Ndufa4 (Ndufa4, mitochondrial complex associated)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ndufa4 (Ndufa4, mitochondrial complex associated) Rattus norvegicus

Analyze

Symbol:

Ndufa4

Name:

Ndufa4, mitochondrial complex associated

RGD ID:

1584719

Description:

Predicted to be involved in positive regulation of cytochrome-c oxidase activity. Part of mitochondrial respiratory chain complex I and mitochondrial respiratory chain complex IV. Human ortholog(s) of this gene implicated in cytochrome-c oxidase deficiency disease. Orthologous to human NDUFA4 (NDUFA4 mitochondrial complex associated); PARTICIPATES IN Alzheimer's disease pathway; Huntington's disease pathway; oxidative phosphorylation pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2-amino-2-deoxy-D-glucopyranose.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cytochrome c oxidase subunit NDUFA4; LOC681024; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4; NADH:ubiquinone oxidoreductase subunit A4; similar to NADH-ubiquinone oxidoreductase MLRQ subunit (Complex I-MLRQ) (CI-MLRQ)

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Candidate Gene For:

Gluco61 Niddm71

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	40,002,216 - 40,009,384 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	40,002,216 - 40,023,920 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	44,975,238 - 44,982,402 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	40,901,442 - 40,908,606 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	39,304,957 - 39,312,121 (-)	NCBI	Rnor_WKY
Rnor_6.0	4	38,233,680 - 38,240,848 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	38,233,680 - 38,240,848 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	38,070,978 - 38,078,251 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	37,125,782 - 37,133,055 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	35,414,376 - 35,421,532 (-)	NCBI		Celera
Cytogenetic Map	4	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Mitochondrial Complex IV Deficiency, Nuclear Type 21 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-amino-2-deoxy-D-glucopyranose (EXP)

3-chloropropane-1,2-diol (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucosamine (EXP)

all-trans-retinoic acid (ISO)

apigenin (EXP)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

azoxystrobin (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

beta-D-glucosamine (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

cisplatin (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

dioxygen (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

folic acid (ISO)

gentamycin (EXP)

isoniazide (ISO)

ivermectin (ISO)

lamivudine (ISO)

lipopolysaccharide (ISO)

paracetamol (ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (EXP)

picoxystrobin (ISO)

quercetin (ISO)

resveratrol (ISO)

rotenone (ISO)

selenium atom (ISO)

sodium arsenite (EXP,ISO)

sodium fluoride (ISO)

tetrachloromethane (EXP)

thapsigargin (ISO)

thioacetamide (EXP)

toluene (EXP)

tributylstannane (EXP)

Tributyltin oxide (ISO)

triptonide (ISO)

tungsten (ISO)

tunicamycin (ISO)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of cytochrome-c oxidase activity (ISO)

Cellular Component

mitochondrial respiratory chain complex I (IDA,ISO)

mitochondrial respiratory chain complex IV (IBA,IDA,ISO)

mitochondrion (ISO)

Molecular Function

protein binding (ISO)

protein-containing complex binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Alzheimer's disease pathway (IEA)

Huntington's disease pathway (IEA)

oxidative phosphorylation pathway (IEA)

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	A novel mutation in the NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 4 (Ndufa4) gene links mitochondrial dysfunction to the development of diabetes in a rodent model.	Yagil C, etal., Dis Model Mech. 2018 Nov 20;11(11). pii: dmm.036699. doi: 10.1242/dmm.036699.

Additional References at PubMed

PMID:12477932	PMID:12611891	PMID:12865426	PMID:14651853	PMID:16729965	PMID:18614015	PMID:20530722	PMID:22902835	PMID:23209302	PMID:23376485	PMID:30030519	PMID:31536960
PMID:33994501

Genomics

Comparative Map Data

Ndufa4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	40,002,216 - 40,009,384 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	40,002,216 - 40,023,920 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	44,975,238 - 44,982,402 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	40,901,442 - 40,908,606 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	39,304,957 - 39,312,121 (-)	NCBI	Rnor_WKY
Rnor_6.0	4	38,233,680 - 38,240,848 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	38,233,680 - 38,240,848 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	38,070,978 - 38,078,251 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	37,125,782 - 37,133,055 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	35,414,376 - 35,421,532 (-)	NCBI		Celera
Cytogenetic Map	4	q21	NCBI

NDUFA4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	10,931,943 - 10,940,153 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	7	10,931,943 - 10,940,153 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	10,971,570 - 10,979,780 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	10,939,340 - 10,946,338 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	10,746,054 - 10,753,053	NCBI
Celera	7	10,947,593 - 10,954,592 (-)	NCBI		Celera
Cytogenetic Map	7	p21.3	NCBI
HuRef	7	10,829,724 - 10,838,039 (-)	NCBI		HuRef
CHM1_1	7	10,972,141 - 10,980,374 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	11,062,535 - 11,070,743 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	11,025,124 - 11,033,358 (-)	NCBI

Ndufa4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	11,900,371 - 11,907,449 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	11,900,291 - 11,907,496 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	11,900,372 - 11,907,450 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	11,900,292 - 11,907,497 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	11,850,373 - 11,857,446 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	11,850,373 - 11,857,446 (-)	NCBI		MGSCv36	mm8
Celera	6	11,992,912 - 11,999,985 (-)	NCBI		Celera
Cytogenetic Map	6	A1	NCBI

Ndufa4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955432	17,502,272 - 17,509,517 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955432	17,502,272 - 17,509,517 (-)	NCBI	ChiLan1.0	ChiLan1.0

NDUFA4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	7	64,085,666 - 64,092,390 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	11,585,054 - 11,591,775 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	10,932,727 - 10,939,949 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

NDUFA4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	25,887,204 - 25,893,746 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	25,468,815 - 25,475,355 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	25,696,535 - 25,703,079 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	14	25,864,709 - 25,871,252 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	25,594,037 - 25,600,585 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	25,847,856 - 25,854,404 (-)	NCBI		UU_Cfam_GSD_1.0

Ndufa4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	39,433,348 - 39,440,232 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936761	554,028 - 560,901 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936761	554,025 - 560,913 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NDUFA4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	80,636,929 - 80,644,315 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	80,637,005 - 80,644,067 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	88,555,979 - 88,563,046 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NDUFA4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	47,245,396 - 47,252,145 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	47,245,170 - 47,252,730 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	57,188,514 - 57,195,774 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ndufa4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624827	8,366,027 - 8,375,881 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624827	8,366,597 - 8,373,881 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ndufa4
38 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	252
Count of miRNA genes:	166
Interacting mature miRNAs:	190
Transcripts:	ENSRNOT00000007567
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634323	Hc2	Hypercalciuria QTL 2	2.15		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	4	210796	45210796	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	57114705	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5219178	56647776	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	9940885	44463908	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	10084089	55084089	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	10084089	55084089	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	10084089	55084089	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	10084089	55084089	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	10084089	55084089	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	10084089	55084089	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	14678065	59678065	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	17933508	62933508	Rat
1354665	Stl10	Serum triglyceride level QTL 10	3.57		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21333343	44463908	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	21333343	62278020	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
11530004	Niddm71	Non-insulin dependent diabetes mellitus QTL 71		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	4	32584199	52754138	Rat
8655949	Rf62	Renal function QTL 62	22		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	4	34430119	44463908	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
4889511	Gluco61	Glucose level QTL 61	4.7	0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	4	37177950	40869000	Rat
2290374	Gluco32	Glucose level QTL 32	6.27		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	4	37177950	44463908	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	39505275	73892441	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	39524264	74726312	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat

Markers in Region

RH127505

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	1,120,397 - 1,120,573 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	1,279,266 - 1,279,441	NCBI	Rnor6.0
Rnor_5.0	18	1,321,700 - 1,321,875	UniSTS	Rnor5.0
RGSC_v3.4	18	1,396,306 - 1,396,481	UniSTS	RGSC3.4
Celera	18	1,006,194 - 1,006,369	UniSTS
RH 3.4 Map	18	32.2	UniSTS
Cytogenetic Map	18	p13	UniSTS
Cytogenetic Map	4	q21	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High		4
Medium	3	39	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001127684	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC167115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM055502	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM088467	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210865	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223554	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224471	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224731	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000141	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000007567 ⟹ ENSRNOP00000007567

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	40,002,216 - 40,008,418 (-)	Ensembl
Rnor_6.0 Ensembl	4	38,233,680 - 38,240,848 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000108269 ⟹ ENSRNOP00000093714

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	40,005,645 - 40,023,920 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112879 ⟹ ENSRNOP00000096418

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	40,002,392 - 40,023,920 (-)	Ensembl

RefSeq Acc Id:

NM_001127684 ⟹ NP_001121156

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	40,002,216 - 40,009,384 (-)	NCBI
Rnor_6.0	4	38,233,680 - 38,240,848 (-)	NCBI
Rnor_5.0	4	38,070,978 - 38,078,251 (-)	NCBI
RGSC_v3.4	4	37,125,782 - 37,133,055 (-)	RGD
Celera	4	35,414,376 - 35,421,532 (-)	NCBI

Sequence:

show sequence

GGGGTCCTTCAGGTAGGAGGTCCTGGGTGACTTTGGACGTCCGCTCAGCCAGGTTGCAGAAGCG
GTTTAGTGTGTGTCCTAATCTTCTCTCTCGGTGTAGGTAGGCCTGTGCCGCAAACATGCTCCGC
CAGATCCTCGGGCAAGCCAAGAAACATCCCAGCTTGATCCCTCTCTTCGTGTTTATTGGAGCAG
GGGGTACTGGAGCAGCACTGTATGTGATGCGCTTGGCATTGTTCAATCCAGATGTCAGCTGGGA
CAGGAAGAATAACCCAGAGCCTTGGAACAAACTGGGTCCCAATGAACAATATAAGTTCTATTCT
GTGAACGTGGACTACAGCAAACTGAAAAAAGAAGGCCCAGACTTCTAAACTGTGAAGTTCACTG
CAAAGCTGCTTACAATGAAGGTCTTTCAGAAGCCATCCGCACAATTTTCCACTTAAGCAGGAAC
TATGTCTCCGAATGCATGAAATCATGTTGATTTTTTTTTTTGAGTTTATTACACTGATGAATAA
ATCTCTGAAACTTGATATGTGTCACTATTTAATGCTGAAAATTCATATGGGATTTGATAGCTAG
GATATAAGAAATAAAGTATCAGGATTTAAAGAATCTCTTGAATTTCTCTTTATACATTTGAAAG
TGAGACCTATGCTGCTTTAATAAGGGTGTGTGTGTATGTGTATATAGGCCCACACTTGATAACT
TCAAACTGGAAATTAAAGGGCTTCTGGGAAGAATATTCACGTCTTTGTCAAATGAACACAATAG
AAAGCTCTGGATTTCTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001121156	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI67115	(Get FASTA)	NCBI Sequence Viewer
	EDM15076	(Get FASTA)	NCBI Sequence Viewer
	EDM15077	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001121156 ⟸ NM_001127684
- UniProtKB:	B2RZD6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLRQILGQAKKHPSLIPLFVFIGAGGTGAALYVMRLALFNPDVSWDRKNNPEPWNKLGPNEQYK FYSVNVDYSKLKKEGPDF hide sequence

RefSeq Acc Id:

ENSRNOP00000007567 ⟸ ENSRNOT00000007567

RefSeq Acc Id:

ENSRNOP00000093714 ⟸ ENSRNOT00000108269

RefSeq Acc Id:

ENSRNOP00000096418 ⟸ ENSRNOT00000112879

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RZD6-F1-model_v2	AlphaFold	B2RZD6	1-82	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692878

Promoter ID:

EPDNEW_R3403

Type:

initiation region

Name:

Ndufa4_1

Description:

NDUFA4, mitochondrial complex associated

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	38,240,814 - 38,240,874	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1584719	AgrOrtholog
BioCyc Gene	G2FUF-45634	BioCyc
BioCyc Pathway	PWY-3781 [aerobic respiration I (cytochrome c)]	BioCyc
	PWY-7279 [aerobic respiration II (cytochrome c) (yeast)]	BioCyc
Ensembl Genes	ENSRNOG00000005512	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000007567.4	UniProtKB/TrEMBL
	ENSRNOP00000093714.1	UniProtKB/TrEMBL
	ENSRNOP00000096418	ENTREZGENE
	ENSRNOP00000096418.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000007567.5	UniProtKB/TrEMBL
	ENSRNOT00000108269.1	UniProtKB/TrEMBL
	ENSRNOT00000112879	ENTREZGENE
	ENSRNOT00000112879.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6922256	IMAGE-MGC_LOAD
InterPro	B12D	UniProtKB/TrEMBL
KEGG Report	rno:681024	UniProtKB/TrEMBL
MGC_CLONE	MGC:189583	IMAGE-MGC_LOAD
NCBI Gene	681024	ENTREZGENE
PANTHER	CYTOCHROME C OXIDASE SUBUNIT NDUFA4	UniProtKB/TrEMBL
	PTHR14256	UniProtKB/TrEMBL
Pfam	B12D	UniProtKB/TrEMBL
PhenoGen	Ndufa4	PhenoGen
UniProt	A0A8I6AXF3_RAT	UniProtKB/TrEMBL
	B2RZD6	ENTREZGENE, UniProtKB/TrEMBL
	F7FN80_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-04-28	Ndufa4	Ndufa4, mitochondrial complex associated	Ndufa4	NDUFA4, mitochondrial complex associated	Name changed	629549	APPROVED
2017-03-29	Ndufa4	NDUFA4, mitochondrial complex associated	Ndufa4	NADH:ubiquinone oxidoreductase subunit A4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-17	Ndufa4	NADH:ubiquinone oxidoreductase subunit A4	Ndufa4	NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Ndufa4	NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4	LOC681024	similar to NADH-ubiquinone oxidoreductase MLRQ subunit (Complex I-MLRQ) (CI-MLRQ)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC681024	similar to NADH-ubiquinone oxidoreductase MLRQ subunit (Complex I-MLRQ) (CI-MLRQ)	LOC679503	similar to NADH-ubiquinone oxidoreductase MLRQ subunit (Complex I-MLRQ) (CI-MLRQ)	Data Merged	1643240	APPROVED
2006-11-19	LOC681024	similar to NADH-ubiquinone oxidoreductase MLRQ subunit (Complex I-MLRQ) (CI-MLRQ)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC679503	similar to NADH-ubiquinone oxidoreductase MLRQ subunit (Complex I-MLRQ) (CI-MLRQ)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)