Advanced Search (OLGA)

Gene: Gja4 (gap junction protein, alpha 4) Rattus norvegicus

Analyze

Symbol:

Gja4

Name:

gap junction protein, alpha 4

RGD ID:

2691

Description:

Predicted to enable gap junction channel activity. Involved in several processes, including calcium ion transport; endothelium development; and response to pain. Located in gap junction. Part of connexin complex. Biomarker of ureteral obstruction. Human ortholog(s) of this gene implicated in coronary artery disease and myocardial infarction. Orthologous to human GJA4 (gap junction protein alpha 4); PARTICIPATES IN connexin signaling pathway; INTERACTS WITH (S)-nicotine; 1,2,4-trimethylbenzene; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

connexin h1; connexin-37; cx37; CXN37; Cxnh1; gap junction alpha-4 protein; gap junction membrane channel protein alpha 4; Gap junction membrane channel protein alpha 4 (connexin 37); Gap junction membrane channel, protein alpha 4 (connexin 37)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GJA4 (gap junction protein alpha 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gja4 (gap junction protein, alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gja4 (gap junction protein alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GJA4 (gap junction protein alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GJA4 (gap junction protein alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gja4 (gap junction protein alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GJA4 (gap junction protein alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GJA4 (gap junction protein alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gja4 (gap junction protein alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GJA4 (gap junction protein alpha 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gja4 (gap junction protein, alpha 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cx39.4 (connexin 39.4)	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	gja4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	144,917,791 - 144,920,324 (-)	NCBI		GRCr8
mRatBN7.2	5	139,633,324 - 139,635,857 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	139,633,287 - 139,635,925 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	142,328,532 - 142,331,068 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	144,098,526 - 144,101,062 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	144,099,313 - 144,101,849 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	145,374,688 - 145,377,221 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	145,374,690 - 145,377,221 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	149,142,702 - 149,145,235 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	146,755,061 - 146,757,594 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	146,765,101 - 146,767,633 (-)	NCBI
Celera	5	138,127,254 - 138,129,787 (-)	NCBI		Celera
RH 3.4 Map	5	934.8	RGD
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

angiosarcoma (ISO)

Charcot-Marie-Tooth disease dominant intermediate C (ISO)

coronary artery disease (ISO)

Experimental Liver Cirrhosis (ISO)

hemangioma of liver (ISO)

hypertension (ISO)

multiple cutaneous and mucosal venous malformations (ISO)

myocardial infarction (ISO)

skin hemangioma (ISO)

ureteral obstruction (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(R)-carnitine (ISO)

(S)-nicotine (EXP)

1,2,4-trimethylbenzene (EXP)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

7,12-dimethyltetraphene (EXP,ISO)

aldrin (ISO)

all-trans-retinoic acid (EXP)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (EXP)

astragaloside IV (ISO)

atenolol (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

bromobenzene (EXP)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

carvedilol (EXP)

chloroprene (ISO)

chlorpyrifos (ISO)

cyclophosphamide (ISO)

diarsenic trioxide (EXP)

dioxygen (ISO)

doxorubicin (ISO)

entinostat (ISO)

fenvalerate (EXP)

fonofos (ISO)

gentamycin (EXP)

lycopene (ISO)

methamphetamine (EXP)

methotrexate (ISO)

methylparaben (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-acetyl-L-cysteine (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nickel atom (ISO)

nicotine (EXP)

oxybenzone (ISO)

paracetamol (EXP,ISO)

parathion (ISO)

perfluorooctanoic acid (EXP,ISO)

phenobarbital (EXP)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (ISO)

resveratrol (EXP,ISO)

SCH 23390 (EXP)

sevoflurane (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

terbufos (ISO)

tetrachloromethane (ISO)

thimerosal (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

triclosan (ISO)

troglitazone (ISO)

undecane (EXP)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

blood vessel development (ISO)

calcium ion transport (IMP)

cell communication (IEA)

cell-cell signaling (IBA,IMP)

endothelium development (IEP)

response to pain (IEP)

transmembrane transport (IEA)

Cellular Component

anchoring junction (IEA)

connexin complex (IBA,IDA,IEA)

gap junction (IDA,IEA,TAS)

membrane (IEA)

plasma membrane (IEA)

Molecular Function

gap junction channel activity (IBA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

connexin signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Disruption of smooth muscle gap junctions attenuates myogenic vasoconstriction of mesenteric resistance arteries.	Earley S, etal., Am J Physiol Heart Circ Physiol. 2004 Dec;287(6):H2677-86. Epub 2004 Aug 19.
2.	Connexins: gaps in our knowledge of vascular function.	Figueroa XF, etal., Physiology (Bethesda). 2004 Oct;19:277-84.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Four novel members of the connexin family of gap junction proteins. Molecular cloning, expression, and chromosome mapping.	Haefliger JA, etal., J Biol Chem 1992 Jan 25;267(3):2057-64.
6.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
7.	Induction of connexin 37 expression in a rat model of neuropathic pain.	Lin SH, etal., Brain Res Mol Brain Res 2002 Mar 28;99(2):134-40.
8.	Association between C1019T polymorphism of connexin37 and acute myocardial infarction: a study in patients from Sicily.	Listi F, etal., Int J Cardiol. 2005 Jul 10;102(2):269-71.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Connexin37 is the major connexin expressed in the media of caudal artery.	Rummery NM, etal., Arterioscler Thromb Vasc Biol 2002 Sep 1;22(9):1427-32.
15.	Expression of connexins in the normal and obstructed developing kidney.	Silverstein DM, etal., Pediatr Nephrol. 2003 Mar;18(3):216-24. Epub 2003 Feb 7.
16.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
17.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
18.	The bystander effect exerted by tumor cells expressing the herpes simplex virus thymidine kinase (HSVtk) gene is dependent on connexin expression and cell communication via gap junctions.	Vrionis FD, etal., Gene Ther. 1997 Jun;4(6):577-85.
19.	Genetic risk for coronary artery disease in individuals with or without type 2 diabetes.	Yamada Y, etal., Mol Genet Metab. 2004 Apr;81(4):282-90.
20.	Multiple connexin expression in regenerating arterial endothelial gap junctions.	Yeh HI, etal., Arterioscler Thromb Vasc Biol. 2000 Jul;20(7):1753-62.
21.	Individual gap junction plaques contain multiple connexins in arterial endothelium.	Yeh HI, etal., Circ Res. 1998 Dec 14-28;83(12):1248-63.
22.	Age-related alteration of gap junction distribution and connexin expression in rat aortic endothelium.	Yeh HI, etal., J Histochem Cytochem. 2000 Oct;48(10):1377-89.

Additional References at PubMed

PMID:12435353	PMID:15016632	PMID:15489334	PMID:17928514	PMID:19129462	PMID:19828678	PMID:20805582	PMID:24133065	PMID:24269759	PMID:25217644	PMID:28818996	PMID:29049831
PMID:32350069

Genomics

Comparative Map Data

Gja4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	144,917,791 - 144,920,324 (-)	NCBI		GRCr8
mRatBN7.2	5	139,633,324 - 139,635,857 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	139,633,287 - 139,635,925 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	142,328,532 - 142,331,068 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	144,098,526 - 144,101,062 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	144,099,313 - 144,101,849 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	145,374,688 - 145,377,221 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	145,374,690 - 145,377,221 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	149,142,702 - 149,145,235 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	146,755,061 - 146,757,594 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	146,765,101 - 146,767,633 (-)	NCBI
Celera	5	138,127,254 - 138,129,787 (-)	NCBI		Celera
RH 3.4 Map	5	934.8	RGD
Cytogenetic Map	5	q36	NCBI

