Symbol:
Taf12
Name:
TATA-box binding protein associated factor 12
RGD ID:
1592841
Description:
Predicted to enable several functions, including DNA-binding transcription factor binding activity; TBP-class protein binding activity; and transcription coactivator activity. Predicted to contribute to RNA polymerase II general transcription initiation factor activity. Predicted to be involved in RNA polymerase II preinitiation complex assembly; mRNA transcription by RNA polymerase II; and positive regulation of transcription initiation by RNA polymerase II. Predicted to be part of SAGA complex; transcription factor TFIID complex; and transcription factor TFTC complex. Predicted to be active in nucleus. Orthologous to human TAF12 (TATA-box binding protein associated factor 12); PARTICIPATES IN RNA polymerase I transcription pathway; RNA polymerase II transcription initiation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; C60 fullerene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC682902; similar to Transcription initiation factor TFIID subunit 12 (Transcription initiation factor TFIID 20 kDa subunits) (TAFII-20) (TAFII20); TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor; transcription initiation factor TFIID subunit 12
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 149,756,826 - 149,772,886 (+) NCBI GRCr8 mRatBN7.2 5 144,472,816 - 144,490,299 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 144,472,841 - 144,488,849 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 147,172,810 - 147,188,198 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 148,942,655 - 148,958,096 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 148,931,015 - 148,945,727 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 150,459,701 - 150,476,521 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 150,459,713 - 150,475,186 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 154,126,851 - 154,143,964 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 5 142,905,400 - 142,920,328 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Taf12 Rat 1,2-dimethylhydrazine multiple interactions ISO Taf12 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TAF12 mRNA CTD PMID:22206623 Taf12 Rat 17alpha-ethynylestradiol affects expression ISO Taf12 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of TAF12 mRNA CTD PMID:17555576 Taf12 Rat 17alpha-ethynylestradiol multiple interactions ISO Taf12 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TAF12 mRNA CTD PMID:17942748 Taf12 Rat 17alpha-ethynylestradiol increases expression ISO Taf12 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of TAF12 mRNA CTD PMID:17942748 Taf12 Rat 17beta-estradiol increases expression ISO TAF12 (Homo sapiens) 6480464 Estradiol results in increased expression of TAF12 mRNA CTD PMID:19167446 Taf12 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Taf12 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Taf12 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Taf12 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Taf12 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TAF12 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TAF12 mRNA CTD PMID:21496263 Taf12 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TAF12 mRNA CTD PMID:33387578 Taf12 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Taf12 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TAF12 mRNA CTD PMID:21570461 Taf12 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Taf12 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TAF12 mRNA CTD PMID:17942748 and PMID:21496263 Taf12 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Taf12 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TAF12 mRNA CTD PMID:17942748 Taf12 Rat 2-methylcholine affects expression ISO TAF12 (Homo sapiens) 6480464 beta-methylcholine affects the expression of TAF12 mRNA CTD PMID:21179406 Taf12 Rat 2-palmitoylglycerol increases expression ISO TAF12 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of TAF12 mRNA CTD PMID:37199045 Taf12 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO TAF12 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TAF12 mRNA CTD PMID:28628672 Taf12 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Taf12 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of TAF12 mRNA CTD PMID:18648102 Taf12 Rat aflatoxin B1 increases expression ISO TAF12 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of TAF12 mRNA CTD PMID:27153756 Taf12 Rat aristolochic acid A increases expression ISO TAF12 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TAF12 mRNA CTD PMID:33212167 Taf12 Rat benzo[a]pyrene increases expression ISO Taf12 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TAF12 mRNA CTD PMID:22228805 Taf12 Rat benzo[a]pyrene affects methylation ISO TAF12 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TAF12 3' UTR CTD PMID:27901495 Taf12 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TAF12 mRNA CTD PMID:25181051 Taf12 Rat bisphenol A increases methylation ISO TAF12 (Homo sapiens) 6480464 bisphenol A results in increased methylation of TAF12 gene CTD PMID:31601247 Taf12 Rat bisphenol F multiple interactions ISO TAF12 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TAF12 mRNA CTD PMID:28628672 Taf12 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of TAF12 mRNA CTD PMID:19167457 Taf12 Rat carbon nanotube increases expression ISO Taf12 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Taf12 Rat ciguatoxin CTX1B affects expression ISO Taf12 (Mus musculus) 6480464 Ciguatoxins affects the expression of TAF12 mRNA CTD PMID:18353800 Taf12 Rat coumarin decreases phosphorylation ISO TAF12 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of TAF12 protein CTD PMID:35688186 Taf12 Rat coumestrol increases expression ISO TAF12 (Homo sapiens) 6480464 Coumestrol results in increased expression of TAF12 mRNA CTD PMID:19167446 Taf12 Rat cyclosporin A increases expression ISO TAF12 (Homo sapiens) 6480464 Cyclosporine results in increased expression of TAF12 mRNA CTD PMID:25562108 Taf12 Rat dexamethasone multiple interactions ISO TAF12 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TAF12 mRNA CTD PMID:28628672 Taf12 Rat folic acid multiple interactions ISO Taf12 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TAF12 mRNA CTD PMID:22206623 Taf12 Rat FR900359 increases phosphorylation ISO TAF12 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of TAF12 protein CTD PMID:37730182 Taf12 Rat hydralazine multiple interactions ISO TAF12 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of TAF12 mRNA CTD PMID:17183730 Taf12 Rat indometacin multiple interactions ISO TAF12 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TAF12 mRNA CTD PMID:28628672 Taf12 Rat manganese atom multiple interactions ISO TAF12 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of TAF12 mRNA CTD PMID:39836092 Taf12 Rat manganese(0) multiple interactions ISO TAF12 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of TAF12 mRNA CTD PMID:39836092 Taf12 Rat manganese(II) chloride multiple interactions ISO TAF12 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of TAF12 mRNA CTD PMID:39836092 Taf12 Rat methotrexate affects expression ISO Taf12 (Mus musculus) 6480464 Methotrexate affects the expression of TAF12 mRNA CTD PMID:18502557 Taf12 Rat nitrates multiple interactions ISO Taf12 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TAF12 mRNA CTD PMID:35964746 Taf12 Rat ozone multiple interactions ISO TAF12 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of TAF12 mRNA CTD PMID:35430440 Taf12 Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of TAF12 mRNA CTD PMID:27638505 Taf12 Rat paracetamol increases expression ISO TAF12 (Homo sapiens) 6480464 Acetaminophen results in increased expression of TAF12 mRNA CTD PMID:22230336 Taf12 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TAF12 mRNA CTD PMID:33387578 Taf12 Rat paracetamol affects expression ISO Taf12 (Mus musculus) 6480464 Acetaminophen affects the expression of TAF12 mRNA CTD PMID:17562736 Taf12 Rat sirolimus decreases expression ISO Taf12 (Mus musculus) 6480464 Sirolimus results in decreased expression of TAF12 mRNA CTD PMID:11355896 Taf12 Rat sodium arsenite increases expression ISO TAF12 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TAF12 mRNA CTD PMID:38568856 Taf12 Rat tamoxifen affects expression ISO Taf12 (Mus musculus) 6480464 Tamoxifen affects the expression of TAF12 mRNA CTD PMID:17555576 Taf12 Rat titanium dioxide increases methylation ISO Taf12 (Mus musculus) 6480464 titanium dioxide results in increased methylation of TAF12 gene CTD PMID:35295148 Taf12 Rat triphenyl phosphate affects expression ISO TAF12 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TAF12 mRNA CTD PMID:37042841 Taf12 Rat valproic acid multiple interactions ISO TAF12 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of TAF12 mRNA CTD PMID:17183730
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 2-palmitoylglycerol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) aflatoxin B1 (ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) C60 fullerene (EXP) carbon nanotube (ISO) ciguatoxin CTX1B (ISO) coumarin (ISO) coumestrol (ISO) cyclosporin A (ISO) dexamethasone (ISO) folic acid (ISO) FR900359 (ISO) hydralazine (ISO) indometacin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methotrexate (ISO) nitrates (ISO) ozone (ISO) p-toluidine (EXP) paracetamol (EXP,ISO) sirolimus (ISO) sodium arsenite (ISO) tamoxifen (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) valproic acid (ISO)
Taf12 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 149,756,826 - 149,772,886 (+) NCBI GRCr8 mRatBN7.2 5 144,472,816 - 144,490,299 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 144,472,841 - 144,488,849 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 147,172,810 - 147,188,198 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 148,942,655 - 148,958,096 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 148,931,015 - 148,945,727 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 150,459,701 - 150,476,521 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 150,459,713 - 150,475,186 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 154,126,851 - 154,143,964 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 5 142,905,400 - 142,920,328 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
TAF12 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 28,602,850 - 28,648,269 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 28,587,829 - 28,648,291 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 28,929,362 - 28,969,579 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 28,802,200 - 28,842,172 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 28,750,228 - 28,790,201 NCBI Celera 1 27,325,365 - 27,365,501 (-) NCBI Celera Cytogenetic Map 1 p35.3 NCBI HuRef 1 27,182,618 - 27,222,688 (-) NCBI HuRef CHM1_1 1 29,045,214 - 29,085,178 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 28,444,812 - 28,490,693 (-) NCBI T2T-CHM13v2.0
Taf12 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 132,001,667 - 132,020,640 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 132,001,686 - 132,023,077 (+) Ensembl GRCm39 Ensembl GRCm38 4 132,274,355 - 132,293,329 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 132,274,375 - 132,295,766 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 131,830,290 - 131,849,244 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 131,546,489 - 131,565,403 (+) NCBI MGSCv36 mm8 Celera 4 130,435,455 - 130,454,533 (+) NCBI Celera Cytogenetic Map 4 D2.3 NCBI cM Map 4 65.09 NCBI
TAF12 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 198,199,107 - 198,239,106 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 197,318,260 - 197,358,257 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 27,874,675 - 27,914,672 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 28,907,540 - 28,948,322 (-) NCBI panpan1.1 PanPan1.1 panPan2
TAF12 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 71,865,274 - 71,898,236 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 71,865,289 - 71,898,236 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 68,442,106 - 68,475,051 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 72,424,252 - 72,457,215 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 72,424,264 - 72,457,215 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 69,252,893 - 69,285,838 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 70,260,614 - 70,293,571 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 71,258,668 - 71,291,609 (+) NCBI UU_Cfam_GSD_1.0
Taf12 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 46,870,722 - 46,894,620 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 12,693,018 - 12,720,136 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 12,695,508 - 12,719,384 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TAF12 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 85,618,691 - 85,643,075 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 85,618,679 - 85,643,087 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 79,432,412 - 79,441,136 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TAF12 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 104,164,912 - 104,199,925 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 104,164,907 - 104,200,272 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 12,313,419 - 12,350,679 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Taf12
.
Predicted Target Of
Count of predictions: 77 Count of miRNA genes: 66 Interacting mature miRNAs: 69 Transcripts: ENSRNOT00000074251 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 1300119 Bp180 Blood pressure QTL 180 3.82 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 144358090 157869054 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631263 Cm24 Cardiac mass QTL 24 3.5 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 5 143799107 158428037 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH128062
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 144,487,461 - 144,487,668 (+) MAPPER mRatBN7.2 Rnor_6.0 5 150,473,684 - 150,473,890 NCBI Rnor6.0 Rnor_5.0 5 154,141,127 - 154,141,333 UniSTS Rnor5.0 Celera 5 142,920,008 - 142,920,214 UniSTS RH 3.4 Map 5 965.1 UniSTS
RH139476
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 8 859.2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000074251 ⟹ ENSRNOP00000066252
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 144,472,880 - 144,488,849 (+) Ensembl Rnor_6.0 Ensembl 5 150,459,745 - 150,474,004 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000081681 ⟹ ENSRNOP00000070933
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 144,472,841 - 144,488,849 (+) Ensembl Rnor_6.0 Ensembl 5 150,459,713 - 150,475,186 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097331 ⟹ ENSRNOP00000090404
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 144,473,163 - 144,488,849 (+) Ensembl
RefSeq Acc Id:
NM_001115036 ⟹ NP_001108508
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 149,756,894 - 149,771,804 (+) NCBI mRatBN7.2 5 144,472,871 - 144,487,782 (+) NCBI Rnor_6.0 5 150,459,745 - 150,474,004 (+) NCBI Rnor_5.0 5 154,126,851 - 154,143,964 (+) NCBI Celera 5 142,905,400 - 142,920,328 (+) RGD
Sequence:
AGTCGGACCGGCTGCTGAGACGAAAGCTTCACTGGGGCAGTCTCCGCATATCATGGGGAGATAGACGCTGCTGCCTTTGATTGGCCTTGGTCCTCACAGCTCAAAAAAGAAGCAGGATCTTGATAAGC
hide sequence
RefSeq Acc Id:
XM_006239067 ⟹ XP_006239129
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 149,756,826 - 149,772,886 (+) NCBI mRatBN7.2 5 144,472,816 - 144,490,299 (+) NCBI Rnor_6.0 5 150,459,701 - 150,476,521 (+) NCBI Rnor_5.0 5 154,126,851 - 154,143,964 (+) NCBI
Sequence:
TGGAGGCGGGGAGCGGTGCCGGAAGTGCTTGGGGAGGGCCGCGCAGTCGGACCGGCTGCTGAGA
hide sequence
RefSeq Acc Id:
XM_006239068 ⟹ XP_006239130
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 149,757,015 - 149,772,886 (+) NCBI mRatBN7.2 5 144,472,851 - 144,490,299 (+) NCBI Rnor_6.0 5 150,459,701 - 150,476,521 (+) NCBI Rnor_5.0 5 154,126,851 - 154,143,964 (+) NCBI
Sequence:
TGGAGGCGGGGAGCGGTGCCGGAAGTGCTTGGGGAGGGCCGCGCAGTCGGACCGGCTGCTGAGA
hide sequence
RefSeq Acc Id:
NP_001108508 ⟸ NM_001115036
- UniProtKB:
B0BMY3 (UniProtKB/TrEMBL), M0R9S2 (UniProtKB/TrEMBL)
- Sequence:
MNQFGPSALINLSSFSSIKPEPASTPPQGSMANSTTVGKMPGTPGTGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWI
hide sequence
RefSeq Acc Id:
XP_006239129 ⟸ XM_006239067
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2JZ70 (UniProtKB/TrEMBL), A0A8I6ABQ9 (UniProtKB/TrEMBL)
- Sequence:
MAASPYSGLTAVADVIKDLDTQIALIGLGPHSSKKKQDLDKLYELKCKAGQIMNQFGPSALINL
hide sequence
RefSeq Acc Id:
XP_006239130 ⟸ XM_006239068
- Peptide Label:
isoform X2
- UniProtKB:
B0BMY3 (UniProtKB/TrEMBL), M0R9S2 (UniProtKB/TrEMBL)
- Sequence:
MNQFGPSALINLSSFSSIKPEPASTPPQGSMANSTTVGKMPGTPGTGGRLSPENNQVLTKKKLQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000070933 ⟸ ENSRNOT00000081681
Ensembl Acc Id:
ENSRNOP00000066252 ⟸ ENSRNOT00000074251
Ensembl Acc Id:
ENSRNOP00000090404 ⟸ ENSRNOT00000097331
RGD ID: 13694094 Promoter ID: EPDNEW_R4617 Type: initiation region Name: Taf12_1 Description: TATA-box binding protein associated factor 12 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 150,459,745 - 150,459,805 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-14
Taf12
TATA-box binding protein associated factor 12
Taf12
TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-04-14
Taf12
TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor
LOC682902
similar to Transcription initiation factor TFIID subunit 12 (Transcription initiation factor TFIID 20 kDa subunits) (TAFII-20) (TAFII20)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-20
LOC682902
similar to Transcription initiation factor TFIID subunit 12 (Transcription initiation factor TFIID 20 kDa subunits) (TAFII-20) (TAFII20)
Symbol and Name status set to provisional
70820 PROVISIONAL
