Symbol:
Kcne1
Name:
potassium voltage-gated channel subfamily E regulatory subunit 1
RGD ID:
2956
Description:
Enables delayed rectifier potassium channel activity; potassium channel regulator activity; and transmembrane transporter binding activity. Involved in several processes, including cellular response to acidic pH; negative regulation of protein targeting to membrane; and regulation of cation channel activity. Located in Z disc and apical plasma membrane. Part of voltage-gated potassium channel complex. Biomarker of congestive heart failure. Human ortholog(s) of this gene implicated in Jervell-Lange Nielsen syndrome; atrial fibrillation; long QT syndrome; and long QT syndrome 5. Orthologous to human KCNE1 (potassium voltage-gated channel subfamily E regulatory subunit 1); PARTICIPATES IN acebutolol pharmacodynamics pathway; adrenergic beta receptor agonist and beta-blocker pharmacodynamics pathway; amiodarone pharmacodynamics pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; all-trans-retinoic acid; ammonium chloride.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
delayed rectifier potassium channel subunit IsK; IKs producing slow voltage-gated potassium channel subunit beta Mink; Isk; m; minimal potassium channel; mink; Potassium (K+) channel protein slowly activating (Isk); potassium (K+) channel protein, slowly activating (Isk); potassium channel, voltage gated subfamily E regulatory beta subunit 1; potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 1; potassium voltage-gated channel Shaw-related subfamily member 1; potassium voltage-gated channel subfamily E member 1; potassium voltage-gated channel, Isk-related family, member 1; potassium voltage-gated channel, Isk-related subfamily, member 1; potassium voltage-gated channel, Shaw-related subfamily, member 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KCNE1 (potassium voltage-gated channel subfamily E regulatory subunit 1) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Kcne1 (potassium voltage-gated channel, Isk-related subfamily, member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kcne1 (potassium voltage-gated channel subfamily E regulatory subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KCNE1 (potassium voltage-gated channel subfamily E regulatory subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KCNE1 (potassium voltage-gated channel subfamily E regulatory subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kcne1 (potassium voltage-gated channel subfamily E regulatory subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KCNE1 (potassium voltage-gated channel subfamily E regulatory subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KCNE1 (potassium voltage-gated channel subfamily E regulatory subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kcne1 (potassium voltage-gated channel subfamily E regulatory subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
KCNE1B (potassium voltage-gated channel subfamily E regulatory subunit 1B) HGNC
EggNOG, HomoloGene, OrthoDB
Homo sapiens (human):
MORN3 (MORN repeat containing 3) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Kcne1 (potassium voltage-gated channel, Isk-related subfamily, member 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
KCNE1 (potassium voltage-gated channel subfamily E regulatory subunit 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
kcne1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 45,066,875 - 45,080,024 (-) NCBI GRCr8 mRatBN7.2 11 31,580,951 - 31,594,116 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 31,580,742 - 31,593,901 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 40,275,474 - 40,285,587 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 32,946,932 - 32,957,045 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 32,105,499 - 32,115,642 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 32,498,260 - 32,511,202 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 32,498,261 - 32,508,420 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 36,101,918 - 36,117,002 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 32,344,529 - 32,355,189 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 32,400,771 - 32,411,432 (-) NCBI Celera 11 31,234,627 - 31,244,787 (-) NCBI Celera RH 3.4 Map 11 214.7 RGD Cytogenetic Map 11 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - SMPDB
1.
Regulation of neuronal type genes in congestive heart failure rats.
Andersson KB, etal., Acta Physiol (Oxf). 2006 Jan;186(1):17-27.
2.
Electrogram prolongation and nifedipine-suppressible ventricular arrhythmias in mice following targeted disruption of KCNE1.
Balasubramaniam R, etal., J Physiol. 2003 Oct 15;552(Pt 2):535-46.
3.
Mutation of the gene for IsK associated with both Jervell and Lange-Nielsen and Romano-Ward forms of Long-QT syndrome.
Duggal P, etal., Circulation. 1998 Jan 20;97(2):142-6.
4.
Cloning and expression of the delayed-rectifier IsK channel from neonatal rat heart and diethylstilbestrol-primed rat uterus.
Folander K, etal., Proc Natl Acad Sci U S A 1990 Apr;87(8):2975-9.
5.
Specific interaction of the potassium channel beta-subunit minK with the sarcomeric protein T-cap suggests a T-tubule-myofibril linking system.
Furukawa T, etal., J Mol Biol. 2001 Nov 2;313(4):775-84.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
Characterization of gene organization and generation of heterogeneous mRNA species of rat ISK protein.
Iwai M, etal., J Biochem (Tokyo) 1990 Aug;108(2):200-6.
9.
A large candidate gene survey identifies the KCNE1 D85N polymorphism as a possible modulator of drug-induced torsades de pointes.
Kaab S, etal., Circ Cardiovasc Genet. 2012 Feb 1;5(1):91-9. doi: 10.1161/CIRCGENETICS.111.960930. Epub 2011 Nov 18.
10.
KCNE1 and KCNE2 inhibit forward trafficking of homomeric N-type voltage-gated potassium channels.
Kanda VA, etal., Biophys J. 2011 Sep 21;101(6):1354-63. doi: 10.1016/j.bpj.2011.08.015. Epub 2011 Sep 20.
11.
KCNE1 and KCNE2 provide a checkpoint governing voltage-gated potassium channel a-subunit composition.
Kanda VA, etal., Biophys J. 2011 Sep 21;101(6):1364-75. doi: 10.1016/j.bpj.2011.08.014. Epub 2011 Sep 20.
12.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
13.
Association of the human minK gene 38G allele with atrial fibrillation: evidence of possible genetic control on the pathogenesis of atrial fibrillation.
Lai LP, etal., Am Heart J. 2002 Sep;144(3):485-90.
14.
Inhibitory effect of somatostatin on secretin-induced augmentation of the slowly activating K+ current (IKs) in the rat pancreatic acinar cell.
Lee E, etal., Pflugers Arch 2002 Jan;443(3):405-10.
15.
MinK, MiRP1, and MiRP2 diversify Kv3.1 and Kv3.2 potassium channel gating.
Lewis A, etal., J Biol Chem. 2004 Feb 27;279(9):7884-92. Epub 2003 Dec 16.
16.
Millimeter wave promotes the synthesis of extracellular matrix and the proliferation of chondrocyte by regulating the voltage-gated K+ channel.
Li X, etal., J Bone Miner Metab. 2014 Jul;32(4):367-77. doi: 10.1007/s00774-013-0513-2. Epub 2013 Nov 8.
17.
Regulation of the Kv2.1 potassium channel by MinK and MiRP1.
McCrossan ZA, etal., J Membr Biol. 2009 Mar;228(1):1-14. doi: 10.1007/s00232-009-9154-8. Epub 2009 Feb 14.
18.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
19.
Stoichiometry of the KCNQ1 - KCNE1 ion channel complex.
Nakajo K, etal., Proc Natl Acad Sci U S A. 2010 Nov 2;107(44):18862-7. doi: 10.1073/pnas.1010354107. Epub 2010 Oct 20.
20.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
21.
D85N, a KCNE1 polymorphism, is a disease-causing gene variant in long QT syndrome.
Nishio Y, etal., J Am Coll Cardiol. 2009 Aug 25;54(9):812-9. doi: 10.1016/j.jacc.2009.06.005.
22.
Molecular and functional characterization of ERG, KCNQ, and KCNE subtypes in rat stomach smooth muscle.
Ohya S, etal., Am J Physiol Gastrointest Liver Physiol 2002 Feb;282(2):G277-87.
23.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
24.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
25.
GOA pipeline
RGD automated data pipeline
26.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
27.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
28.
Immunohistochemical study of a rat membrane protein which induces a selective potassium permeation: its localization in the apical membrane portion of epithelial cells.
Sugimoto T, etal., J Membr Biol. 1990 Jan;113(1):39-47.
29.
Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing.
Tester DJ, etal., Heart Rhythm. 2005 May;2(5):507-17.
30.
KCNQ1/KCNE1 channels during germ-cell differentiation in the rat: expression associated with testis pathologies.
Tsevi I, etal., J Cell Physiol. 2005 Feb;202(2):400-10.2: id: 27199802 Error occurred: Document retrieval error: document does notexist
31.
min K channels form by assembly of at least 14 subunits.
Tzounopoulos T, etal., Proc Natl Acad Sci U S A. 1995 Oct 10;92(21):9593-7.
32.
Upregulation of KCNE1 induces QT interval prolongation in patients with chronic heart failure.
Watanabe E, etal., Circ J. 2007 Apr;71(4):471-8.
33.
Changes in activation gating of IsK potassium currents brought about by mutations in the transmembrane sequence.
Wilson GG, etal., FEBS Lett. 1994 Oct 24;353(3):251-4.
34.
Dynamic changes in HCN2, HCN4, KCNE1, and KCNE2 expression in ventricular cells from acute myocardial infarction rat hearts.
Xia S, etal., Biochem Biophys Res Commun. 2010 May 7;395(3):330-5. doi: 10.1016/j.bbrc.2010.04.003. Epub 2010 Apr 8.
35.
External pH regulates the slowly activating potassium current IsK expressed in Xenopus oocytes.
Yamane T, etal., FEBS Lett. 1993 Mar 22;319(3):229-32.
36.
Skipping of Exon 1 in the KCNQ1 gene causes Jervell and Lange-Nielsen syndrome.
Zehelein J, etal., J Biol Chem. 2006 Nov 17;281(46):35397-403. Epub 2006 Sep 19.
Kcne1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 45,066,875 - 45,080,024 (-) NCBI GRCr8 mRatBN7.2 11 31,580,951 - 31,594,116 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 31,580,742 - 31,593,901 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 40,275,474 - 40,285,587 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 32,946,932 - 32,957,045 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 32,105,499 - 32,115,642 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 32,498,260 - 32,511,202 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 32,498,261 - 32,508,420 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 36,101,918 - 36,117,002 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 32,344,529 - 32,355,189 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 32,400,771 - 32,411,432 (-) NCBI Celera 11 31,234,627 - 31,244,787 (-) NCBI Celera RH 3.4 Map 11 214.7 RGD Cytogenetic Map 11 q11 NCBI
KCNE1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 21 34,446,688 - 34,512,210 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 21 34,446,688 - 34,512,214 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 21 35,818,986 - 35,884,508 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 21 34,740,858 - 34,806,443 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 21 34,740,858 - 34,806,443 NCBI Celera 21 21,018,555 - 21,083,181 (-) NCBI Celera Cytogenetic Map 21 q22.12 ENTREZGENE HuRef 21 21,297,857 - 21,363,444 (-) NCBI HuRef CHM1_1 21 35,381,239 - 35,446,817 (-) NCBI CHM1_1 T2T-CHM13v2.0 21 32,829,243 - 32,898,958 (-) NCBI T2T-CHM13v2.0
Kcne1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 92,142,889 - 92,156,356 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 92,142,870 - 92,156,356 (-) Ensembl GRCm39 Ensembl GRCm38 16 92,346,001 - 92,359,468 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 92,345,982 - 92,359,468 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 92,346,246 - 92,359,713 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 92,234,860 - 92,248,327 (-) NCBI MGSCv36 mm8 Celera 16 93,429,327 - 93,442,798 (-) NCBI Celera Cytogenetic Map 16 C4 NCBI cM Map 16 53.57 NCBI
Kcne1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955407 33,807,581 - 33,814,356 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955407 33,807,581 - 33,814,356 (-) NCBI ChiLan1.0 ChiLan1.0
KCNE1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 22 30,566,300 - 30,634,574 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 21 25,424,445 - 25,492,209 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 21 20,818,395 - 20,884,053 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 21 34,187,482 - 34,252,573 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 21 34,190,043 - 34,190,441 (-) Ensembl panpan1.1 panPan2
KCNE1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 31 29,858,428 - 29,868,315 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 31 28,958,149 - 28,967,760 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 31 29,159,562 - 29,169,178 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 31 29,025,740 - 29,034,430 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 31 29,040,518 - 29,050,143 (-) NCBI UNSW_CanFamBas_1.0
Kcne1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404971 29,459,975 - 29,505,317 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936500 8,007,291 - 8,007,680 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936500 7,998,464 - 8,007,848 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KCNE1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 198,051,282 - 198,059,296 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 198,051,281 - 198,059,444 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 207,879,823 - 207,887,895 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KCNE1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 78,500,755 - 78,557,275 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 78,503,317 - 78,503,757 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 6,317,391 - 6,329,488 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kcne1
.
Predicted Target Of
Count of predictions: 15 Count of miRNA genes: 15 Interacting mature miRNAs: 15 Transcripts: ENSRNOT00000002717 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 1598842 Glom10 Glomerulus QTL 10 3.4 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 1 35331169 Rat 8694376 Bw156 Body weight QTL 156 2.25 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 724517 Uae18 Urinary albumin excretion QTL 18 3.7 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 16472047 44285911 Rat 10058952 Gmadr6 Adrenal mass QTL 6 2.29 0.0072 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 22959403 67959403 Rat 1300130 Rf20 Renal function QTL 20 4.44 kidney glomerulus integrity trait (VT:0010546) kidney glomerulus diameter (CMO:0001166) 11 29528418 60324829 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 2298551 Neuinf10 Neuroinflammation QTL 10 3.7 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 11 31239134 78851519 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 9589032 Epfw10 Epididymal fat weight QTL 10 9.29 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 11 23280456 68280456 Rat 9590313 Scort20 Serum corticosterone level QTL 20 6.51 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 11 23280456 68280456 Rat 8694424 Bw162 Body weight QTL 162 3.8 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat 1641927 Alcrsp10 Alcohol response QTL 10 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 11 8436674 53436674 Rat
RH94732
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 31,580,951 - 31,581,051 (+) MAPPER mRatBN7.2 Rnor_6.0 11 32,498,261 - 32,498,360 NCBI Rnor6.0 Rnor_5.0 11 36,101,919 - 36,102,018 UniSTS Rnor5.0 RGSC_v3.4 11 32,344,529 - 32,344,628 UniSTS RGSC3.4 Celera 11 31,234,627 - 31,234,726 UniSTS RH 3.4 Map 11 214.7 UniSTS Cytogenetic Map 11 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSRNOT00000002717 ⟹ ENSRNOP00000002717
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 31,580,952 - 31,581,962 (-) Ensembl Rnor_6.0 Ensembl 11 32,498,261 - 32,508,420 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096553 ⟹ ENSRNOP00000086617
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 31,580,742 - 31,593,901 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098014 ⟹ ENSRNOP00000087251
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 31,580,952 - 31,582,831 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114695 ⟹ ENSRNOP00000092414
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 31,580,742 - 31,593,901 (-) Ensembl
RefSeq Acc Id:
NM_012973 ⟹ NP_037105
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 45,066,876 - 45,077,033 (-) NCBI mRatBN7.2 11 31,580,952 - 31,591,112 (-) NCBI Rnor_6.0 11 32,498,261 - 32,508,420 (-) NCBI Rnor_5.0 11 36,101,918 - 36,117,002 (-) NCBI RGSC_v3.4 11 32,344,529 - 32,355,189 (-) RGD Celera 11 31,234,627 - 31,244,787 (-) RGD
Sequence:
CGTCCATCCAGGTCCAGGCGTGCAGAGTTTTGCTCCACATCAGGGAAACCGTGAAGCCCCAGGATGGCCCTGTCCAATTCCACAACTGTTCTGCCTTTTCTGGCCTCGCTGTGGCAGGAAACAGATGA
hide sequence
RefSeq Acc Id:
XM_006248034 ⟹ XP_006248096
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 45,066,875 - 45,068,479 (-) NCBI mRatBN7.2 11 31,580,951 - 31,582,534 (-) NCBI Rnor_6.0 11 32,498,260 - 32,499,844 (-) NCBI Rnor_5.0 11 36,101,918 - 36,117,002 (-) NCBI
Sequence:
AACCCTCCCCAAGTGCTGCTTCCTCCACCAAGCAGTCACCTAAAATTTCTACAGCGTCCCGCAACAGTGCTACAGACCCAGTGCTCAGTTCCATGAATCTATGTGGGGAGATTCACTGCAGCAGCCAC
hide sequence
RefSeq Acc Id:
XM_006248035 ⟹ XP_006248097
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 45,066,875 - 45,076,782 (-) NCBI mRatBN7.2 11 31,580,951 - 31,591,006 (-) NCBI Rnor_6.0 11 32,498,260 - 32,508,107 (-) NCBI Rnor_5.0 11 36,101,918 - 36,117,002 (-) NCBI
Sequence:
TCCGAGACCTGGGCTGACTGAGCCAAGCCCTGCCTGCTGGAAGCCCCAGGGCTCTGAGGCTCCGCCCATCCAAAGCTGCATTGCTTAGGTGCCTCTGGGATTGTCTGTCAGTCTTGTCTGTCAGTCCT
hide sequence
RefSeq Acc Id:
XM_017597886 ⟹ XP_017453375
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 45,066,875 - 45,080,024 (-) NCBI mRatBN7.2 11 31,580,951 - 31,594,116 (-) NCBI Rnor_6.0 11 32,498,260 - 32,511,202 (-) NCBI
Sequence:
TGCCCGGAGGTGCAATGAGAGCCATGGGATTGAAGGGTTACGGGCAATATTATGACTTGATCTCTGTGTGTCATAGTCATGGTCATGCGTGTGTTCATATGGAGGACAGAGGACCGAGGCCAGCGCTG
hide sequence
RefSeq Acc Id:
XM_017597887 ⟹ XP_017453376
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 45,066,875 - 45,069,079 (-) NCBI mRatBN7.2 11 31,580,951 - 31,582,926 (-) NCBI Rnor_6.0 11 32,498,260 - 32,499,917 (-) NCBI
Sequence:
GAGAGATCACATCTTCATTTGCATACAGGAAACAGACAGTGAACCGGAAGTGGGCAAGTCTGAGTTTTGCTCCACATCAGGGAAACCGTGAAGCCCCAGGATGGCCCTGTCCAATTCCACAACTGTTC
hide sequence
RefSeq Acc Id:
NP_037105 ⟸ NM_012973
- UniProtKB:
P15383 (UniProtKB/Swiss-Prot), A6JLJ7 (UniProtKB/TrEMBL)
- Sequence:
MALSNSTTVLPFLASLWQETDEPGGNMSADLARRSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKALFQARVLESFRACYVIENQAAVEQPATHLPELKP
hide sequence
RefSeq Acc Id:
XP_006248097 ⟸ XM_006248035
- Peptide Label:
isoform X1
- UniProtKB:
P15383 (UniProtKB/Swiss-Prot), A6JLJ7 (UniProtKB/TrEMBL)
- Sequence:
MALSNSTTVLPFLASLWQETDEPGGNMSADLARRSQLRDDSKLEALYILMVLGFFGFFTLGIML
hide sequence
RefSeq Acc Id:
XP_006248096 ⟸ XM_006248034
- Peptide Label:
isoform X1
- UniProtKB:
P15383 (UniProtKB/Swiss-Prot), A6JLJ7 (UniProtKB/TrEMBL)
- Sequence:
MALSNSTTVLPFLASLWQETDEPGGNMSADLARRSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKALFQARVLESFRACYVIENQAAVEQPATHLPELKP
hide sequence
RefSeq Acc Id:
XP_017453375 ⟸ XM_017597886
- Peptide Label:
isoform X1
- UniProtKB:
P15383 (UniProtKB/Swiss-Prot), A6JLJ7 (UniProtKB/TrEMBL)
- Sequence:
MALSNSTTVLPFLASLWQETDEPGGNMSADLARRSQLRDDSKLEALYILMVLGFFGFFTLGIML
hide sequence
RefSeq Acc Id:
XP_017453376 ⟸ XM_017597887
- Peptide Label:
isoform X1
- UniProtKB:
P15383 (UniProtKB/Swiss-Prot), A6JLJ7 (UniProtKB/TrEMBL)
- Sequence:
MALSNSTTVLPFLASLWQETDEPGGNMSADLARRSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKALFQARVLESFRACYVIENQAAVEQPATHLPELKP
hide sequence
Ensembl Acc Id:
ENSRNOP00000002717 ⟸ ENSRNOT00000002717
Ensembl Acc Id:
ENSRNOP00000086617 ⟸ ENSRNOT00000096553
Ensembl Acc Id:
ENSRNOP00000087251 ⟸ ENSRNOT00000098014
Ensembl Acc Id:
ENSRNOP00000092414 ⟸ ENSRNOT00000114695
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Kcne1
potassium voltage-gated channel subfamily E regulatory subunit 1
Kcne1
potassium channel, voltage gated subfamily E regulatory beta subunit 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-01-27
Kcne1
potassium channel, voltage gated subfamily E regulatory beta subunit 1
Kcne1
potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-01-26
Kcne1
potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 1
Kcne1
potassium voltage-gated channel, Isk-related family, member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-01-14
Kcne1
Potassium voltage-gated channel, Isk-related subfamily, member 1
Correction to spelling of name
68913 APPROVED
2001-10-23
Kcne1
Potassium voltage-gated channel, Shaw-related subfamily, member 1
Name updated to reflect Human and Mouse nomenclature
68913 APPROVED
Note Type
Note
Reference
gene_expression
expressed in the fundus and antrum of the stomach, brain, adrenal gland, thymus, retina, and skeletal muscle
625508
gene_expression
expressed in antrum and but not in fundus of the stomach
625508
gene_process
responsible for the potassium current deactivation by depolarization
625508
gene_process
curents generated by channel may counteract in the increase of muscle tone resulting in the regulation of the rhythms in stomach smooth muscle contraction
625508
gene_product
471 bp
625508
