interactions ISO RGD:733075 6480464 [Cadmium analog co-treated with Selenium analog co-treated with zinc sulfide analog] results in increased expression more ... CTD PMID:21481475 Ptafr Rat calcium atom multiple interactions EXP 6480464 RGS4 protein inhibits the reaction [PTAFR protein affects the localization of and affects the abundance more ... CTD PMID:11297424 Ptafr Rat calcium(0) multiple interactions EXP 6480464 RGS4 protein inhibits the reaction [PTAFR protein affects the localization of and affects the abundance more ... CTD PMID:11297424 Ptafr Rat camptothecin increases expression ISO RGD:733075 6480464 Camptothecin results in increased expression of PTAFR mRNA CTD PMID:38460933 Ptafr Rat cannabidiol multiple interactions ISO RGD:62190 6480464 Cannabidiol analog inhibits the reaction [Bleomycin results in increased expression of PTAFR mRNA] CTD PMID:30825431 Ptafr Rat carbon nanotube increases expression ISO RGD:62190 6480464 Nanotubes, Carbon analog results in increased expression of PTAFR mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Ptafr Rat carvedilol multiple interactions EXP 6480464 Carvedilol inhibits the reaction [Arginine results in increased expression of PTAFR mRNA] CTD PMID:32569593 Ptafr Rat CGP 52608 multiple interactions ISO RGD:733075 6480464 CGP 52608 promotes the reaction [RORA protein binds to PTAFR gene] CTD PMID:28238834 Ptafr Rat chlorpyrifos increases expression ISO RGD:62190 6480464 Chlorpyrifos results in increased expression of PTAFR mRNA CTD PMID:32715474 Ptafr Rat chlorpyrifos decreases expression ISO RGD:62190 6480464 Chlorpyrifos results in decreased expression of PTAFR mRNA CTD PMID:37019170 Ptafr Rat chlorpyrifos decreases methylation EXP 6480464 Chlorpyrifos results in decreased methylation of PTAFR gene CTD PMID:32905263 Ptafr Rat choline multiple interactions ISO RGD:62190 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Ptafr Rat cisplatin increases expression ISO RGD:733075 6480464 Cisplatin results in increased expression of PTAFR mRNA CTD PMID:27392435 Ptafr Rat cisplatin multiple interactions ISO RGD:733075 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PTAFR mRNA CTD PMID:27392435 Ptafr Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PTAFR mRNA CTD PMID:27523638 Ptafr Rat D-glucose multiple interactions ISO RGD:62190 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Ptafr Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of PTAFR mRNA CTD PMID:10447766 Ptafr Rat dextran sulfate multiple interactions ISO RGD:62190 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PTAFR more ... CTD PMID:29950665 Ptafr Rat dichlorine increases expression EXP 6480464 Chlorine results in increased expression of PTAFR mRNA CTD PMID:18636392 Ptafr Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of PTAFR mRNA CTD PMID:18636392 Ptafr Rat elemental selenium multiple interactions ISO RGD:733075 6480464 [Cadmium analog co-treated with Selenium analog co-treated with zinc sulfide analog] results in increased expression more ... CTD PMID:21481475 Ptafr Rat ethanol multiple interactions ISO RGD:62190 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of PTAFR mRNA CTD PMID:30517762 Ptafr Rat ethyl methanesulfonate increases expression ISO RGD:733075 6480464 Ethyl Methanesulfonate results in increased expression of PTAFR mRNA CTD PMID:23649840 Ptafr Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of PTAFR mRNA CTD PMID:30307764 Ptafr Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of PTAFR mRNA CTD PMID:18035473 Ptafr Rat folic acid multiple interactions ISO RGD:62190 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Ptafr Rat folic acid increases expression ISO RGD:62190 6480464 Folic Acid results in increased expression of PTAFR mRNA CTD PMID:25629700 Ptafr Rat formaldehyde increases expression ISO RGD:733075 6480464 Formaldehyde results in increased expression of PTAFR mRNA CTD PMID:23649840 Ptafr Rat fructose multiple interactions ISO RGD:62190 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Ptafr Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PTAFR mRNA CTD PMID:33387578 Ptafr Rat ginsenoside Re multiple interactions ISO RGD:62190 6480464 ginsenoside Re affects the reaction [GPX1 protein affects the expression of PTAFR protein] CTD PMID:36682417 Ptafr Rat ginsenoside Re decreases expression ISO RGD:62190 6480464 ginsenoside Re results in decreased expression of PTAFR protein CTD PMID:36682417 Ptafr Rat glucose multiple interactions ISO RGD:62190 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Ptafr Rat glyphosate multiple interactions ISO RGD:62190 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Ptafr Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of PTAFR mRNA CTD PMID:9065783 Ptafr Rat ivermectin decreases expression ISO RGD:733075 6480464 Ivermectin results in decreased expression of PTAFR mRNA CTD PMID:34090504 Ptafr Rat L-arginine increases expression EXP 6480464 Arginine results in increased expression of PTAFR mRNA CTD PMID:32569593 Ptafr Rat L-arginine multiple interactions EXP 6480464 Carvedilol inhibits the reaction [Arginine results in increased expression of PTAFR mRNA] CTD PMID:32569593 Ptafr Rat L-methionine multiple interactions ISO RGD:62190 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Ptafr Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of PTAFR mRNA CTD PMID:9065783 Ptafr Rat lipopolysaccharide multiple interactions ISO RGD:733075 6480464 [S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of PTAFR mRNA CTD PMID:35811015 Ptafr Rat lipoxin A4 multiple interactions ISO RGD:733075 6480464 [WEB 2086 binds to and results in decreased activity of PTAFR protein] which results in more ... CTD PMID:7602232 Ptafr Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:62190 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of PTAFR mRNA CTD PMID:36189433 Ptafr Rat monosodium L-glutamate decreases expression ISO RGD:62190 6480464 Sodium Glutamate results in decreased expression of PTAFR mRNA CTD PMID:20111022 Ptafr Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine multiple interactions ISO RGD:733075 6480464 PTAFR protein promotes the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased expression of SELP protein] CTD PMID:11116075 Ptafr Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of PTAFR mRNA CTD PMID:25380136 Ptafr Rat nickel atom increases expression ISO RGD:733075 6480464 Nickel results in increased expression of PTAFR mRNA CTD PMID:24768652 Ptafr Rat nicotine decreases expression ISO RGD:733075 6480464 Nicotine results in decreased expression of PTAFR mRNA CTD PMID:18247414 Ptafr Rat nicotine increases expression ISO RGD:733075 6480464 Nicotine results in increased expression of PTAFR mRNA CTD PMID:23825647 Ptafr Rat Nutlin-3 multiple interactions ISO RGD:733075 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of PTAFR mRNA CTD PMID:38460933 Ptafr Rat o-anisidine affects expression ISO RGD:733075 6480464 2-anisidine affects the expression of PTAFR mRNA CTD PMID:28089782 Ptafr Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of PTAFR mRNA CTD PMID:18636392 Ptafr Rat ozone multiple interactions ISO RGD:62190 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:34911549 Ptafr Rat ozone multiple interactions ISO RGD:733075 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268 Ptafr Rat paracetamol decreases expression ISO RGD:62190 6480464 Acetaminophen results in decreased expression of PTAFR mRNA CTD PMID:17585979 Ptafr Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PTAFR mRNA CTD PMID:33387578 Ptafr Rat paracetamol increases expression ISO RGD:733075 6480464 Acetaminophen results in increased expression of PTAFR mRNA CTD PMID:22230336 Ptafr Rat paracetamol affects expression ISO RGD:62190 6480464 Acetaminophen affects the expression of PTAFR mRNA CTD PMID:17562736 Ptafr Rat perfluorooctanoic acid increases expression ISO RGD:733075 6480464 perfluorooctanoic acid results in increased expression of PTAFR mRNA CTD PMID:36326898 Ptafr Rat phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 RGS4 protein inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of PTAFR protein] CTD PMID:11297424 Ptafr Rat phorbol 13-acetate 12-myristate increases phosphorylation EXP 6480464 Tetradecanoylphorbol Acetate results in increased phosphorylation of PTAFR protein CTD PMID:11297424 Ptafr Rat potassium chromate multiple interactions ISO RGD:733075 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PTAFR mRNA CTD PMID:22079256 Ptafr Rat potassium chromate increases expression ISO RGD:733075 6480464 potassium chromate(VI) results in increased expression of PTAFR mRNA CTD PMID:22079256 Ptafr Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:733075 6480464 [S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of PTAFR mRNA CTD PMID:35811015 Ptafr Rat selenium atom multiple interactions ISO RGD:733075 6480464 [Cadmium analog co-treated with Selenium analog co-treated with zinc sulfide analog] results in increased expression more ... CTD PMID:21481475 Ptafr Rat sevoflurane decreases methylation ISO RGD:62190 6480464 Sevoflurane results in decreased methylation of PTAFR mRNA CTD PMID:35249202 Ptafr Rat silicon dioxide increases expression ISO RGD:733075 6480464 Silicon Dioxide analog results in increased expression of PTAFR mRNA; Silicon Dioxide results in increased more ... CTD PMID:25351596|PMID:25895662 Ptafr Rat silicon dioxide increases expression ISO RGD:62190 6480464 Silicon Dioxide results in increased expression of PTAFR mRNA CTD PMID:29341224 Ptafr Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of PTAFR mRNA CTD PMID:21602193|PMID:22431001 Ptafr Rat simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of PTAFR mRNA CTD PMID:16414398 Ptafr Rat sodium arsenite decreases expression ISO RGD:733075 6480464 sodium arsenite results in decreased expression of PTAFR mRNA CTD PMID:38568856 Ptafr Rat sodium arsenite increases expression ISO RGD:733075 6480464 sodium arsenite results in increased expression of PTAFR mRNA CTD PMID:34032870 Ptafr Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PTAFR mRNA CTD PMID:32741896 Ptafr Rat tetrachloromethane increases activity EXP 6480464 Carbon Tetrachloride results in increased activity of PTAFR protein CTD PMID:12873816|PMID:16521183 Ptafr Rat tetrachloromethane multiple interactions ISO RGD:62190 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of PTAFR mRNA CTD PMID:30517762 Ptafr Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PTAFR mRNA CTD PMID:12873816|PMID:12921627|PMID:15138217|PMID:16521183|PMID:16644059|PMID:18205269 Ptafr Rat tetrachloromethane multiple interactions EXP 6480464 Carbon Tetrachloride promotes the reaction [Platelet Activating Factor binds to PTAFR protein] CTD PMID:18205269 Ptafr Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PTAFR mRNA CTD PMID:34492290 Ptafr Rat titanium dioxide multiple interactions ISO RGD:62190 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PTAFR more ... CTD PMID:29950665 Ptafr Rat titanium dioxide increases expression ISO RGD:62190 6480464 titanium dioxide results in increased expression of PTAFR mRNA CTD PMID:35295148 Ptafr Rat triphenyl phosphate affects expression ISO RGD:733075 6480464 triphenyl phosphate affects the expression of PTAFR mRNA CTD PMID:37042841 Ptafr Rat tris(2-butoxyethyl) phosphate affects expression ISO RGD:733075 6480464 tris(2-butoxyethyl) phosphate affects the expression of PTAFR mRNA CTD PMID:29024780 Ptafr Rat valproic acid increases methylation ISO RGD:733075 6480464 Valproic Acid results in increased methylation of PTAFR gene CTD PMID:29154799 Ptafr Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of PTAFR gene CTD PMID:31079544 Ptafr Rat vincristine increases expression ISO RGD:733075 6480464 Vincristine results in increased expression of PTAFR mRNA CTD PMID:23649840 Ptafr Rat zileuton multiple interactions ISO RGD:733075 6480464 zileuton binds to and results in decreased activity of PTAFR protein; zileuton inhibits the reaction more ... CTD PMID:11529688
Imported Annotations - KEGG (archival)
(-)-demecolcine (ISO) (-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (ISO) 1-naphthyl isothiocyanate (EXP) 1-O-palmitoyl-2-O-(5-oxovaleryl)-sn-glycero-3-phosphocholine (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine (EXP,ISO) 2-naphthylamine (ISO) acetamide (EXP) acrolein (ISO) acrylamide (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) albuterol (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) Apafant (ISO) arachidonic acid (EXP) aristolochic acid A (ISO) asbestos (ISO) avobenzone (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bleomycin A2 (ISO) cadmium atom (ISO) calcium atom (EXP) calcium(0) (EXP) camptothecin (ISO) cannabidiol (ISO) carbon nanotube (ISO) carvedilol (EXP) CGP 52608 (ISO) chlorpyrifos (EXP,ISO) choline (ISO) cisplatin (ISO) Cuprizon (EXP) D-glucose (ISO) dexamethasone (EXP) dextran sulfate (ISO) dichlorine (EXP) elemental selenium (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenvalerate (EXP) flavonoids (EXP) folic acid (ISO) formaldehyde (ISO) fructose (ISO) gentamycin (EXP) ginsenoside Re (ISO) glucose (ISO) glyphosate (ISO) indometacin (EXP) ivermectin (ISO) L-arginine (EXP) L-methionine (ISO) lipopolysaccharide (EXP,ISO) lipoxin A4 (ISO) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (ISO) N-formyl-L-methionyl-L-leucyl-L-phenylalanine (ISO) N-nitrosodimethylamine (EXP) nickel atom (ISO) nicotine (ISO) Nutlin-3 (ISO) o-anisidine (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) perfluorooctanoic acid (ISO) phorbol 13-acetate 12-myristate (EXP) potassium chromate (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) selenium atom (ISO) sevoflurane (ISO) silicon dioxide (EXP,ISO) simvastatin (EXP) sodium arsenite (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) tris(2-butoxyethyl) phosphate (ISO) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO) zileuton (ISO)
1.
Platelet-activating factor in vasoobliteration of oxygen-induced retinopathy.
Beauchamp MH, etal., Invest Ophthalmol Vis Sci. 2002 Oct;43(10):3327-37.
2.
Cloning, expression and tissue distribution of rat platelet-activating-factor-receptor cDNA.
Bito H, etal., Eur J Biochem 1994 Apr 1;221(1):211-8.
3.
Scorpion venom-induced neutrophilia is inhibited by a PAF receptor antagonist in the rat.
Borges CM, etal., J Leukoc Biol. 2000 Apr;67(4):515-9.
4.
The third intracellular domain of the platelet-activating factor receptor is a critical determinant in receptor coupling to phosphoinositide phospholipase C-activating G proteins. Studies using intracellular domain minigenes and receptor chimeras.
Carlson SA, etal., J Biol Chem. 1996 Sep 20;271(38):23146-53.
5.
Mutation of a putative amphipathic alpha-helix in the third intracellular domain of the platelet-activating factor receptor disrupts receptor/G protein coupling and signaling.
Carlson SA, etal., Mol Pharmacol. 1998 Mar;53(3):451-8.
6.
Regulation of platelet-activating factor receptor and platelet-activating factor receptor-mediated biological responses by cAMP in rat Kupffer cells.
Chao W, etal., J Biol Chem. 1990 Oct 15;265(29):17576-83.
7.
Platelet-activating factor (PAF) mediation of rat anaphylactic responses to soluble immune complexes. Studies with PAF receptor antagonist L-652,731.
Doebber TW, etal., J Immunol. 1986 Jun 15;136(12):4659-68.
8.
Platelet-activating factor (PAF) enhances tumor necrosis factor production by alveolar macrophages. Prevention by PAF receptor antagonists and lipoxygenase inhibitors.
Dubois C, etal., J Immunol. 1989 Aug 1;143(3):964-70.
9.
Platelet activating factor receptor antagonist improves survival and attenuates eicosanoid release in severe endotoxemia.
Fletcher JR, etal., Ann Surg. 1990 Mar;211(3):312-6.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
12.
Inhibition and reversal of endotoxin-, aggregated IgG- and paf-induced hypotension in the rat by SRI 63-072, a paf receptor antagonist.
Handley DA, etal., Immunopharmacology. 1986 Aug;12(1):11-6.
13.
Mechanisms of glomerular injury in experimental immune nephritis. II. Effect of a platelet activating factor receptor antagonist in an autologous nephritis model.
Hruby ZW, etal., Arch Immunol Ther Exp (Warsz). 1991;39(5-6):575-86.
14.
Differential actions of platelet-activating factor (PAF) receptor antagonists on the vasodilator and vasoconstrictor effects of PAF in the rat perfused heart.
Hu WM and Man RY, Br J Pharmacol. 1991 Dec;104(4):773-5.
15.
Participation of prostaglandin E2 and platelet-activating factor in thapsigargin-induced production of interleukin-6.
Ichinowatari G, etal., Eur J Pharmacol. 2002 Jan 11;434(3):187-96.
16.
Yangambin, a lignan obtained from Ocotea duckei, differentiates putative PAF receptor subtypes in the gastrointestinal tract of rats.
Jesus-Morais CM, etal., Planta Med. 2000 Apr;66(3):211-6.
17.
Mechanism and dose-effect of Ginkgolide B on severe acute pancreatitis of rats.
Ji RL, etal., World J Gastroenterol. 2011 May 7;17(17):2241-7. doi: 10.3748/wjg.v17.i17.2241.
18.
Beneficial actions of BN 50739, a new PAF receptor antagonist, in murine traumatic shock.
Karasawa A, etal., Methods Find Exp Clin Pharmacol. 1990 May;12(4):231-7.
19.
Antiinflammatory and antiallodynic actions of the lignan niranthin isolated from Phyllanthus amarus. Evidence for interaction with platelet activating factor receptor.
Kassuya CA, etal., Eur J Pharmacol. 2006 Sep 28;546(1-3):182-8. Epub 2006 Jul 22.
20.
PAF enhances MMP-2 production in rat aortic VSMCs via a beta-arrestin2-dependent ERK signaling pathway.
Kim YH, etal., J Lipid Res. 2013 Oct;54(10):2678-86. doi: 10.1194/jlr.M037176. Epub 2013 Aug 2.
21.
Platelet-activating factor receptor signals in rat osteoblasts during spaceflight.
Kumei Y, etal., Ann N Y Acad Sci. 2004 Dec;1030:116-20.
22.
Polyunsaturated fatty acid supplementation alters proinflammatory gene expression and reduces the incidence of necrotizing enterocolitis in a neonatal rat model.
Lu J, etal., Pediatr Res. 2007 Apr;61(4):427-32.
23.
Similar coronary vascular effects in the rat perfused heart of platelet-activating factor structural analogues with agonist and antagonist properties.
Man RY and Kinnaird AA, Br J Pharmacol. 1995 Nov;116(5):2359-64.
24.
Mechanisms underlying the nociceptive responses induced by platelet-activating factor (PAF) in the rat paw.
Marotta DM, etal., Biochem Pharmacol. 2009 Apr 1;77(7):1223-35.
25.
Interference of the PAF receptor antagonist, PCA 4248, with the rat pleurisy evoked by inflammatory mediators or allergen.
Martins MA, etal., Eur J Pharmacol. 1993 Jun 11;237(1):17-22.
26.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
27.
Role of PAF in acute liver injury after extended hepatectomy: overexpression of PAF receptor mRNA in Kupffer cells.
Mizuno S, etal., Dig Dis Sci. 2001 Jun;46(6):1299-304.
28.
cAMP mediates homologous downregulation of PAF receptor mRNA expression in mesangial cells.
Nakao A, etal., Am J Physiol. 1997 Sep;273(3 Pt 2):F445-50.
29.
Effects of PAF on histamine H1 receptor mRNA expression in rat trigeminal ganglia.
Nakasaki T, etal., Prostaglandins Other Lipid Mediat. 1999 Aug;58(1):29-41.
30.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
31.
Up-regulation of platelet-activating factor synthases and its receptor in spinal cord contribute to development of neuropathic pain following peripheral nerve injury.
Okubo M, etal., Mol Pain. 2012 Feb 2;8:8. doi: 10.1186/1744-8069-8-8.
32.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
33.
(+/-)-trans-2-(3-Methoxy-5-methylsulfonyl-4-propoxyphenyl)-5-(3,4,5- trimethoxyphenyl)tetrahydrofuran (L-659,989), a novel, potent PAF receptor antagonist.
Ponpipom MM, etal., Biochem Biophys Res Commun. 1988 Feb 15;150(3):1213-20.
34.
The vascular distribution of the platelet-activating factor receptor.
Predescu D, etal., Eur J Cell Biol. 1996 Jan;69(1):86-98.
35.
Effect of platelet-activating factor (PAF) receptor blockers on smooth muscle cell replication in vitro and allograft arteriosclerosis in vivo.
Raisanen A, etal., Transpl Int. 1993;6(5):251-7.
36.
GOA pipeline
RGD automated data pipeline
37.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
38.
Pneumococcal trafficking across the blood-brain barrier. Molecular analysis of a novel bidirectional pathway.
Ring A, etal., J Clin Invest. 1998 Jul 15;102(2):347-60.
39.
Influence of the platelet-activating factor receptor antagonist BN52021 on endotoxin-induced leukocyte adherence in rat mesenteric venules.
Schmidt H, etal., J Surg Res. 1996 Jan;60(1):29-35.
40.
Effects of the PAF receptor antagonist UK74505 on local and remote reperfusion injuries following ischaemia of the superior mesenteric artery in the rat.
Souza DG, etal., Br J Pharmacol. 2000 Dec;131(8):1800-8.
41.
Role of PAF receptors during intestinal ischemia and reperfusion injury. A comparative study between PAF receptor-deficient mice and PAF receptor antagonist treatment.
Souza DG, etal., Br J Pharmacol. 2003 Jun;139(4):733-40.
42.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
43.
Effect of the platelet-activating factor antagonist BN 50739 and its diluents on mitochondrial respiration and membrane lipids during and following cerebral ischemia.
Sun D and Gilboe DD, J Neurochem. 1994 May;62(5):1929-38.
44.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
45.
Role of platelet activating factor in endotoxemic acute renal failure in the male rat.
Tolins JP, etal., J Lab Clin Med. 1989 Mar;113(3):316-24.
46.
Proteinase-activated receptor-2-activating peptides induce leukocyte rolling, adhesion, and extravasation in vivo.
Vergnolle N J Immunol. 1999 Nov 1;163(9):5064-9.
47.
Regulation of platelet-activating factor receptor gene expression in vivo by endotoxin, platelet-activating factor and endogenous tumour necrosis factor.
Wang H, etal., Biochem J. 1997 Mar 1;322 ( Pt 2):603-8.
48.
Platelet-activating factor receptor mRNA is localized in eosinophils and epithelial cells in rat small intestine: regulation by dexamethasone and gut flora.
Wang H, etal., Immunology. 1999 Jul;97(3):447-54.
49.
Protective effects of a PAF receptor antagonist and a neutrophil elastase inhibitor on multiple organ failure induced by cerulein plus lipopolysaccharide in rats.
Yamano M, etal., Naunyn Schmiedebergs Arch Pharmacol. 1998 Aug;358(2):253-63.
50.
Platelet-activating factor receptor antagonist attenuates endotoxin-induced vascular hyporeactivity in the pithed rat.
Yoshikawa D, etal., Eur J Pharmacol. 1998 Jan 26;342(2-3):241-5.
51.
Down-regulation of platelet-activating factor receptor gene expression during focal reversible cerebral ischemia in rats.
Zhang X, etal., Neurochem Res. 2007 Mar;32(3):451-6.
52.
Prolongation of parturition in the pregnant rat following treatment with a platelet activating factor receptor antagonist.
Zhu YP, etal., Biol Reprod. 1991 Jan;44(1):39-42.
53.
Direct action of platelet activating factor (PAF) induces eosinophil accumulation and enhances expression of PAF receptors in conjunctivitis.
Zinchuk O, etal., Mol Vis. 2005 Feb 9;11:114-23.
Ptafr Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 150,049,322 - 150,079,060 (+) NCBI GRCr8 mRatBN7.2 5 144,765,770 - 144,795,057 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 144,765,976 - 144,795,251 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 147,473,683 - 147,495,127 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 149,243,260 - 149,264,707 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 149,231,360 - 149,253,019 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 150,746,284 - 150,775,675 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 150,754,021 - 150,775,672 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 154,414,542 - 154,443,798 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 152,565,687 - 152,587,342 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 152,575,728 - 152,597,381 (-) NCBI Celera 5 143,199,712 - 143,221,168 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
PTAFR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 28,147,166 - 28,193,856 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 28,147,166 - 28,193,936 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 28,473,677 - 28,520,367 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 28,348,425 - 28,375,778 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 28,160,005 - 28,187,333 NCBI Celera 1 26,869,321 - 26,916,090 (-) NCBI Celera Cytogenetic Map 1 p35.3 NCBI HuRef 1 26,730,992 - 26,777,615 (-) NCBI HuRef CHM1_1 1 28,589,192 - 28,635,951 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 27,988,997 - 28,035,686 (-) NCBI T2T-CHM13v2.0
Ptafr Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 132,291,378 - 132,309,994 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 132,291,378 - 132,309,994 (+) Ensembl GRCm39 Ensembl GRCm38 4 132,564,067 - 132,582,683 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 132,564,067 - 132,582,683 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 132,119,982 - 132,136,781 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 131,836,143 - 131,852,942 (+) NCBI MGSCv36 mm8 Celera 4 130,724,940 - 130,741,731 (+) NCBI Celera Cytogenetic Map 4 D2.3 NCBI cM Map 4 65.56 NCBI
Ptafr Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 7,311,901 - 7,312,929 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 7,309,854 - 7,345,579 (-) NCBI ChiLan1.0 ChiLan1.0
PTAFR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 198,678,044 - 198,707,889 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 197,792,619 - 197,829,135 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 27,405,880 - 27,436,184 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 28,447,178 - 28,474,623 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 28,447,833 - 28,448,861 (-) Ensembl panpan1.1 panPan2
PTAFR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 72,225,386 - 72,256,353 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 72,225,386 - 72,256,352 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 68,803,234 - 68,834,141 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 72,785,522 - 72,816,261 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 72,785,522 - 72,816,261 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 69,612,919 - 69,643,905 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 70,622,939 - 70,654,206 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 71,619,611 - 71,650,615 (+) NCBI UU_Cfam_GSD_1.0
Ptafr Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 46,509,123 - 46,540,460 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 12,336,071 - 12,337,099 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 12,333,905 - 12,337,140 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PTAFR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 85,235,394 - 85,261,760 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 85,235,390 - 85,272,360 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 84,789,514 - 84,851,193 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PTAFR Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 104,627,591 - 104,658,840 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 104,657,179 - 104,658,207 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 11,819,318 - 11,850,460 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ptafr
.
Predicted Target Of
Count of predictions: 686 Count of miRNA genes: 281 Interacting mature miRNAs: 369 Transcripts: ENSRNOT00000017687 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 1300119 Bp180 Blood pressure QTL 180 3.82 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 144358090 157869054 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631263 Cm24 Cardiac mass QTL 24 3.5 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 5 143799107 158428037 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH128779
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 144,794,789 - 144,795,009 (+) MAPPER mRatBN7.2 Rnor_6.0 5 150,775,411 - 150,775,630 NCBI Rnor6.0 Rnor_5.0 5 154,443,534 - 154,443,753 UniSTS Rnor5.0 RGSC_v3.4 5 152,565,732 - 152,565,951 UniSTS RGSC3.4 Celera 5 143,220,904 - 143,221,123 UniSTS RH 3.4 Map 5 965.51 UniSTS Cytogenetic Map 5 q36 UniSTS
UniSTS:144285
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 144,792,122 - 144,792,657 (+) MAPPER mRatBN7.2 Rnor_6.0 5 150,772,744 - 150,773,278 NCBI Rnor6.0 Rnor_5.0 5 154,440,867 - 154,441,401 UniSTS Rnor5.0 RGSC_v3.4 5 152,568,084 - 152,568,618 UniSTS RGSC3.4 Celera 5 143,218,237 - 143,218,771 UniSTS Cytogenetic Map 5 q36 UniSTS
UniSTS:484979
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 144,791,818 - 144,793,228 (+) MAPPER mRatBN7.2 Rnor_6.0 5 150,772,440 - 150,773,849 NCBI Rnor6.0 Rnor_5.0 5 154,440,563 - 154,441,972 UniSTS Rnor5.0 RGSC_v3.4 5 152,567,513 - 152,568,922 UniSTS RGSC3.4 Celera 5 143,217,933 - 143,219,342 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017687 ⟹ ENSRNOP00000017687
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 144,765,983 - 144,795,251 (+) Ensembl Rnor_6.0 Ensembl 5 150,754,021 - 150,775,672 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097551 ⟹ ENSRNOP00000079229
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 144,773,279 - 144,795,245 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119353 ⟹ ENSRNOP00000085904
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 144,765,976 - 144,795,251 (+) Ensembl
RefSeq Acc Id:
NM_053321 ⟹ NP_445773
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 150,057,404 - 150,079,060 (+) NCBI mRatBN7.2 5 144,773,398 - 144,795,054 (+) NCBI Rnor_6.0 5 150,754,021 - 150,775,675 (+) NCBI Rnor_5.0 5 154,414,542 - 154,443,798 (+) NCBI RGSC_v3.4 5 152,565,687 - 152,587,342 (-) RGD Celera 5 143,199,712 - 143,221,168 (+) RGD
Sequence:
CTGAGGCTTGGACCCGGAGGGACACGCAGAGCCTACGGCTGAGCTCCTATAGGGACATACAACGTTCCATGACCAGGTGACCCTTCCTGCCCAGAGCAATGGAGCAAAATGGCTCCTTCCGTGTGGAT
hide sequence
RefSeq Acc Id:
XM_006239063 ⟹ XP_006239125
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 150,049,768 - 150,079,060 (+) NCBI mRatBN7.2 5 144,765,770 - 144,795,057 (+) NCBI Rnor_6.0 5 150,746,284 - 150,775,675 (+) NCBI Rnor_5.0 5 154,414,542 - 154,443,798 (+) NCBI
Sequence:
CTCGGCTTTAGATGGGCCGGGTGTTGGCTGAATTGTGTAGATCCTGGTTGGGTGGGACTATTTT
hide sequence
RefSeq Acc Id:
XM_006239064 ⟹ XP_006239126
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 150,069,239 - 150,079,060 (+) NCBI mRatBN7.2 5 144,785,215 - 144,795,057 (+) NCBI Rnor_6.0 5 150,765,465 - 150,775,675 (+) NCBI Rnor_5.0 5 154,414,542 - 154,443,798 (+) NCBI
Sequence:
ACCAAAATGAAAAGAAATCAATATCTTAAGCCTATGGTGAGCTAGGCATGGCGTTGTAGGTTTG
hide sequence
RefSeq Acc Id:
XM_063288332 ⟹ XP_063144402
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 150,049,322 - 150,079,060 (+) NCBI
RefSeq Acc Id:
NP_445773 ⟸ NM_053321
- UniProtKB:
P46002 (UniProtKB/Swiss-Prot), A6ISU3 (UniProtKB/TrEMBL)
- Sequence:
MEQNGSFRVDSEFRYTLFPIVYSVIFVLGVVANGYVLWVFATLYPSKKLNEIKIFMVNLTVADLLFLMTLPLWIVYYSNEGDWIVHKFLCNLAGCLFFINTYCSVAFLGVITYNRYQAVAYPIKTAQA
hide sequence
RefSeq Acc Id:
XP_006239125 ⟸ XM_006239063
- Peptide Label:
isoform X1
- Sequence:
MEQNGSFRVDSEFRYTLFPIVYSVIFVLGVVANGYVLWVFATLYPSKKLNEIKIFMVNLTVADLLFLMTLPLWIVYYSNEGDWIVHKFLCNLAGCLFFINTYCSVAFLGVITYNRYQAVAYPIKTAQA
hide sequence
RefSeq Acc Id:
XP_006239126 ⟸ XM_006239064
- Peptide Label:
isoform X1
- UniProtKB:
P46002 (UniProtKB/Swiss-Prot), A6ISU3 (UniProtKB/TrEMBL)
- Sequence:
MEQNGSFRVDSEFRYTLFPIVYSVIFVLGVVANGYVLWVFATLYPSKKLNEIKIFMVNLTVADLLFLMTLPLWIVYYSNEGDWIVHKFLCNLAGCLFFINTYCSVAFLGVITYNRYQAVAYPIKTAQA
hide sequence
Ensembl Acc Id:
ENSRNOP00000017687 ⟸ ENSRNOT00000017687
Ensembl Acc Id:
ENSRNOP00000085904 ⟸ ENSRNOT00000119353
Ensembl Acc Id:
ENSRNOP00000079229 ⟸ ENSRNOT00000097551
RefSeq Acc Id:
XP_063144402 ⟸ XM_063288332
- Peptide Label:
isoform X1
RGD ID: 13694099 Promoter ID: EPDNEW_R4624 Type: multiple initiation site Name: Ptafr_1 Description: platelet-activating factor receptor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 150,753,983 - 150,754,043 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Ptafr
platelet-activating factor receptor
Name updated
70584 APPROVED
