Advanced Search (OLGA)

Gene: Bud23 (BUD23, rRNA methyltransferase and ribosome maturation factor) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Bud23

Name:

BUD23, rRNA methyltransferase and ribosome maturation factor

RGD ID:

1589742

Description:

Predicted to enable protein heterodimerization activity and rRNA (guanine) methyltransferase activity. Predicted to be involved in positive regulation of rRNA processing and rRNA (guanine-N7)-methylation. Predicted to be located in nucleoplasm and perinuclear region of cytoplasm. Predicted to be active in nucleolus. Human ortholog(s) of this gene implicated in Williams-Beuren syndrome. Orthologous to human BUD23 (BUD23 rRNA methyltransferase and ribosome maturation factor); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC360830; LOC368084; probable 18S rRNA (guanine-N(7))-methyltransferase; similar to Putative methyltransferase WBSCR22 (Williams-Beuren syndrome chromosome region 22 protein homolog); similar to Williams-Beuren syndrome critical region protein 22; Wbscr22; Williams Beuren syndrome chromosome region 22

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,266,093 - 27,277,300 (+)	NCBI		GRCr8
mRatBN7.2	12	21,629,551 - 21,640,758 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,629,536 - 21,640,751 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	22,769,812 - 22,781,449 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	23,382,129 - 23,393,766 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	22,450,784 - 22,461,993 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	24,669,626 - 24,680,833 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	24,669,449 - 24,680,818 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	26,669,896 - 26,681,103 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	22,724,688 - 22,735,895 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	12	23,392,836 - 23,404,043 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bud23	Rat	autism spectrum disorder		ISO	BUD23 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism spectrum disorder	ClinVar	PMID:21658581 more ...
Bud23	Rat	autistic disorder		ISO	BUD23 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311
Bud23	Rat	intestinal volvulus		ISO	BUD23 (Homo sapiens)	8554872	ClinVar Annotator: match by term: INTESTINAL MALROTATION and FAMILIAL	ClinVar	PMID:25741868
Bud23	Rat	Neurodevelopmental Disorders		ISO	BUD23 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Bud23	Rat	pleomorphic xanthoastrocytoma		ISO	BUD23 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pleomorphic xanthoastrocytoma	ClinVar	PMID:28299358
Bud23	Rat	schizophrenia		ISO	BUD23 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311
Bud23	Rat	Volvulus Of Midgut		ISO	BUD23 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Volvulus of midgut	ClinVar	PMID:25741868
Bud23	Rat	Williams-Beuren syndrome		ISO	BUD23 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Williams syndrome	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bud23	Rat	1,2-dichloroethane	increases expression	ISO	Bud23 (Mus musculus)	6480464	ethylene dichloride results in increased expression of WBSCR22 mRNA	CTD	PMID:28960355
Bud23	Rat	17alpha-ethynylestradiol	affects expression	ISO	Bud23 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of BUD23 mRNA	CTD	PMID:17555576
Bud23	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Bud23 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of BUD23 mRNA	CTD	PMID:21570461
Bud23	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of BUD23 mRNA	CTD	PMID:33387578
Bud23	Rat	3,4-methylenedioxymethamphetamine	decreases expression	ISO	Bud23 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of BUD23 mRNA	CTD	PMID:20188158
Bud23	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Bud23 (Mus musculus)	6480464	bisphenol S results in increased expression of BUD23 mRNA	CTD	PMID:39298647
Bud23	Rat	5-aza-2'-deoxycytidine	multiple interactions	ISO	BUD23 (Homo sapiens)	6480464	IL6 protein inhibits the reaction [Decitabine results in decreased expression of BUD23 mRNA]	CTD	PMID:17621267
Bud23	Rat	5-aza-2'-deoxycytidine	decreases expression	ISO	BUD23 (Homo sapiens)	6480464	Decitabine results in decreased expression of BUD23 mRNA	CTD	PMID:17621267
Bud23	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of WBSCR22 mRNA	CTD	PMID:30047161
Bud23	Rat	aflatoxin B1	increases methylation	ISO	BUD23 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of BUD23 gene and Aflatoxin B1 results in increased methylation of BUD23 intron	CTD	PMID:27153756 and PMID:30157460
Bud23	Rat	all-trans-retinoic acid	decreases expression	ISO	BUD23 (Homo sapiens)	6480464	Tretinoin results in decreased expression of WBSCR22 mRNA	CTD	PMID:33167477
Bud23	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of WBSCR22 mRNA	CTD	PMID:30047161
Bud23	Rat	antirheumatic drug	decreases expression	ISO	BUD23 (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of BUD23 mRNA	CTD	PMID:24449571
Bud23	Rat	aristolochic acid A	increases expression	ISO	BUD23 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of BUD23 mRNA	CTD	PMID:33212167
Bud23	Rat	arsane	multiple interactions	ISO	BUD23 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BUD23 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of BUD23 mRNA	CTD	PMID:39836092
Bud23	Rat	arsenic atom	multiple interactions	ISO	BUD23 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BUD23 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of BUD23 mRNA	CTD	PMID:39836092
Bud23	Rat	arsenite(3-)	multiple interactions	ISO	BUD23 (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to BUD23 mRNA]	CTD	PMID:32406909
Bud23	Rat	atrazine	decreases expression	ISO	BUD23 (Homo sapiens)	6480464	Atrazine results in decreased expression of BUD23 mRNA	CTD	PMID:22378314
Bud23	Rat	benzo[a]pyrene	increases expression	ISO	Bud23 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of BUD23 mRNA	CTD	PMID:22228805
Bud23	Rat	benzo[e]pyrene	increases methylation	ISO	BUD23 (Homo sapiens)	6480464	benzo(e)pyrene results in increased methylation of BUD23 intron	CTD	PMID:30157460
Bud23	Rat	beta-lapachone	increases expression	ISO	BUD23 (Homo sapiens)	6480464	beta-lapachone results in increased expression of BUD23 mRNA	CTD	PMID:38218311
Bud23	Rat	bisphenol A	decreases expression	ISO	BUD23 (Homo sapiens)	6480464	bisphenol A results in decreased expression of BUD23 mRNA	CTD	PMID:29275510
Bud23	Rat	bisphenol A	decreases methylation	ISO	Bud23 (Mus musculus)	6480464	bisphenol A results in decreased methylation of BUD23 promoter	CTD	PMID:27312807
Bud23	Rat	cobalt dichloride	decreases expression	ISO	BUD23 (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of BUD23 mRNA	CTD	PMID:19376846
Bud23	Rat	copper(II) sulfate	increases expression	ISO	BUD23 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of BUD23 mRNA	CTD	PMID:19549813
Bud23	Rat	corosolic acid	decreases expression	ISO	BUD23 (Homo sapiens)	6480464	corosolic acid results in decreased expression of BUD23 mRNA	CTD	PMID:37939859
Bud23	Rat	cyclosporin A	increases expression	ISO	BUD23 (Homo sapiens)	6480464	Cyclosporine results in increased expression of BUD23 mRNA	CTD	PMID:20106945 and PMID:25562108
Bud23	Rat	diazinon	increases methylation	ISO	BUD23 (Homo sapiens)	6480464	Diazinon results in increased methylation of BUD23 gene	CTD	PMID:22964155
Bud23	Rat	diethylstilbestrol	decreases expression	ISO	BUD23 (Homo sapiens)	6480464	Diethylstilbestrol results in decreased expression of BUD23 mRNA	CTD	PMID:36621641
Bud23	Rat	ethanol	multiple interactions	ISO	BUD23 (Homo sapiens)	6480464	[[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of BUD23 mRNA	CTD	PMID:29432896
Bud23	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of BUD23 mRNA	CTD	PMID:22061828
Bud23	Rat	glyphosate	increases methylation	EXP		6480464	Glyphosate results in increased methylation of BUD23 gene	CTD	PMID:31011160
Bud23	Rat	hydrogen peroxide	affects expression	ISO	BUD23 (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of BUD23 mRNA	CTD	PMID:20044591 and PMID:21179406
Bud23	Rat	manganese atom	multiple interactions	ISO	BUD23 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BUD23 mRNA	CTD	PMID:39836092
Bud23	Rat	manganese(0)	multiple interactions	ISO	BUD23 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BUD23 mRNA	CTD	PMID:39836092
Bud23	Rat	manganese(II) chloride	multiple interactions	ISO	BUD23 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BUD23 mRNA	CTD	PMID:39836092
Bud23	Rat	methapyrilene	increases methylation	ISO	BUD23 (Homo sapiens)	6480464	Methapyrilene results in increased methylation of BUD23 intron	CTD	PMID:30157460
Bud23	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of WBSCR22 mRNA	CTD	PMID:30047161
Bud23	Rat	paracetamol	increases expression	ISO	BUD23 (Homo sapiens)	6480464	Acetaminophen results in increased expression of BUD23 mRNA	CTD	PMID:29067470
Bud23	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of WBSCR22 mRNA	CTD	PMID:32680482
Bud23	Rat	pirinixic acid	increases expression	ISO	Bud23 (Mus musculus)	6480464	pirinixic acid results in increased expression of BUD23 mRNA	CTD	PMID:23811191
Bud23	Rat	sodium arsenite	multiple interactions	ISO	BUD23 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BUD23 mRNA more ...	CTD	PMID:33939924 and PMID:39836092
Bud23	Rat	sodium dichromate	increases expression	EXP		6480464	sodium bichromate results in increased expression of BUD23 mRNA	CTD	PMID:25993096
Bud23	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of WBSCR22 mRNA	CTD	PMID:30047161
Bud23	Rat	T-2 toxin	increases expression	ISO	BUD23 (Homo sapiens)	6480464	T-2 Toxin results in increased expression of BUD23 mRNA	CTD	PMID:31863870
Bud23	Rat	tert-butyl hydroperoxide	decreases expression	ISO	BUD23 (Homo sapiens)	6480464	tert-Butylhydroperoxide results in decreased expression of BUD23 mRNA	CTD	PMID:15336504
Bud23	Rat	tetrachloroethene	decreases expression	ISO	Bud23 (Mus musculus)	6480464	Tetrachloroethylene results in decreased expression of BUD23 mRNA	CTD	PMID:28973375
Bud23	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of BUD23 mRNA	CTD	PMID:23411599 and PMID:34492290
Bud23	Rat	thiram	increases expression	ISO	BUD23 (Homo sapiens)	6480464	Thiram results in increased expression of BUD23 mRNA	CTD	PMID:38568856
Bud23	Rat	titanium dioxide	decreases methylation	ISO	Bud23 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of WBSCR22 gene	CTD	PMID:35295148
Bud23	Rat	triptonide	increases expression	ISO	Bud23 (Mus musculus)	6480464	triptonide results in increased expression of BUD23 mRNA	CTD	PMID:33045310
Bud23	Rat	valproic acid	affects expression	ISO	Bud23 (Mus musculus)	6480464	Valproic Acid affects the expression of BUD23 mRNA	CTD	PMID:17292431
Bud23	Rat	valproic acid	increases expression	ISO	BUD23 (Homo sapiens)	6480464	Valproic Acid results in increased expression of BUD23 mRNA	CTD	PMID:23179753

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bud23	Rat	methylation	involved_in	IEA	UniProtKB-KW:KW-0489	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bud23	Rat	positive regulation of rRNA processing	involved_in	ISO	BUD23 (Homo sapiens)	1624291	PMID:25851604	RGD	PMID:25851604
Bud23	Rat	positive regulation of rRNA processing	involved_in	IEA	UniProtKB:O43709 and ensembl:ENSP00000265758	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bud23	Rat	rRNA (guanine-N7)-methylation	involved_in	ISO	BUD23 (Homo sapiens)	1624291	PMID:25851604	RGD	PMID:25851604
Bud23	Rat	rRNA (guanine-N7)-methylation	involved_in	IEA	UniProtKB:O43709 and ensembl:ENSP00000265758	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bud23	Rat	rRNA (guanine-N7)-methylation	involved_in	IBA	PANTHER:PTN000296553 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bud23	Rat	rRNA (guanine-N7)-methylation	involved_in	IEA	InterPro:IPR022238 and InterPro:IPR039769	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bud23	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bud23	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Bud23	Rat	nucleolus	located_in	ISO	BUD23 (Homo sapiens) and UniProtKB:O43709-1	1624291		RGD	GO_REF:0000052
Bud23	Rat	nucleolus	located_in	IEA	UniProtKB:O43709 and ensembl:ENSP00000265758	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bud23	Rat	nucleolus	is_active_in	IBA	PANTHER:PTN000296553 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bud23	Rat	nucleoplasm	located_in	ISO	BUD23 (Homo sapiens)	1624291	PMID:25851604	RGD	PMID:25851604
Bud23	Rat	nucleoplasm	located_in	IEA	UniProtKB:O43709 and ensembl:ENSP00000265758	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bud23	Rat	nucleoplasm	located_in	ISO	BUD23 (Homo sapiens) and UniProtKB:O43709-1	1624291		RGD	GO_REF:0000052
Bud23	Rat	nucleus	located_in	ISO	BUD23 (Homo sapiens)	1624291	PMID:34948388	RGD	PMID:34948388
Bud23	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Bud23	Rat	nucleus	located_in	IEA	UniProtKB:O43709 and ensembl:ENSP00000265758	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bud23	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bud23	Rat	perinuclear region of cytoplasm	located_in	ISO	BUD23 (Homo sapiens)	1624291	PMID:25851604	RGD	PMID:25851604
Bud23	Rat	perinuclear region of cytoplasm	located_in	IEA	UniProtKB:O43709 and ensembl:ENSP00000265758	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bud23	Rat	methyltransferase activity	enables	IEA	UniProtKB-KW:KW-0489	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bud23	Rat	protein binding	enables	ISO	BUD23 (Homo sapiens)	1624291	UniProtKB:Q9UI30 more ...	RGD	PMID:25851604 more ...
Bud23	Rat	protein heterodimerization activity	enables	ISO	BUD23 (Homo sapiens)	1624291	PMID:25851604	RGD	PMID:25851604
Bud23	Rat	protein heterodimerization activity	enables	IEA	UniProtKB:O43709 and ensembl:ENSP00000265758	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bud23	Rat	rRNA (guanine) methyltransferase activity	enables	ISO	BUD23 (Homo sapiens)	1624291	PMID:25851604	RGD	PMID:25851604
Bud23	Rat	rRNA (guanine) methyltransferase activity	enables	IEA	UniProtKB:O43709 and ensembl:ENSP00000265758	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bud23	Rat	rRNA (guanine) methyltransferase activity	enables	IBA	PANTHER:PTN000296553 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bud23	Rat	rRNA (guanine) methyltransferase activity	enables	IEA	InterPro:IPR022238 and InterPro:IPR039769	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Bud23	Rat	S-adenosylmethionine-dependent methyltransferase activity	enables	IEA	InterPro:IPR013216	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Bud23	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:22681889	PMID:25851604

Bud23
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,266,093 - 27,277,300 (+)	NCBI		GRCr8
mRatBN7.2	12	21,629,551 - 21,640,758 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,629,536 - 21,640,751 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	22,769,812 - 22,781,449 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	23,382,129 - 23,393,766 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	22,450,784 - 22,461,993 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	24,669,626 - 24,680,833 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	24,669,449 - 24,680,818 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	26,669,896 - 26,681,103 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	22,724,688 - 22,735,895 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	12	23,392,836 - 23,404,043 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

BUD23
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	73,683,597 - 73,698,212 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	73,683,597 - 73,698,212 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	73,097,927 - 73,112,542 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	72,735,834 - 72,750,478 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	72,542,548 - 72,557,192	NCBI
Celera	7	68,576,112 - 68,590,746 (+)	NCBI		Celera
Cytogenetic Map	7	q11.23	NCBI
HuRef	7	68,980,309 - 68,994,966 (+)	NCBI		HuRef
CHM1_1	7	73,243,634 - 73,258,288 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	74,884,512 - 74,899,128 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	72,430,970 - 72,445,623 (+)	NCBI

Bud23
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	135,081,811 - 135,093,813 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	135,081,811 - 135,093,813 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	135,052,957 - 135,064,959 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	135,052,957 - 135,064,959 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	135,528,827 - 135,539,980 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	135,337,586 - 135,349,586 (-)	NCBI		MGSCv36	mm8
Celera	5	132,063,286 - 132,074,439 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	74.97	NCBI

Bud23
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	14,047,409 - 14,057,939 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955456	14,047,409 - 14,057,483 (-)	NCBI	ChiLan1.0	ChiLan1.0

BUD23
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	91,201,923 - 91,216,615 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	139,466,554 - 139,481,234 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	7	80,836,518 - 80,851,501 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	80,836,518 - 80,851,497 (+)	Ensembl	panpan1.1		panPan2

BUD23
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	6,583,612 - 6,596,538 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	6,583,616 - 6,595,281 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	8,281,013 - 8,293,928 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	6,398,642 - 6,411,560 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	6,398,641 - 6,410,307 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	6,388,142 - 6,401,056 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	6,335,879 - 6,348,795 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	6,499,592 - 6,512,508 (-)	NCBI		UU_Cfam_GSD_1.0

Bud23
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	131,127,809 - 131,138,719 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	2,897,432 - 2,908,802 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	2,897,884 - 2,908,758 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BUD23
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	10,960,069 - 10,973,081 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	10,960,037 - 10,973,084 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	10,656,154 - 10,669,253 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BUD23
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	9,368,950 - 9,382,951 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	9,368,726 - 9,382,925 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666070	7,119,984 - 7,134,024 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bud23
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	14,120,798 - 14,131,933 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	14,120,798 - 14,131,490 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Bud23
134 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	64
Count of miRNA genes:	49
Interacting mature miRNAs:	60
Transcripts:	ENSRNOT00000044449
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	8525423	28064601	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	23297788	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
10755457	Coatc14	Coat color QTL 14		0.01759	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	12	1	22591684	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	28064557	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	19610870	24139202	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	1	29333307	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	11073825	24234895	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	13635523	30827399	Rat
631521	Pia12	Pristane induced arthritis QTL 12	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	20259417	23672083	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	8449490	28302290	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

RH134623

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,640,432 - 21,640,618 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	24,680,508 - 24,680,693	NCBI	Rnor6.0
Rnor_5.0	12	26,680,778 - 26,680,963	UniSTS	Rnor5.0
RGSC_v3.4	12	22,735,570 - 22,735,755	UniSTS	RGSC3.4
Celera	12	23,403,718 - 23,403,903	UniSTS
RH 3.4 Map	12	327.5	UniSTS
Cytogenetic Map	12	q12	UniSTS

RH138619

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,628,352 - 21,628,480 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	24,668,428 - 24,668,555	NCBI	Rnor6.0
Rnor_5.0	12	26,668,698 - 26,668,825	UniSTS	Rnor5.0
RGSC_v3.4	12	22,723,490 - 22,723,617	UniSTS	RGSC3.4
Celera	12	23,391,638 - 23,391,765	UniSTS
RH 3.4 Map	12	308.8	UniSTS
Cytogenetic Map	12	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001135743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC091752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC160891	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000044449 ⟹ ENSRNOP00000047461

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	21,629,536 - 21,640,751 (+)	Ensembl
Rnor_6.0 Ensembl	12	24,669,449 - 24,680,818 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114014 ⟹ ENSRNOP00000090542

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	21,629,536 - 21,640,751 (+)	Ensembl

RefSeq Acc Id:

NM_001135743 ⟹ NP_001129215

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	27,266,093 - 27,277,300 (+)	NCBI
mRatBN7.2	12	21,629,551 - 21,640,758 (+)	NCBI
Rnor_6.0	12	24,669,626 - 24,680,833 (+)	NCBI
Rnor_5.0	12	26,669,896 - 26,681,103 (+)	NCBI
RGSC_v3.4	12	22,724,688 - 22,735,895 (+)	RGD
Celera	12	23,392,836 - 23,404,043 (+)	RGD

Sequence:

show sequence

AGCGTGTTGCCATCCCTTAGAGATGGCATCTCGTAGCCGGAGACCAGAACACAGCGGACCGCCAGAGCTGTTTTATGACCAGAATGAAGCCCGGAAATACGTTCGCAACTCACGGATGATTGACATCC
AGACCAAGATGACTGAGCGAGCACTGGAGCTCCTCTGTTTGCCAGAGGGCCAGCCTTCTTATCTGTTAGACATCGGCTGTGGTTCTGGACTGAGTGGAGACTATATCTCAGAAGAGGGGCACTACTGG
GTGGGCATTGACATCAGCCCTGCCATGTTGGACGCCGCCTTGGACCGCGACACAGAGGGAGACCTACTACTAGGGGACATGGGCCAGGGAGTCCCTTTCAGACCGGGTTCTTTTGATGGCTGCATCAG
CATCTCTGCGGTGCAGTGGCTCTGCAACGCAAACAAGAAGTCGGACATCCCTGCCAGGCGCCTCTACTGCTTCTTTTCTTCTCTGTACTCTGCCCTCGTCCGTGGGGCCCGAGCTGTCCTGCAGCTGT
ACCCCGAGAACTCGGAGCAGCTGGAGCTGATCACAACCCAGGCCACGAGAGCAGGCTTCACTGGCGGTGTGGTGGTGGACTTCCCCAACAGTGCCAAAGCAAAGAAGTTCTACCTCTGTCTGTTTTCT
GGGCCTTCCACCTCCCTGCCAAAGGGGCTGACTGAAAGTCAGGAAGCAGACCAGGCCTCCGAGTCCGCTTTCACCAGTGAACGGGCTCCACACAAGAAGGCCCGGAGAGACCTGGTGAAGAAGAGCCG
GGAGTGGGTCCTAGAGAAGAAGGAGAGGCGCAGGCGCCAGGGCAAGGAGGTCAGACCTGACACGCAGTACACCGGCCGCAAGCGCAAGCCCCGCTTCTGAGGGAGCCACATCTGATCAGCCGGAGAGC
CTGGCCACCCACACACATCCAGTCTGCAGATGCAGACGGTCCTGCCACCCACTCTGCTCAGAGTGGGCGCTATCCAACCCAGGACCTGCCTCAGGAATTTTCTGGATTGAACTGTTTACCTCAGCAGC
TAGCAACATAGTATTTTAGAAGAGTTGGGACGCTCTCAAAATATTTCTTCACTAAGAGTTGCAGGGATCTGGGTTTGGCAGCTCACATCCTATAATCGCAACACCCTCCCGGGAGTCTGAGACAAGAA
GTTGGAAAGTTCCAGGCCTGTCTGGGCTACACAGCAAAAACCTGTCTTAAAAACCAAAAGGAAAAACATTTCTAAGAATGTTTTATTTTGTCCTAAATGCATTAAATTACTTTCTAAGTAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001129215	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI60891	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000047461
	ENSRNOP00000047461.3
	ENSRNOP00000090542.1

RefSeq Acc Id:

NP_001129215 ⟸ NM_001135743

- UniProtKB:

B1H275 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASRSRRPEHSGPPELFYDQNEARKYVRNSRMIDIQTKMTERALELLCLPEGQPSYLLDIGCGSGLSGDYISEEGHYWVGIDISPAMLDAALDRDTEGDLLLGDMGQGVPFRPGSFDGCISISAVQWL
CNANKKSDIPARRLYCFFSSLYSALVRGARAVLQLYPENSEQLELITTQATRAGFTGGVVVDFPNSAKAKKFYLCLFSGPSTSLPKGLTESQEADQASESAFTSERAPHKKARRDLVKKSREWVLEKK
ERRRRQGKEVRPDTQYTGRKRKPRF

hide sequence

Ensembl Acc Id:

ENSRNOP00000047461 ⟸ ENSRNOT00000044449

Ensembl Acc Id:

ENSRNOP00000090542 ⟸ ENSRNOT00000114014

Protein Domains

18S rRNA (guanine(1575)-N(7))-methyltransferase Methyltransferase type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1H275-F1-model_v2	AlphaFold	B1H275	1-281	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13698561

Promoter ID:

EPDNEW_R9086

Type:

multiple initiation site

Name:

Bud23_1

Description:

BUD23, rRNA methyltransferase and ribosome maturation factor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	24,669,620 - 24,669,680	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-19604	BioCyc
Ensembl Genes	ENSRNOG00000033700	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000044449	ENTREZGENE
	ENSRNOT00000044449.6	UniProtKB/TrEMBL
	ENSRNOT00000114014.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.150	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7442902	IMAGE-MGC_LOAD
InterPro	Bud23-like	UniProtKB/TrEMBL
	Methyltransf_11	UniProtKB/TrEMBL
	SAM-dependent_MTases-like	UniProtKB/TrEMBL
	Unchr_MeTrfase_Williams-Beuren	UniProtKB/TrEMBL
KEGG Report	rno:368084	UniProtKB/TrEMBL
MGC_CLONE	MGC:188319	IMAGE-MGC_LOAD
NCBI Gene	368084	ENTREZGENE
PANTHER	18S RRNA (GUANINE-N(7))-METHYLTRANSFERASE-RELATED	UniProtKB/TrEMBL
	PTHR12734	UniProtKB/TrEMBL
Pfam	Methyltransf_11	UniProtKB/TrEMBL
	WBS_methylT	UniProtKB/TrEMBL
PhenoGen	Bud23	PhenoGen
RatGTEx	ENSRNOG00000033700	RatGTEx
Superfamily-SCOP	SSF53335	UniProtKB/TrEMBL
UniProt	A0A8I6GIY8_RAT	UniProtKB/TrEMBL
	B1H275	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-07	Bud23	BUD23, rRNA methyltransferase and ribosome maturation factor	Wbscr22	Williams Beuren syndrome chromosome region 22	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-05-24	Wbscr22	Williams Beuren syndrome chromosome region 22	LOC360830		Data merged from RGD:1597085	1643240	APPROVED
2008-10-13	LOC360830		LOC368084	similar to Putative methyltransferase WBSCR22 (Williams-Beuren syndrome chromosome region 22 protein homolog)	Symbol and Name updated	1299863	PROVISIONAL
2008-03-05	Wbscr22	Williams Beuren syndrome chromosome region 22	LOC360830	similar to Williams-Beuren syndrome critical region protein 22	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC368084	similar to Putative methyltransferase WBSCR22 (Williams-Beuren syndrome chromosome region 22 protein homolog)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC360830	similar to Williams-Beuren syndrome critical region protein 22			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar