Symbol:
Patj
Name:
PATJ, crumbs cell polarity complex component
RGD ID:
1565362
Description:
Predicted to be involved in several processes, including establishment of apical/basal cell polarity; positive regulation of epithelial cell migration; and tight junction assembly. Part of protein-containing complex. Orthologous to human PATJ (PATJ crumbs cell polarity complex component); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; amitriptyline.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
InaD-like (Drosophila); InaD-like 2; InaD-like 2 (Drosophila); inaD-like protein; Inadl; Inadl2; LOC313382; PDZ domain protein; PDZ domain protein (Drosophila inaD-like); RGD1565362; similar to channel-interacting pdz domain protein isoform 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PATJ (PATJ crumbs cell polarity complex component) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Patj (PATJ, crumbs cell polarity complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Patj (PATJ crumbs cell polarity complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PATJ (PATJ crumbs cell polarity complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PATJ (PATJ crumbs cell polarity complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Patj (PATJ crumbs cell polarity complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PATJ (PATJ crumbs cell polarity complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PATJ (PATJ crumbs cell polarity complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Patj (PATJ crumbs cell polarity complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Patj (PATJ, crumbs cell polarity complex component)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PATJ (PATJ crumbs cell polarity complex component)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
mpz-1
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
patj
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Patj
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PANTHER|SonicParanoid)
Allele / Splice:
PatjTn(sb-T2/Bart3)2.343Mcwi
Genetic Models:
F344-PatjTn(sb-T2/Bart3)2.343Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 118,177,557 - 118,480,301 (+) NCBI GRCr8 mRatBN7.2 5 113,061,985 - 113,364,807 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 113,062,118 - 113,364,807 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 115,640,473 - 115,944,504 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 117,365,825 - 117,669,843 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 117,428,349 - 117,732,383 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 117,038,548 - 117,340,308 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 117,052,260 - 117,340,336 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 120,981,525 - 121,281,044 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 118,806,744 - 119,131,114 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 111,633,199 - 111,931,738 (+) NCBI Celera Cytogenetic Map 5 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Patj Rat (S)-nicotine decreases expression ISO Patj (Mus musculus) 6480464 Nicotine results in decreased expression of PATJ mRNA CTD PMID:21955143 Patj Rat 1,1-dichloroethene decreases expression ISO Patj (Mus musculus) 6480464 vinylidene chloride results in decreased expression of PATJ mRNA CTD PMID:26682919 Patj Rat 1,2-dichloroethane affects expression ISO Patj (Mus musculus) 6480464 ethylene dichloride affects the expression of PATJ mRNA CTD PMID:28960355 Patj Rat 1,2-dimethylhydrazine decreases expression ISO Patj (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PATJ mRNA CTD PMID:22206623 Patj Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Patj (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PATJ mRNA CTD PMID:21570461 and PMID:26377647 Patj Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Patj (Mus musculus) 6480464 [Tetrachlorodibenzodioxin affects the methylation of PATJ intron] which results in increased expression of PATJ mRNA CTD PMID:33017471 Patj Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Patj (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PATJ mRNA CTD PMID:33956508 Patj Rat 4,4'-sulfonyldiphenol increases expression ISO Patj (Mus musculus) 6480464 bisphenol S results in increased expression of PATJ mRNA CTD PMID:30951980 Patj Rat 4-hydroxyphenyl retinamide increases expression ISO Patj (Mus musculus) 6480464 Fenretinide results in increased expression of PATJ mRNA CTD PMID:28973697 Patj Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PATJ mRNA CTD PMID:24780913 Patj Rat 8-Br-cAMP increases expression ISO PATJ (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of PATJ mRNA CTD PMID:22079614 Patj Rat acrolein multiple interactions ISO PATJ (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PATJ mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PATJ mRNA CTD PMID:32699268 Patj Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PATJ mRNA CTD PMID:28959563 Patj Rat acrylamide increases expression ISO Patj (Mus musculus) 6480464 Acrylamide results in increased expression of PATJ mRNA CTD PMID:30807115 Patj Rat aflatoxin B1 affects expression ISO PATJ (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of PATJ protein CTD PMID:20106945 Patj Rat aflatoxin B1 decreases expression ISO PATJ (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PATJ mRNA CTD PMID:22100608 and PMID:27153756 Patj Rat aflatoxin B1 decreases methylation ISO PATJ (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PATJ gene and Aflatoxin B1 results in decreased methylation of PATJ intron CTD PMID:27153756 and PMID:30157460 Patj Rat Aflatoxin B2 alpha decreases methylation ISO PATJ (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of PATJ exon and aflatoxin B2 results in decreased methylation of PATJ intron CTD PMID:30157460 Patj Rat all-trans-retinoic acid increases expression ISO PATJ (Homo sapiens) 6480464 Tretinoin results in increased expression of PATJ mRNA CTD PMID:21934132 Patj Rat alpha-pinene multiple interactions ISO PATJ (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PATJ mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PATJ mRNA CTD PMID:32699268 Patj Rat amitriptyline decreases expression EXP 6480464 Amitriptyline results in decreased expression of PATJ mRNA CTD PMID:22341215 Patj Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PATJ mRNA CTD PMID:16483693 Patj Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of PATJ mRNA CTD PMID:30779732 Patj Rat Ampullosporin multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of PATJ mRNA CTD PMID:16635253 Patj Rat antirheumatic drug affects expression ISO PATJ (Homo sapiens) 6480464 Antirheumatic Agents affects the expression of PATJ mRNA CTD PMID:24449571 Patj Rat aristolochic acid A decreases expression ISO PATJ (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PATJ mRNA CTD PMID:33212167 Patj Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PATJ gene CTD PMID:28931070 Patj Rat benzene decreases expression ISO Patj (Mus musculus) 6480464 Benzene results in decreased expression of PATJ mRNA CTD PMID:15120971 and PMID:15122651 Patj Rat benzo[a]pyrene decreases expression ISO PATJ (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PATJ mRNA CTD PMID:20106945 more ... Patj Rat benzo[a]pyrene decreases methylation ISO PATJ (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PATJ promoter CTD PMID:27901495 Patj Rat benzo[a]pyrene affects methylation ISO PATJ (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PATJ 5' UTR and Benzo(a)pyrene affects the methylation of PATJ exon CTD PMID:27901495 and PMID:30157460 Patj Rat benzo[a]pyrene decreases expression ISO Patj (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PATJ mRNA CTD PMID:21715664 Patj Rat benzo[e]pyrene decreases methylation ISO PATJ (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of PATJ intron CTD PMID:30157460 Patj Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of PATJ mRNA CTD PMID:15651846 Patj Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PATJ mRNA CTD PMID:25181051 Patj Rat bisphenol A increases expression ISO Patj (Mus musculus) 6480464 bisphenol A results in increased expression of PATJ mRNA CTD PMID:32156529 Patj Rat bisphenol A multiple interactions ISO PATJ (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of PATJ gene CTD PMID:31601247 Patj Rat bisphenol A affects methylation ISO PATJ (Homo sapiens) 6480464 bisphenol A affects the methylation of PATJ gene CTD PMID:31601247 Patj Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PATJ mRNA CTD PMID:30816183 more ... Patj Rat bisphenol F increases expression ISO Patj (Mus musculus) 6480464 bisphenol F results in increased expression of PATJ mRNA CTD PMID:30951980 Patj Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of PATJ protein CTD PMID:28903499 Patj Rat butanal decreases expression ISO PATJ (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PATJ mRNA CTD PMID:26079696 Patj Rat cadmium dichloride affects expression EXP 6480464 Cadmium Chloride affects the expression of PATJ mRNA CTD PMID:22110744 Patj Rat caffeine decreases phosphorylation ISO PATJ (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PATJ protein CTD PMID:35688186 Patj Rat calcitriol increases expression ISO PATJ (Homo sapiens) 6480464 Calcitriol results in increased expression of PATJ mRNA CTD PMID:26485663 Patj Rat carbamazepine affects expression ISO PATJ (Homo sapiens) 6480464 Carbamazepine affects the expression of PATJ mRNA CTD PMID:25979313 Patj Rat carbon nanotube decreases expression ISO Patj (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Patj Rat corosolic acid increases expression ISO PATJ (Homo sapiens) 6480464 corosolic acid results in increased expression of PATJ mRNA CTD PMID:37939859 Patj Rat coumestrol decreases expression ISO PATJ (Homo sapiens) 6480464 Coumestrol results in decreased expression of PATJ mRNA CTD PMID:19167446 Patj Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PATJ mRNA CTD PMID:26577399 Patj Rat cyclosporin A decreases expression ISO Patj (Mus musculus) 6480464 Cyclosporine results in decreased expression of PATJ mRNA CTD PMID:19770486 Patj Rat dibenzo[a,l]pyrene decreases expression ISO PATJ (Homo sapiens) 6480464 dibenzo(a and l)pyrene results in decreased expression of PATJ mRNA CTD PMID:31255691 Patj Rat dorsomorphin multiple interactions ISO PATJ (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Patj Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PATJ mRNA CTD PMID:29391264 Patj Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PATJ mRNA CTD PMID:31464424 Patj Rat entinostat increases expression ISO PATJ (Homo sapiens) 6480464 entinostat results in increased expression of PATJ mRNA CTD PMID:27188386 Patj Rat ethanol increases expression ISO Patj (Mus musculus) 6480464 Ethanol results in increased expression of PATJ mRNA CTD PMID:21955143 Patj Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PATJ mRNA CTD PMID:24136188 Patj Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PATJ mRNA CTD PMID:24136188 Patj Rat formaldehyde decreases expression ISO PATJ (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PATJ mRNA CTD PMID:20655997 and PMID:23649840 Patj Rat FR900359 increases phosphorylation ISO PATJ (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PATJ protein CTD PMID:37730182 Patj Rat fulvestrant multiple interactions ISO PATJ (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of PATJ gene CTD PMID:31601247 Patj Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PATJ mRNA CTD PMID:33387578 Patj Rat ketamine multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of PATJ mRNA CTD PMID:16635253 Patj Rat mercury dibromide multiple interactions ISO PATJ (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PATJ mRNA CTD PMID:27188386 Patj Rat mercury dibromide increases expression ISO PATJ (Homo sapiens) 6480464 mercuric bromide results in increased expression of PATJ mRNA CTD PMID:26272509 Patj Rat mercury dichloride decreases expression ISO PATJ (Homo sapiens) 6480464 Mercuric Chloride results in decreased expression of PATJ mRNA CTD PMID:27188386 Patj Rat methapyrilene decreases methylation ISO PATJ (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of PATJ intron CTD PMID:30157460 Patj Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PATJ gene CTD PMID:35440735 Patj Rat morphine decreases expression ISO Patj (Mus musculus) 6480464 Morphine results in decreased expression of PATJ mRNA CTD PMID:21955143 Patj Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of PATJ mRNA CTD PMID:21515302 Patj Rat N-methyl-N-nitrosourea increases expression ISO Patj (Mus musculus) 6480464 Methylnitrosourea results in increased expression of PATJ mRNA CTD PMID:15240709 Patj Rat nicotine decreases expression ISO Patj (Mus musculus) 6480464 Nicotine results in decreased expression of PATJ mRNA CTD PMID:21955143 Patj Rat Nor-9-carboxy-delta9-THC multiple interactions ISO PATJ (Homo sapiens) 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of PATJ gene CTD PMID:30521419 Patj Rat ozone multiple interactions ISO PATJ (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PATJ mRNA more ... CTD PMID:32699268 Patj Rat panobinostat multiple interactions ISO PATJ (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PATJ mRNA CTD PMID:27188386 Patj Rat paracetamol decreases expression ISO PATJ (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PATJ mRNA CTD PMID:21420995 and PMID:29067470 Patj Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PATJ mRNA CTD PMID:33387578 Patj Rat paracetamol increases expression ISO PATJ (Homo sapiens) 6480464 Acetaminophen results in increased expression of PATJ mRNA CTD PMID:22230336 and PMID:26690555 Patj Rat pentanal decreases expression ISO PATJ (Homo sapiens) 6480464 pentanal results in decreased expression of PATJ mRNA CTD PMID:26079696 Patj Rat phenylmercury acetate multiple interactions ISO PATJ (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PATJ mRNA CTD PMID:27188386 Patj Rat phenylmercury acetate increases expression ISO PATJ (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PATJ mRNA CTD PMID:26272509 Patj Rat potassium dichromate decreases expression ISO Patj (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of PATJ mRNA CTD PMID:23608068 Patj Rat SB 431542 multiple interactions ISO PATJ (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Patj Rat silicon dioxide decreases expression ISO PATJ (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of PATJ mRNA CTD PMID:25895662 Patj Rat sodium arsenate increases expression ISO Patj (Mus musculus) 6480464 sodium arsenate results in increased expression of PATJ mRNA CTD PMID:21795629 Patj Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of PATJ mRNA CTD PMID:22110744 Patj Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of PATJ mRNA CTD PMID:21515302 Patj Rat titanium dioxide decreases expression ISO Patj (Mus musculus) 6480464 titanium dioxide results in decreased expression of PATJ mRNA CTD PMID:35295148 Patj Rat titanium dioxide decreases methylation ISO Patj (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PATJ promoter CTD PMID:35295148 Patj Rat titanium dioxide increases methylation ISO Patj (Mus musculus) 6480464 titanium dioxide results in increased methylation of PATJ gene CTD PMID:35295148 Patj Rat trichostatin A increases expression ISO PATJ (Homo sapiens) 6480464 trichostatin A results in increased expression of PATJ mRNA CTD PMID:24935251 and PMID:26272509 Patj Rat trichostatin A multiple interactions ISO PATJ (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PATJ mRNA CTD PMID:27188386 Patj Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of PATJ mRNA CTD PMID:30589522 Patj Rat triphenyl phosphate affects expression ISO PATJ (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PATJ mRNA CTD PMID:37042841 Patj Rat triptonide affects expression ISO Patj (Mus musculus) 6480464 triptonide affects the expression of PATJ mRNA CTD PMID:33045310 Patj Rat tris(2-butoxyethyl) phosphate affects expression ISO PATJ (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of PATJ mRNA CTD PMID:29024780 Patj Rat valproic acid multiple interactions ISO PATJ (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PATJ mRNA CTD PMID:27188386 Patj Rat valproic acid increases expression ISO PATJ (Homo sapiens) 6480464 Valproic Acid results in increased expression of PATJ mRNA CTD PMID:23179753 more ... Patj Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PATJ mRNA CTD PMID:23034163
(S)-nicotine (ISO) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acrolein (ISO) acrylamide (EXP,ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amitriptyline (EXP) ammonium chloride (EXP) amphetamine (EXP) Ampullosporin (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) atrazine (EXP) benzene (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-chloroethyl) sulfide (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) Brodifacoum (EXP) butanal (ISO) cadmium dichloride (EXP) caffeine (ISO) calcitriol (ISO) carbamazepine (ISO) carbon nanotube (ISO) corosolic acid (ISO) coumestrol (ISO) Cuprizon (EXP) cyclosporin A (ISO) dibenzo[a,l]pyrene (ISO) dorsomorphin (ISO) endosulfan (EXP) entinostat (ISO) ethanol (ISO) finasteride (EXP) flutamide (EXP) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) gentamycin (EXP) ketamine (EXP) mercury dibromide (ISO) mercury dichloride (ISO) methapyrilene (ISO) methoxychlor (EXP) morphine (ISO) Muraglitazar (EXP) N-methyl-N-nitrosourea (ISO) nicotine (ISO) Nor-9-carboxy-delta9-THC (ISO) ozone (ISO) panobinostat (ISO) paracetamol (EXP,ISO) pentanal (ISO) phenylmercury acetate (ISO) potassium dichromate (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium dichromate (EXP) Tesaglitazar (EXP) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (EXP,ISO) triptonide (ISO) tris(2-butoxyethyl) phosphate (ISO) valproic acid (ISO) vinclozolin (EXP)
Cellular Component
anchoring junction (IEA) apical part of cell (IBA,ISO) apical plasma membrane (IEA,ISO,ISS) bicellular tight junction (IBA,IEA,ISO) cell junction (IEA,ISO) cell leading edge (ISO) centriolar satellite (IEA,ISO) cytoplasm (IBA,IEA) cytosol (IEA,ISO) membrane (IEA) perinuclear region of cytoplasm (IEA,ISO) plasma membrane (IBA,IEA) protein-containing complex (IDA) subapical complex (ISO) tight junction (ISO,ISS)
Patj Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 118,177,557 - 118,480,301 (+) NCBI GRCr8 mRatBN7.2 5 113,061,985 - 113,364,807 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 113,062,118 - 113,364,807 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 115,640,473 - 115,944,504 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 117,365,825 - 117,669,843 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 117,428,349 - 117,732,383 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 117,038,548 - 117,340,308 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 117,052,260 - 117,340,336 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 120,981,525 - 121,281,044 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 118,806,744 - 119,131,114 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 111,633,199 - 111,931,738 (+) NCBI Celera Cytogenetic Map 5 q33 NCBI
PATJ Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 61,742,480 - 62,163,915 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 61,742,477 - 62,178,675 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 62,208,152 - 62,629,587 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 61,980,737 - 62,402,180 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 60,496,772 - 60,918,615 (+) NCBI Celera Cytogenetic Map 1 p31.3 NCBI HuRef 1 60,320,895 - 60,742,543 (+) NCBI HuRef CHM1_1 1 62,323,629 - 62,744,942 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 61,621,342 - 62,042,561 (+) NCBI T2T-CHM13v2.0
Patj Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 98,283,803 - 98,607,840 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 98,284,022 - 98,607,840 (+) Ensembl GRCm39 Ensembl GRCm38 4 98,395,560 - 98,719,603 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 98,395,785 - 98,719,603 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 98,062,517 - 98,386,294 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 97,887,844 - 98,211,621 (+) NCBI MGSCv36 mm8 Celera 4 96,759,588 - 97,075,177 (+) NCBI Celera Cytogenetic Map 4 C6 NCBI cM Map 4 45.6 NCBI
Patj Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955423 27,409,623 - 27,629,731 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955423 27,408,334 - 27,637,065 (-) NCBI ChiLan1.0 ChiLan1.0
PATJ Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 164,694,360 - 165,117,105 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 163,844,049 - 164,266,301 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 60,993,316 - 61,416,043 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 62,832,424 - 63,233,073 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 62,832,424 - 63,247,074 (+) Ensembl panpan1.1 panPan2
PATJ Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 47,913,433 - 48,268,043 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 47,914,284 - 48,256,861 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 47,973,462 - 48,335,754 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 48,097,120 - 48,453,049 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 48,097,122 - 48,452,964 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 48,051,707 - 48,405,688 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 47,998,363 - 48,352,502 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 48,260,886 - 48,617,091 (-) NCBI UU_Cfam_GSD_1.0
Patj
PATJ Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 150,245,497 - 150,605,544 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 150,248,714 - 150,605,565 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 138,472,898 - 138,557,009 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PATJ Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 70,910,594 - 71,300,877 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 70,910,447 - 71,301,424 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 46,104,468 - 46,515,476 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Patj
.
Predicted Target Of
Count of predictions: 615 Count of miRNA genes: 253 Interacting mature miRNAs: 312 Transcripts: ENSRNOT00000010112, ENSRNOT00000010211, ENSRNOT00000057943, ENSRNOT00000065197 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1298070 Scl18 Serum cholesterol level QTL 18 3.7 blood LDL cholesterol amount (VT:0000181) calculated plasma low density lipoprotein cholesterol level (CMO:0001245) 5 79584860 124584860 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1598859 Cm66 Cardiac mass QTL 66 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 79584860 124584860 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 1582212 Livw2 Liver weight QTL 2 3.5 0.0004 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 5 99016066 119085810 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 1358909 Kidm25 Kidney mass QTL 25 1.87 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 90067849 128034027 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298086 Bp156 Blood pressure QTL 156 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 84132602 129132602 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 1358889 Bp261 Blood pressure QTL 261 2.86 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 90067849 128034027 Rat 2316957 Pur21 Proteinuria QTL 21 6.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 5 59793528 113558156 Rat 1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 7794743 Bp373 Blood pressure QTL 373 0.0058 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 112175546 116047089 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 1598846 Bp293 Blood pressure QTL 293 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 79584860 124584860 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
D5Rat25
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 118,176,414 - 118,176,602 (+) Marker Load Pipeline mRatBN7.2 5 113,060,909 - 113,061,097 (+) MAPPER mRatBN7.2 Rnor_6.0 5 117,037,089 - 117,037,276 NCBI Rnor6.0 Rnor_5.0 5 120,979,996 - 120,980,183 UniSTS Rnor5.0 RGSC_v3.4 5 118,805,536 - 118,805,723 UniSTS RGSC3.4 RGSC_v3.4 5 118,805,535 - 118,805,723 RGD RGSC3.4 RGSC_v3.1 5 118,810,762 - 118,810,949 RGD Celera 5 111,631,991 - 111,632,178 UniSTS RH 3.4 Map 5 789.6 UniSTS RH 3.4 Map 5 789.6 RGD SHRSP x BN Map 5 61.5499 RGD SHRSP x BN Map 5 61.5499 UniSTS Cytogenetic Map 5 q33 UniSTS
RH143216
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 113,364,282 - 113,364,390 (+) MAPPER mRatBN7.2 Rnor_6.0 5 117,339,784 - 117,339,891 NCBI Rnor6.0 Rnor_5.0 5 121,280,905 - 121,281,012 UniSTS Rnor5.0 RGSC_v3.4 5 119,131,961 - 119,132,068 UniSTS RGSC3.4 Celera 5 111,931,214 - 111,931,321 UniSTS RH 3.4 Map 5 794.9 UniSTS Cytogenetic Map 5 q33 UniSTS
RH142079
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 113,362,916 - 113,363,115 (+) MAPPER mRatBN7.2 Rnor_6.0 5 117,338,418 - 117,338,616 NCBI Rnor6.0 Rnor_5.0 5 121,279,539 - 121,279,737 UniSTS Rnor5.0 RGSC_v3.4 5 119,130,595 - 119,130,793 UniSTS RGSC3.4 Celera 5 111,929,848 - 111,930,046 UniSTS RH 3.4 Map 9 58.2 UniSTS Cytogenetic Map 5 q33 UniSTS
AU049786
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 113,246,624 - 113,246,759 (+) MAPPER mRatBN7.2 Rnor_6.0 5 117,222,689 - 117,222,823 NCBI Rnor6.0 Rnor_5.0 5 121,165,800 - 121,165,934 UniSTS Rnor5.0 RGSC_v3.4 5 119,007,905 - 119,008,039 UniSTS RGSC3.4 Celera 5 111,814,675 - 111,814,791 UniSTS Cytogenetic Map 5 q33 UniSTS
UniSTS:234969
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 113,335,953 - 113,336,240 (+) MAPPER mRatBN7.2 Rnor_6.0 5 117,311,488 - 117,311,774 NCBI Rnor6.0 Rnor_5.0 5 121,252,809 - 121,253,095 UniSTS Rnor5.0 RGSC_v3.4 5 119,103,292 - 119,103,578 UniSTS RGSC3.4 Celera 5 111,903,153 - 111,903,439 UniSTS Cytogenetic Map 5 q33 UniSTS
This gene Patj is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010211 ⟹ ENSRNOP00000010211
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 113,062,118 - 113,364,807 (+) Ensembl Rnor_6.0 Ensembl 5 117,052,260 - 117,340,336 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000094178 ⟹ ENSRNOP00000092161
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 113,062,118 - 113,332,082 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095175 ⟹ ENSRNOP00000079221
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 113,062,118 - 113,364,807 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000101438 ⟹ ENSRNOP00000077045
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 113,062,118 - 113,364,807 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103328 ⟹ ENSRNOP00000097148
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 113,207,165 - 113,363,205 (+) Ensembl
RefSeq Acc Id:
NM_080398 ⟹ NP_536323
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 118,177,623 - 118,480,301 (+) NCBI mRatBN7.2 5 113,062,118 - 113,364,807 (+) NCBI Rnor_6.0 5 117,038,630 - 117,340,308 (+) NCBI Celera 5 111,633,199 - 111,931,738 (+) NCBI
Sequence:
AGCAGCTGTACTTCCGCCAGGTGAGGAGGCCGTGATCGCAGCCTCGGGGCTCCCACCCGGCTGTCGCCTGATCAGACTTAGGATTGAAAGTGCTTGAAAAGAGTGATCCAAAATGCCTGAAAACCCTG
hide sequence
RefSeq Acc Id:
XM_008763915 ⟹ XP_008762137
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 118,177,557 - 118,298,341 (+) NCBI mRatBN7.2 5 113,062,054 - 113,182,942 (+) NCBI Rnor_6.0 5 117,038,616 - 117,159,681 (+) NCBI
Sequence:
GTCCAGGTGAGGGCAGCAGCTGTACTTCCGCCAGGTGAGGAGGCCGTGATCGCAGCCTCGGGGCTCCCACCCGGCTGTCGCCTGATCAGACTTAGGATTGAAAGTGCTTGAAAAGAGTGATCCAAAAT
hide sequence
RefSeq Acc Id:
XM_008763916 ⟹ XP_008762138
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 118,323,416 - 118,479,916 (+) NCBI mRatBN7.2 5 113,207,170 - 113,364,422 (+) NCBI Rnor_6.0 5 117,181,442 - 117,339,923 (+) NCBI
Sequence:
CACACACACATACACCCCTTGTCAGTATGGGCCACTAATTTCCTAATAAGAGAAAAACTAGAAACCATAGGAGCACTGCAGTCAGGAGTGTGTAACAGCTGGGATATCCAGTAGCTGTGTGTTTGTCT
hide sequence
RefSeq Acc Id:
XM_039109186 ⟹ XP_038965114
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 118,177,557 - 118,479,916 (+) NCBI mRatBN7.2 5 113,062,054 - 113,364,422 (+) NCBI
RefSeq Acc Id:
XM_039109188 ⟹ XP_038965116
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 118,177,557 - 118,479,916 (+) NCBI mRatBN7.2 5 113,062,054 - 113,364,422 (+) NCBI
RefSeq Acc Id:
XM_063287100 ⟹ XP_063143170
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 118,177,557 - 118,479,916 (+) NCBI
RefSeq Acc Id:
XM_063287101 ⟹ XP_063143171
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 118,177,557 - 118,479,916 (+) NCBI
RefSeq Acc Id:
XM_063287102 ⟹ XP_063143172
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 118,177,557 - 118,479,916 (+) NCBI
RefSeq Acc Id:
XM_063287103 ⟹ XP_063143173
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 118,326,581 - 118,479,916 (+) NCBI
RefSeq Acc Id:
XP_008762137 ⟸ XM_008763915
- Peptide Label:
isoform X6
- Sequence:
MPENPAAEKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQLSHIPSDCSANFDFSRKGLLVFTDGSITNGNAHRPCSSITASESLPWTQRSGNEDFTSVIQQMAQ
hide sequence
RefSeq Acc Id:
XP_008762138 ⟸ XM_008763916
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I6GME4 (UniProtKB/TrEMBL)
- Sequence:
MVHGGFPEKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGINPDGPAAADGR
hide sequence
RefSeq Acc Id:
NP_536323 ⟸ NM_080398
- UniProtKB:
F1MAD2 (UniProtKB/Swiss-Prot), A0A8I6AG04 (UniProtKB/TrEMBL)
- Sequence:
MPENPAAEKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQL
hide sequence
Ensembl Acc Id:
ENSRNOP00000010211 ⟸ ENSRNOT00000010211
RefSeq Acc Id:
XP_038965114 ⟸ XM_039109186
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZMD2 (UniProtKB/TrEMBL), A0A8I6AG04 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965116 ⟸ XM_039109188
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6AG04 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000077045 ⟸ ENSRNOT00000101438
Ensembl Acc Id:
ENSRNOP00000092161 ⟸ ENSRNOT00000094178
Ensembl Acc Id:
ENSRNOP00000079221 ⟸ ENSRNOT00000095175
Ensembl Acc Id:
ENSRNOP00000097148 ⟸ ENSRNOT00000103328
RefSeq Acc Id:
XP_063143171 ⟸ XM_063287101
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AG04 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143172 ⟸ XM_063287102
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I5ZJD2 (UniProtKB/TrEMBL), A0A8I6AG04 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143170 ⟸ XM_063287100
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AG04 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143173 ⟸ XM_063287103
- Peptide Label:
isoform X7
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-07-18
Inadl
InaD-like (Drosophila)
Inadl2
InaD-like 2 (Drosophila)
Data merged from RGD:621378
737654 APPROVED
2008-03-20
Inadl2
InaD-like 2 (Drosophila)
Inadl
InaD-like (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-20
Inadl
InaD-like (Drosophila)
RGD1565362_predicted
similar to channel-interacting PDZ domain protein isoform 1 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1565362_predicted
similar to channel-interacting PDZ domain protein isoform 1 (predicted)
LOC313382
similar to channel-interacting PDZ domain protein isoform 1
Symbol and Name status set to approved
1299863 APPROVED
2005-01-20
Inadl
InaD-like (Drosophila)
PDZ domain protein (Drosophila inaD-like)
Name updated
1299863 APPROVED
Note Type
Note
Reference
gene_function
may participate in TRPC3 protein mediated 1alpha,25(OH)(2)D(3) modulation of CCE in muscle and osteoblastic cells
1304343