GJA4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	34,792,999 - 34,795,747 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	34,792,999 - 34,795,747 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	35,258,600 - 35,261,348 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	35,031,186 - 35,033,935 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	34,927,714 - 34,930,439	NCBI
Celera	1	33,532,323 - 33,535,072 (+)	NCBI		Celera
Cytogenetic Map	1	p34.3	NCBI
HuRef	1	33,376,201 - 33,378,950 (+)	NCBI		HuRef
CHM1_1	1	35,374,168 - 35,376,917 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	34,655,628 - 34,658,374 (+)	NCBI		T2T-CHM13v2.0

Gja4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	127,205,213 - 127,207,832 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	127,205,214 - 127,207,832 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	127,311,420 - 127,314,039 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	127,311,421 - 127,314,039 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	126,988,665 - 126,991,222 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	126,813,725 - 126,816,282 (-)	NCBI		MGSCv36	mm8
Celera	4	125,645,767 - 125,648,324 (-)	NCBI		Celera
Cytogenetic Map	4	D2.2	NCBI
cM Map	4	61.47	NCBI

Gja4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	12,902,773 - 12,905,337 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	12,902,764 - 12,905,337 (+)	NCBI	ChiLan1.0	ChiLan1.0

GJA4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	192,050,029 - 192,052,939 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	191,171,197 - 191,174,108 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	34,059,901 - 34,063,181 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	35,241,402 - 35,244,191 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

GJA4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	7,167,665 - 7,170,388 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Gja4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	51,613,628 - 51,616,047 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	17,439,327 - 17,440,331 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	17,439,250 - 17,440,829 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GJA4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	91,045,394 - 91,048,162 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	91,045,430 - 91,048,161 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

GJA4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	98,092,282 - 98,095,036 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	98,092,785 - 98,093,786 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	18,746,427 - 18,749,170 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gja4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	17,836,180 - 17,845,011 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	17,842,566 - 17,845,011 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gja4
21 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	318
Count of miRNA genes:	189
Interacting mature miRNAs:	221
Transcripts:	ENSRNOT00000019246
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	125392826	139989768	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	129132428	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

Markers in Region

RH94392

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	139,633,329 - 139,633,503 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	145,374,694 - 145,374,867	NCBI	Rnor6.0
Rnor_5.0	5	149,142,708 - 149,142,881	UniSTS	Rnor5.0
RGSC_v3.4	5	146,755,067 - 146,755,240	UniSTS	RGSC3.4
Celera	5	138,127,260 - 138,127,433	UniSTS
RH 3.4 Map	5	934.8	UniSTS
Cytogenetic Map	5	q36	UniSTS

UniSTS:226049

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	139,633,824 - 139,634,191 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	145,375,189 - 145,375,555	NCBI	Rnor6.0
Rnor_5.0	5	149,143,203 - 149,143,569	UniSTS	Rnor5.0
RGSC_v3.4	5	146,755,562 - 146,755,928	UniSTS	RGSC3.4
Celera	5	138,127,755 - 138,128,121	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH134065

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	139,633,369 - 139,634,557 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	145,374,734 - 145,375,921	NCBI	Rnor6.0
Rnor_5.0	5	149,142,748 - 149,143,935	UniSTS	Rnor5.0
RGSC_v3.4	5	146,755,107 - 146,756,294	UniSTS	RGSC3.4
Celera	5	138,127,300 - 138,128,487	UniSTS
Cytogenetic Map	5	q36	UniSTS

PMC197251P2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	139,634,422 - 139,634,748 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	145,375,787 - 145,376,112	NCBI	Rnor6.0
Rnor_5.0	5	149,143,801 - 149,144,126	UniSTS	Rnor5.0
RGSC_v3.4	5	146,756,160 - 146,756,485	UniSTS	RGSC3.4
Celera	5	138,128,353 - 138,128,678	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_021654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC133802	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LT990400	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M76532	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019246 ⟹ ENSRNOP00000019246

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	139,633,287 - 139,635,925 (-)	Ensembl
Rnor_6.0 Ensembl	5	145,374,690 - 145,377,221 (-)	Ensembl

RefSeq Acc Id:

NM_021654 ⟹ NP_067686

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	144,917,791 - 144,920,324 (-)	NCBI
mRatBN7.2	5	139,633,324 - 139,635,857 (-)	NCBI
Rnor_6.0	5	145,374,688 - 145,377,221 (-)	NCBI
Rnor_5.0	5	149,142,702 - 149,145,235 (-)	NCBI
RGSC_v3.4	5	146,755,061 - 146,757,594 (-)	RGD
Celera	5	138,127,254 - 138,129,787 (-)	RGD

Sequence:

show sequence

CGCAGGCGCAGCTTCGGCCACGGTCGTCCCCTCTACCTGGGCCAGCCGGGCAAGCAGGCGAGAG
AGGCCCCGGAAACATGGGTGACTGGGGCTTCCTGGAGAAGCTGCTAGACCAGGTCCAGGAGCAC
TCGACCGTGGTGGGCAAGATCTGGTTAACGGTGCTCTTCATCTTCCGAATCCTCATCCTGGGCC
TGGCTGGTGAGTCGGTGTGGGGCGACGAGCAGTCTGATTTCGAATGTAACACAGCCCAGCCAGG
CTGCACCAATGTGTGCTATGACCAGGCTTTCCCCATCTCCCACATCCGATACTGGGTGCTGCAG
TTCCTCTTCGTGAGCACACCCACCCTGATCTACCTGGGCCACGTCATTTACCTGTCTCGGCGGG
AAGAACGGTTGCGGCAGAAAGAGGGAGAGCTTCGGGCACTGCCATCCAAGGACCCTCATGTAGA
GCGGGCACTAGCAGCCATAGAACATCAGATGGCCAAGATCTCGGTGGCAGAGGACGGTCGTCTT
CGCATTCGAGGGGCGCTCATGGGTACCTACGTGATCAGTGTGCTGTGTAAGAGTGTGCTGGAGG
CAGGCTTCCTCTATGGCCAGTGGCGTCTCTACGGCTGGACCATGGAGCCGGTGTTTGTGTGCCA
GCGTGCGCCCTGCCCCCACGTCGTGGACTGCTACGTCTCTCGACCCACCGAGAAGACCATCTTC
ATCATTTTCATGTTGGTGGTAGGGGTCATCTCCTTGGTGCTCAACCTACTGGAGCTGGTGCACC
TGTTGTGCCGCTGTGTCAGCCGGGAGATAAAGGCACGGAGGGACCATGACACCCGCCCGGCTCA
GGGCAGTGCCTCAGACCCTTACCCTGAACAGGTTTTCTTCTACCTCCCCATGGGCGAGGGACCC
TCGTCCCCACCGTGTCCCACCTACAATGGGCTCTCATCCACTGAGCAAAACTGGGCCAATTTGA
CCACCGAGGAGAGACTGACCTCTACCAGACCTCCCCCATTTGTAAATGCAGCCCCCCAGGGTGG
CCAGAAGTCCTCTAGCCGCCCCAACAGCTCTGCATCCAAGAAGCAGTATGTATAGGGCTCTGGG
GCTTCTGTCACTCCACAGGCTATCCTGAGGAGTGTGTAGTACCTTGAATGCCTCTCGGGCGGTC
CACTCCTCAAAGGCACTTGAGAGACAACTGGGCCTGGAAGGTGGACATTCGCTGGGCAGAAGAC
CTGATCACAGGTGGTTCTGGAATACCCTGAGCCTTAGTGATGACCAAAGGACACTGGCTTCTTT
CCAGAATGTGACCCTACCAGCCTCGGTGACAGCAGGTGGGGTGCTCTTGGCTAAGTGTGCTGTG
AACTCTCTGATCCTTTTCGCCTGATGCAGAGGGATCCCGAGCCAAGTCGACTTCAGGTTTCCAT
CACACCCCACTTCTCCTGGGAGAAGGCACTGATGTAGGCTGCTGGCTCAGCTTCGTCACCAGGA
CAGACACAGCCTGCCTGCGCTGGATCTGGCCCTTTCCAGGGGAGCTGGTTGGTGTCTTGTTTCC
CTCACTCCTAGTTCCACTGTTTATGATCCTAAAATAAACGGGACTCCATCATAAAAAAAAAAAA
AAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_067686	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40999	(Get FASTA)	NCBI Sequence Viewer
	AAH78837	(Get FASTA)	NCBI Sequence Viewer
	AAH86576	(Get FASTA)	NCBI Sequence Viewer
	EDL80480	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019246.3
	ENSRNOP00000112715
GenBank Protein	Q03190	(Get FASTA)	NCBI Sequence Viewer
	VZP20200	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_067686 ⟸ NM_021654

- UniProtKB:

Q03190 (UniProtKB/Swiss-Prot), A0A654IEV1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNV
CYDQAFPISHIRYWVLQFLFVSTPTLIYLGHVIYLSRREERLRQKEGELRALPSKDPHVERALA
AIEHQMAKISVAEDGRLRIRGALMGTYVISVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPC
PHVVDCYVSRPTEKTIFIIFMLVVGVISLVLNLLELVHLLCRCVSREIKARRDHDTRPAQGSAS
DPYPEQVFFYLPMGEGPSSPPCPTYNGLSSTEQNWANLTTEERLTSTRPPPFVNAAPQGGQKSS
SRPNSSASKKQYV

hide sequence

Ensembl Acc Id:

ENSRNOP00000019246 ⟸ ENSRNOT00000019246

Protein Domains

Connexin N-terminal Gap junction protein cysteine-rich

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q03190-F1-model_v2	AlphaFold	Q03190	1-333	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694049

Promoter ID:

EPDNEW_R4574

Type:

single initiation site

Name:

Gja4_1

Description:

gap junction protein, alpha 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	145,377,231 - 145,377,291	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2691	AgrOrtholog
BioCyc Gene	G2FUF-39853	BioCyc
Ensembl Genes	ENSRNOG00000014357	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000019246.6	UniProtKB/Swiss-Prot
	ENSRNOT00000138808	ENTREZGENE
Gene3D-CATH	1.20.1440.80	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7128770	IMAGE-MGC_LOAD
	IMAGE:7306623	IMAGE-MGC_LOAD
InterPro	Connexin	UniProtKB/Swiss-Prot
	Connexin37	UniProtKB/Swiss-Prot
	Connexin_CCC	UniProtKB/Swiss-Prot
	Connexin_CS	UniProtKB/Swiss-Prot
	Connexin_N	UniProtKB/Swiss-Prot
	Connexin_N_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:25655	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105441	IMAGE-MGC_LOAD
	MGC:93465	IMAGE-MGC_LOAD
NCBI Gene	25655	ENTREZGENE
PANTHER	GAP JUNCTION ALPHA-4 PROTEIN	UniProtKB/Swiss-Prot
	PTHR11984	UniProtKB/Swiss-Prot
Pfam	Connexin	UniProtKB/Swiss-Prot
PhenoGen	Gja4	PhenoGen
PRINTS	CONNEXIN	UniProtKB/Swiss-Prot
	CONNEXINA4	UniProtKB/Swiss-Prot
PROSITE	CONNEXINS_1	UniProtKB/Swiss-Prot
	CONNEXINS_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000014357	RatGTEx
SMART	CNX	UniProtKB/Swiss-Prot
	Connexin_CCC	UniProtKB/Swiss-Prot
TIGR	TC230030
UniProt	A0A654IEV1	ENTREZGENE, UniProtKB/TrEMBL
	CXA4_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-05-20	Gja4	gap junction protein, alpha 4	Gja4	gap junction membrane channel protein alpha 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Gja4	gap junction membrane channel protein alpha 4			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expression increases in response to sciatic nerve injury	728686

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations