Advanced Search (OLGA)

Gene: CSNK2B (casein kinase 2 beta) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

CSNK2B

Name:

casein kinase 2 beta

RGD ID:

1347139

HGNC Page

HGNC:2460

Description:

Enables several functions, including RNA polymerase II-specific DNA-binding transcription factor binding activity; chromatin binding activity; and identical protein binding activity. Involved in several processes, including adiponectin-activated signaling pathway; positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway; and symbiont-mediated disruption of host cell PML body. Located in cytoplasm; nucleus; and plasma membrane. Part of protein kinase CK2 complex. Is active in PML body and chromatin. Biomarker of leiomyoma.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

alternative name: G5a, phosvitin; casein kinase 2, beta polypeptide; casein kinase II b subunit splicing isoform 132; casein kinase II b subunit splicing isoform 247; casein kinase II b subunit splicing isoform 318; casein kinase II b subunit splicing isoform 660; casein kinase II b subunit splicing isoform 806; Casein kinase II beta subunit; casein kinase II subunit beta; chimera CSNK2B-LY6G5B splicing isoform 1072; chimera CSNK2B-LY6G5B splicing isoform 1103; chimera CSNK2B-LY6G5B splicing isoform 532; chimera CSNK2B-LY6G5B splicing isoform 560; chimera CSNK2B-LY6G5B splicing isoform 562; CK II beta; CK2B; CK2N; Ckb1; Ckb2; CSK2B; CSNK2B-LY6G5B-1072; CSNK2B-LY6G5B-1103; CSNK2B-LY6G5B-532; CSNK2B-LY6G5B-560; CSNK2B-LY6G5B-562; G5A; MGC138222; MGC138224; phosvitin; POBINDS

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Csnk2b (casein kinase 2, beta polypeptide)	HGNC	Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Csnk2b (casein kinase 2 beta)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Csnk2b (casein kinase 2 beta)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	CSNK2B (casein kinase 2 beta)	NCBI	Ortholog
Canis lupus familiaris (dog):	CSNK2B (casein kinase 2 beta)	HGNC	HomoloGene, NCBI
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Csnk2b (casein kinase 2 beta)	NCBI	Ortholog
Sus scrofa (pig):	CSNK2B (casein kinase 2 beta)	HGNC	Inparanoid, NCBI, OMA, Panther, Treefam
Chlorocebus sabaeus (green monkey):	CSNK2B (casein kinase 2 beta)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Csnk2b (casein kinase 2 beta)	NCBI	Ortholog
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Csnk2b (casein kinase 2 beta)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Csnk2b (casein kinase 2, beta polypeptide)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	csnk2b (casein kinase 2, beta polypeptide)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid\|ZFIN)
Drosophila melanogaster (fruit fly):	CkIIbeta	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	kin-10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CKB2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus laevis (African clawed frog):	csnk2b.S	Alliance	DIOPT (Xenbase)
Xenopus laevis (African clawed frog):	csnk2b.L	Alliance	DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):	csnk2b	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	31,666,080 - 31,670,067 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	31,665,227 - 31,670,343 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	31,633,857 - 31,637,844 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	31,741,636 - 31,745,822 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	31,741,635 - 31,745,822	NCBI
Celera	6	33,231,878 - 33,236,064 (+)	NCBI		Celera
Cytogenetic Map	6	p21.33	NCBI
HuRef	6	31,419,882 - 31,424,068 (+)	NCBI		HuRef
CHM1_1	6	31,635,793 - 31,639,979 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	31,519,114 - 31,523,101 (+)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CSNK2B	Human	Hypoglossal Nerve Injuries		ISO	Csnk2b (Rattus norvegicus)	11565824		RGD
CSNK2B	Human	leiomyoma		IEP		11565842		RGD
CSNK2B	Human	myocardial infarction		ISO	Csnk2b (Rattus norvegicus)	11565830		RGD
CSNK2B	Human	Oxygen-Induced Retinopathy		ISO	Csnk2b (Mus musculus)	11565123		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CSNK2B	Human	autism spectrum disorder		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism spectrum disorder	ClinVar	PMID:25741868
CSNK2B	Human	autosomal dominant intellectual developmental disorder		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Autosomal dominant non-syndromic intellectual disability	ClinVar	PMID:25741868
CSNK2B	Human	enophthalmos		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Enophthalmos	ClinVar	PMID:25741868 more ...
CSNK2B	Human	epilepsy		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Seizure	ClinVar
CSNK2B	Human	epilepsy		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Seizure	ClinVar	PMID:25741868 more ...
CSNK2B	Human	genetic disease		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868 more ...
CSNK2B	Human	genetic disease		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868 more ...
CSNK2B	Human	genetic disease		IAGP	(Homo sapiens) more ...	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar
CSNK2B	Human	genetic disease		IAGP	(Homo sapiens) more ...	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868
CSNK2B	Human	genetic disease		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868 more ...
CSNK2B	Human	genetic disease		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:28333917
CSNK2B	Human	intellectual disability		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: intellectual disabilities	ClinVar	PMID:25741868 more ...
CSNK2B	Human	Malocclusion, Angle Class III		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Hapsburg jaw	ClinVar	PMID:25741868 more ...
CSNK2B	Human	megacolon		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Megacolon	ClinVar	PMID:21681106
CSNK2B	Human	Neurodevelopmental Disorders		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:30655572
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:25741868 more ...
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens) more ...	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:25741868
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:25741868 more ...
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens) more ...	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:31784560
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens) more ...	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens) and (Homo sapiens)	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:25741868 and PMID:31784560
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:25741868 more ...
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:29758562
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens) and (Homo sapiens)	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:25741868 and PMID:35571680
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:25741868 more ...
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:11574463 more ...
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:28585349 and PMID:31784560
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:28762608
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Poirier-Bienvenu neurodevelopmental syndrome	ClinVar	PMID:28585349
CSNK2B	Human	proteasome-associated autoinflammatory syndrome 1		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Proteasome-associated autoinflammatory syndrome 1	ClinVar	PMID:28492532
CSNK2B	Human	syndactyly		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Syndactyly	ClinVar	PMID:25741868 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CSNK2B	Human	adult T-cell leukemia/lymphoma		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:26437031
CSNK2B	Human	Skin Neoplasms		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18572023
CSNK2B	Human	squamous cell carcinoma		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18572023

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CSNK2B	Human	POIRIER-BIENVENU NEURODEVELOPMENTAL SYNDROME		IAGP		7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CSNK2B	Human	1,2-dimethylhydrazine	multiple interactions	ISO	Csnk2b (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CSNK2B mRNA	CTD	PMID:22206623
CSNK2B	Human	17alpha-ethynylestradiol	increases expression	ISO	Csnk2b (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of CSNK2B mRNA	CTD	PMID:17942748
CSNK2B	Human	17alpha-ethynylestradiol	decreases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Ethinyl Estradiol results in decreased expression of CSNK2B mRNA	CTD	PMID:17108234 and PMID:17557909
CSNK2B	Human	17alpha-ethynylestradiol	multiple interactions	ISO	Csnk2b (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CSNK2B mRNA	CTD	PMID:17942748
CSNK2B	Human	17beta-estradiol	multiple interactions	ISO	Csnk2b (Rattus norvegicus)	6480464	[bisphenol A co-treated with Estradiol] results in decreased expression of CSNK2B mRNA	CTD	PMID:26496021
CSNK2B	Human	17beta-estradiol	increases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Estradiol results in increased expression of CSNK2B mRNA	CTD	PMID:32145629
CSNK2B	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Csnk2b (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of CSNK2B mRNA	CTD	PMID:20702594
CSNK2B	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in increased expression of CSNK2B mRNA	CTD	PMID:33387578
CSNK2B	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of CSNK2B mRNA	CTD	PMID:34747641
CSNK2B	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Csnk2b (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of CSNK2B mRNA	CTD	PMID:21354282
CSNK2B	Human	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Csnk2b (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CSNK2B mRNA	CTD	PMID:17942748
CSNK2B	Human	2,3,7,8-Tetrachlorodibenzofuran	affects expression	ISO	Csnk2b (Mus musculus)	6480464	2 more ...	CTD	PMID:20702594
CSNK2B	Human	4,4'-diaminodiphenylmethane	increases expression	ISO	Csnk2b (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in increased expression of CSNK2B mRNA	CTD	PMID:18648102
CSNK2B	Human	4,4'-sulfonyldiphenol	increases expression	ISO	Csnk2b (Mus musculus)	6480464	bisphenol S results in increased expression of CSNK2B mRNA	CTD	PMID:39298647
CSNK2B	Human	5-aza-2'-deoxycytidine	increases expression	ISO	Csnk2b (Mus musculus)	6480464	Decitabine results in increased expression of CSNK2B mRNA	CTD	PMID:27915011
CSNK2B	Human	5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole	affects expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Omeprazole affects the expression of CSNK2B mRNA	CTD	PMID:19483382
CSNK2B	Human	6-propyl-2-thiouracil	affects expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Propylthiouracil affects the expression of CSNK2B mRNA	CTD	PMID:19483382
CSNK2B	Human	all-trans-retinoic acid	decreases expression	EXP		6480464	Tretinoin results in decreased expression of CSNK2B mRNA	CTD	PMID:17218384
CSNK2B	Human	amiodarone	affects expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Amiodarone affects the expression of CSNK2B mRNA	CTD	PMID:19483382
CSNK2B	Human	ammonium chloride	affects expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Ammonium Chloride affects the expression of CSNK2B mRNA	CTD	PMID:16483693
CSNK2B	Human	arsenite(3-)	multiple interactions	EXP		6480464	arsenite promotes the reaction [G3BP1 protein binds to CSNK2B mRNA]	CTD	PMID:32406909
CSNK2B	Human	ATP	multiple interactions	EXP		6480464	silmitasertib inhibits the reaction [Adenosine Triphosphate binds to [CSNK2A1 protein binds to CSNK2A1 protein binds to CSNK2B protein binds to CSNK2B protein]]	CTD	PMID:21174434
CSNK2B	Human	ATP	affects binding	EXP		6480464	Adenosine Triphosphate binds to [CSNK2A1 protein binds to CSNK2A1 protein binds to CSNK2B protein binds to CSNK2B protein]	CTD	PMID:21174434
CSNK2B	Human	atrazine	increases expression	EXP		6480464	Atrazine results in increased expression of CSNK2B mRNA	CTD	PMID:22378314
CSNK2B	Human	benzbromarone	affects expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Benzbromarone affects the expression of CSNK2B mRNA	CTD	PMID:19483382
CSNK2B	Human	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of CSNK2B protein	CTD	PMID:33278487
CSNK2B	Human	beta-lapachone	increases expression	EXP		6480464	beta-lapachone results in increased expression of CSNK2B mRNA	CTD	PMID:38218311
CSNK2B	Human	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Csnk2b (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of CSNK2B protein	CTD	PMID:37302538
CSNK2B	Human	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	Csnk2b (Mus musculus)	6480464	benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Diethylhexyl Phthalate results in increased degradation of CSNK2B protein] more ...	CTD	PMID:37302538
CSNK2B	Human	bis(2-ethylhexyl) phthalate	increases ubiquitination	ISO	Csnk2b (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased ubiquitination of CSNK2B protein	CTD	PMID:37302538
CSNK2B	Human	bis(2-ethylhexyl) phthalate	increases degradation	ISO	Csnk2b (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased degradation of CSNK2B protein	CTD	PMID:37302538
CSNK2B	Human	bisphenol A	multiple interactions	ISO	Csnk2b (Rattus norvegicus)	6480464	[bisphenol A co-treated with Estradiol] results in decreased expression of CSNK2B mRNA	CTD	PMID:26496021
CSNK2B	Human	bisphenol A	decreases expression	ISO	Csnk2b (Mus musculus)	6480464	bisphenol A results in decreased expression of CSNK2B mRNA	CTD	PMID:33221593
CSNK2B	Human	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of CSNK2B mRNA	CTD	PMID:30809271
CSNK2B	Human	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of CSNK2B mRNA	CTD	PMID:30903817
CSNK2B	Human	bisphenol A	increases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	bisphenol A results in increased expression of CSNK2B mRNA	CTD	PMID:25181051
CSNK2B	Human	bisphenol F	increases expression	ISO	Csnk2b (Mus musculus)	6480464	bisphenol F results in increased expression of CSNK2B mRNA	CTD	PMID:38685157
CSNK2B	Human	bromobenzene	increases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	bromobenzene results in increased expression of CSNK2B mRNA	CTD	PMID:16036859
CSNK2B	Human	cadmium dichloride	increases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Cadmium Chloride results in increased expression of CSNK2B mRNA	CTD	PMID:33453195
CSNK2B	Human	capsaicin	increases phosphorylation	EXP		6480464	Capsaicin results in increased phosphorylation of CSNK2B protein	CTD	PMID:20510015
CSNK2B	Human	chlorpyrifos	increases expression	ISO	Csnk2b (Mus musculus)	6480464	Chlorpyrifos results in increased expression of CSNK2B mRNA	CTD	PMID:37019170
CSNK2B	Human	choline	multiple interactions	ISO	Csnk2b (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CSNK2B gene	CTD	PMID:20938992
CSNK2B	Human	chromium(6+)	increases expression	EXP		6480464	chromium hexavalent ion results in increased expression of CSNK2B mRNA	CTD	PMID:30690063
CSNK2B	Human	chrysin 5,7-dimethyl ether	multiple interactions	ISO	Csnk2b (Rattus norvegicus)	6480464	5 more ...	CTD	PMID:21554863
CSNK2B	Human	cisplatin	increases expression	EXP		6480464	Cisplatin results in increased expression of CSNK2B mRNA	CTD	PMID:27392435
CSNK2B	Human	clofibrate	affects expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Clofibrate affects the expression of CSNK2B mRNA	CTD	PMID:19483382
CSNK2B	Human	crocidolite asbestos	decreases expression	ISO	Csnk2b (Mus musculus)	6480464	Asbestos and Crocidolite results in decreased expression of CSNK2B mRNA	CTD	PMID:29279043
CSNK2B	Human	cycloheximide	multiple interactions	ISO	Csnk2b (Mus musculus)	6480464	Diethylhexyl Phthalate inhibits the reaction [Cycloheximide results in decreased degradation of CSNK2B protein] and TNFAIP1 protein inhibits the reaction [Cycloheximide results in decreased degradation of CSNK2B protein]	CTD	PMID:37302538
CSNK2B	Human	cycloheximide	decreases degradation	ISO	Csnk2b (Mus musculus)	6480464	Cycloheximide results in decreased degradation of CSNK2B protein	CTD	PMID:37302538
CSNK2B	Human	Dibutyl phosphate	affects expression	EXP		6480464	di-n-butylphosphoric acid affects the expression of CSNK2B mRNA	CTD	PMID:37042841
CSNK2B	Human	dibutyl phthalate	decreases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Dibutyl Phthalate results in decreased expression of CSNK2B mRNA	CTD	PMID:21266533
CSNK2B	Human	dibutyl phthalate	decreases expression	ISO	Csnk2b (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of CSNK2B mRNA	CTD	PMID:17361019
CSNK2B	Human	dicrotophos	increases expression	EXP		6480464	dicrotophos results in increased expression of CSNK2B mRNA	CTD	PMID:28302478
CSNK2B	Human	doxorubicin	increases expression	EXP		6480464	Doxorubicin results in increased expression of CSNK2B mRNA	CTD	PMID:29803840
CSNK2B	Human	elemental selenium	increases expression	EXP		6480464	Selenium results in increased expression of CSNK2B mRNA	CTD	PMID:19244175
CSNK2B	Human	emodin	increases expression	ISO	Csnk2b (Mus musculus)	6480464	Emodin results in increased expression of CSNK2B mRNA	CTD	PMID:21319176
CSNK2B	Human	flutamide	increases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Flutamide results in increased expression of CSNK2B mRNA	CTD	PMID:24136188
CSNK2B	Human	folic acid	multiple interactions	ISO	Csnk2b (Mus musculus)	6480464	[1 more ...	CTD	PMID:20938992 and PMID:22206623
CSNK2B	Human	FR900359	decreases phosphorylation	EXP		6480464	FR900359 results in decreased phosphorylation of CSNK2B protein	CTD	PMID:37730182
CSNK2B	Human	genistein	multiple interactions	ISO	Csnk2b (Rattus norvegicus)	6480464	[Genistein co-treated with Methoxychlor] results in decreased expression of CSNK2B mRNA	CTD	PMID:21782745
CSNK2B	Human	genistein	decreases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Genistein results in decreased expression of CSNK2B mRNA	CTD	PMID:21782745
CSNK2B	Human	gentamycin	increases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Gentamicins results in increased expression of CSNK2B mRNA	CTD	PMID:22061828
CSNK2B	Human	ivermectin	decreases expression	EXP		6480464	Ivermectin results in decreased expression of CSNK2B protein	CTD	PMID:32959892
CSNK2B	Human	L-ethionine	affects expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Ethionine affects the expression of CSNK2B mRNA	CTD	PMID:19483382
CSNK2B	Human	L-methionine	multiple interactions	ISO	Csnk2b (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CSNK2B gene	CTD	PMID:20938992
CSNK2B	Human	lead(0)	decreases expression	EXP		6480464	Lead results in decreased expression of CSNK2B mRNA	CTD	PMID:19921347
CSNK2B	Human	methoxychlor	multiple interactions	ISO	Csnk2b (Rattus norvegicus)	6480464	[Genistein co-treated with Methoxychlor] results in decreased expression of CSNK2B mRNA	CTD	PMID:21782745
CSNK2B	Human	methoxychlor	decreases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Methoxychlor results in decreased expression of CSNK2B mRNA	CTD	PMID:21782745
CSNK2B	Human	methyl methanesulfonate	increases expression	EXP		6480464	Methyl Methanesulfonate results in increased expression of CSNK2B mRNA	CTD	PMID:23649840
CSNK2B	Human	N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal	multiple interactions	ISO	Csnk2b (Mus musculus)	6480464	benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Diethylhexyl Phthalate results in increased degradation of CSNK2B protein] and benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [TNFAIP1 protein results in increased degradation of CSNK2B protein]	CTD	PMID:37302538
CSNK2B	Human	N-nitrosodiethylamine	increases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Diethylnitrosamine results in increased expression of CSNK2B mRNA and Diethylnitrosamine results in increased expression of CSNK2B protein	CTD	PMID:21554863
CSNK2B	Human	N-nitrosodiethylamine	multiple interactions	ISO	Csnk2b (Rattus norvegicus)	6480464	5 more ...	CTD	PMID:21554863
CSNK2B	Human	omeprazole	affects expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Omeprazole affects the expression of CSNK2B mRNA	CTD	PMID:19483382
CSNK2B	Human	paracetamol	affects expression	ISO	Csnk2b (Mus musculus)	6480464	Acetaminophen affects the expression of CSNK2B mRNA	CTD	PMID:17562736
CSNK2B	Human	phenethyl isothiocyanate	increases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	phenethyl isothiocyanate results in increased expression of CSNK2B mRNA	CTD	PMID:17616710
CSNK2B	Human	pirinixic acid	affects expression	ISO	Csnk2b (Rattus norvegicus)	6480464	pirinixic acid affects the expression of CSNK2B mRNA	CTD	PMID:19483382
CSNK2B	Human	pirinixic acid	increases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	pirinixic acid results in increased expression of CSNK2B mRNA	CTD	PMID:19162173
CSNK2B	Human	Propiverine	affects binding	ISO	Csnk2b (Rattus norvegicus)	6480464	propiverine binds to CSNK2B protein	CTD	PMID:29273565
CSNK2B	Human	pyrogallol	increases expression	ISO	Csnk2b (Mus musculus)	6480464	Pyrogallol results in increased expression of CSNK2B mRNA	CTD	PMID:20362636
CSNK2B	Human	quercetin	affects binding	EXP		6480464	Quercetin analog binds to CSNK2B protein	CTD	PMID:21798748
CSNK2B	Human	rotenone	decreases expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Rotenone results in decreased expression of CSNK2B protein	CTD	PMID:35544339
CSNK2B	Human	selenium atom	increases expression	EXP		6480464	Selenium results in increased expression of CSNK2B mRNA	CTD	PMID:19244175
CSNK2B	Human	silmitasertib	multiple interactions	EXP		6480464	silmitasertib inhibits the reaction [Adenosine Triphosphate binds to [CSNK2A1 protein binds to CSNK2A1 protein binds to CSNK2B protein binds to CSNK2B protein]] and silmitasertib results in decreased activity of [CSNK2A1 protein binds to CSNK2A1 protein binds to CSNK2B protein binds to CSNK2B protein]	CTD	PMID:21174434
CSNK2B	Human	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of CSNK2B mRNA and sodium arsenite results in increased expression of CSNK2B protein	CTD	PMID:18572023
CSNK2B	Human	temozolomide	increases expression	EXP		6480464	Temozolomide results in increased expression of CSNK2B mRNA	CTD	PMID:31758290
CSNK2B	Human	thioacetamide	affects expression	ISO	Csnk2b (Rattus norvegicus)	6480464	Thioacetamide affects the expression of CSNK2B mRNA	CTD	PMID:19483382
CSNK2B	Human	titanium dioxide	decreases methylation	ISO	Csnk2b (Mus musculus)	6480464	titanium dioxide results in decreased methylation of CSNK2B gene	CTD	PMID:35295148
CSNK2B	Human	titanium dioxide	increases methylation	ISO	Csnk2b (Mus musculus)	6480464	titanium dioxide results in increased methylation of CSNK2B gene	CTD	PMID:35295148
CSNK2B	Human	triphenyl phosphate	affects expression	EXP		6480464	triphenyl phosphate affects the expression of CSNK2B mRNA	CTD	PMID:37042841
CSNK2B	Human	triptonide	increases expression	ISO	Csnk2b (Mus musculus)	6480464	triptonide results in increased expression of CSNK2B mRNA	CTD	PMID:33045310
CSNK2B	Human	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of CSNK2B mRNA	CTD	PMID:23179753
CSNK2B	Human	vinclozolin	decreases methylation	ISO	Csnk2b (Rattus norvegicus)	6480464	vinclozolin results in decreased methylation of CSNK2B gene	CTD	PMID:31079544
CSNK2B	Human	vitamin E	increases expression	EXP		6480464	Vitamin E results in increased expression of CSNK2B mRNA	CTD	PMID:19244175

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CSNK2B	Human	adiponectin-activated signaling pathway	involved_in	IDA		150520179	PMID:19233263	BHF-UCL	PMID:19233263
CSNK2B	Human	endothelial tube morphogenesis	involved_in	IMP		150520179	PMID:19592636	BHF-UCL	PMID:19592636
CSNK2B	Human	liver regeneration		ISO	Csnk2b (Rattus norvegicus)	9068941		RGD	PMID:8573159 and REF_RGD_ID:11565141
CSNK2B	Human	negative regulation of blood vessel endothelial cell migration	involved_in	IDA		150520179	PMID:19592636	BHF-UCL	PMID:19592636
CSNK2B	Human	negative regulation of cell population proliferation	involved_in	TAS		150520179	PMID:19324893	BHF-UCL	PMID:19324893
CSNK2B	Human	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	involved_in	IDA		150520179	PMID:28031292	ARUK-UCL	PMID:28031292
CSNK2B	Human	negative regulation of viral life cycle	involved_in	IDA		150520179	PMID:31341047	UniProt	PMID:31341047
CSNK2B	Human	peptidyl-threonine phosphorylation	involved_in	IDA		150520179	PMID:15723517	CAFA	PMID:15723517
CSNK2B	Human	phosphorylation	involved_in	ISO	CSNK2B (Chlorocebus sabaeus)	9068941	PMID:20016039	AgBase	PMID:20016039
CSNK2B	Human	positive regulation of activin receptor signaling pathway	involved_in	IMP		150520179	PMID:19592636	BHF-UCL	PMID:19592636
CSNK2B	Human	positive regulation of SMAD protein signal transduction	involved_in	IDA		150520179	PMID:19592636	BHF-UCL	PMID:19592636
CSNK2B	Human	protein-containing complex assembly	involved_in	NAS		150520179	PMID:19324893	BHF-UCL	PMID:19324893
CSNK2B	Human	response to testosterone		ISO	Csnk2b (Rattus norvegicus)	9068941		RGD	PMID:8173590 and REF_RGD_ID:728274
CSNK2B	Human	signal transduction	involved_in	TAS		150520179	PMID:2513884	UniProt	PMID:2513884
CSNK2B	Human	symbiont-mediated disruption of host cell PML body	involved_in	IDA		150520179	PMID:20719947	UniProt	PMID:20719947
CSNK2B	Human	Wnt signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0879	150520179		UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CSNK2B	Human	cell projection		ISO	Csnk2b (Rattus norvegicus)	9068941		RGD	PMID:11068334 and REF_RGD_ID:11565824
CSNK2B	Human	chromatin		ISO	Csnk2b (Rattus norvegicus)	9068941		RGD	PMID:9916157 and REF_RGD_ID:11565845
CSNK2B	Human	chromatin	is_active_in	IDA		150520179	PMID:31341047	UniProt	PMID:31341047
CSNK2B	Human	cytoplasm	located_in	IDA		150520179	PMID:19233263	BHF-UCL	PMID:19233263
CSNK2B	Human	cytoplasm	is_active_in	IBA	FB:FBgn0000259 more ...	150520179		GO_Central	GO_REF:0000033
CSNK2B	Human	cytosol	located_in	TAS		150520179		Reactome	Reactome:R-HSA-201717 more ...
CSNK2B	Human	extracellular exosome	located_in	HDA		150520179	PMID:20458337	UniProt	PMID:20458337
CSNK2B	Human	extracellular region	located_in	TAS		150520179		Reactome	Reactome:R-HSA-6798748 and Reactome:R-HSA-6800434
CSNK2B	Human	fibrillar center	located_in	IDA		150520179		HPA	GO_REF:0000052
CSNK2B	Human	ficolin-1-rich granule lumen	located_in	TAS		150520179		Reactome	Reactome:R-HSA-6800434
CSNK2B	Human	nuclear matrix		ISO	Csnk2b (Rattus norvegicus)	9068941		RGD	PMID:9548568 and REF_RGD_ID:11565140
CSNK2B	Human	nucleoplasm	located_in	IDA		150520179		HPA	GO_REF:0000052
CSNK2B	Human	nucleoplasm	located_in	TAS		150520179		Reactome	Reactome:R-HSA-6805059 more ...
CSNK2B	Human	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	150520179		UniProt	GO_REF:0000043
CSNK2B	Human	nucleus	located_in	HDA		150520179	PMID:21630459	UniProt	PMID:21630459
CSNK2B	Human	nucleus	located_in	IDA		150520179	PMID:21282530	UniProt	PMID:21282530
CSNK2B	Human	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	150520179		UniProt	GO_REF:0000044
CSNK2B	Human	PcG protein complex	located_in	IDA		150520179	PMID:21282530	UniProt	PMID:21282530
CSNK2B	Human	plasma membrane	located_in	IDA		150520179	PMID:19233263	BHF-UCL	PMID:19233263
CSNK2B	Human	PML body	is_active_in	IDA		150520179	PMID:20719947	UniProt	PMID:20719947
CSNK2B	Human	protein kinase CK2 complex	part_of	ISS	ComplexPortal:CPX-914	150520179		ComplexPortal	GO_REF:0000114
CSNK2B	Human	protein kinase CK2 complex	part_of	IBA	FB:FBgn0000259 more ...	150520179		GO_Central	GO_REF:0000033
CSNK2B	Human	protein kinase CK2 complex	part_of	IEA	UniRule:UR000101454	150520179		UniProt	GO_REF:0000104
CSNK2B	Human	protein kinase CK2 complex	part_of	NAS		150520179	PMID:2666134	UniProt	PMID:2666134
CSNK2B	Human	protein kinase CK2 complex	part_of	IEA	InterPro:IPR000704 more ...	150520179		InterPro	GO_REF:0000002
CSNK2B	Human	protein kinase CK2 complex	part_of	IDA		150520179	PMID:15723517	CAFA	PMID:15723517
CSNK2B	Human	protein kinase CK2 complex	part_of	IPI		150520179	PMID:22506723	ComplexPortal	PMID:22506723
CSNK2B	Human	secretory granule lumen	located_in	TAS		150520179		Reactome	Reactome:R-HSA-6798748

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CSNK2B	Human	chromatin binding	enables	IDA		150520179	PMID:25519132	MGI	PMID:25519132
CSNK2B	Human	identical protein binding	enables	IPI	UniProtKB:P67870	150520179	PMID:10094392 more ...	IntAct	PMID:10094392 more ...
CSNK2B	Human	kinase activity	enables	IEA	UniProtKB-KW:KW-0418	150520179		UniProt	GO_REF:0000043
CSNK2B	Human	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	150520179		UniProt	GO_REF:0000043
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:P68400	150520179	PMID:11574463 more ...	IntAct	PMID:11574463 more ...
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:O00257-3 more ...	150520179	PMID:21282530	IntAct	PMID:21282530
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:Q9JK25	150520179	PMID:20664522	IntAct	PMID:20664522
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:P19784	150520179	PMID:23455922 and PMID:26496610	IntAct	PMID:23455922 and PMID:26496610
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:P97784 and UniProtKB:Q9WTL8	150520179	PMID:26562092	IntAct	PMID:26562092
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:O00555	150520179	PMID:21078624	IntAct	PMID:21078624
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:P68400 and UniProtKB:Q96EB6	150520179	PMID:21968188	IntAct	PMID:21968188
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:Q6VY07	150520179	PMID:16977309	IntAct	PMID:16977309
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:P51812	150520179	PMID:31980649	IntAct	PMID:31980649
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:P19784 more ...	150520179	PMID:27705803	IntAct	PMID:27705803
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:O08785 more ...	150520179	PMID:23555304	IntAct	PMID:23555304
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:O75582 more ...	150520179	PMID:33961781	IntAct	PMID:33961781
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:O75582 more ...	150520179	PMID:21988832	IntAct	PMID:21988832
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:P19784 more ...	150520179	PMID:35271311	IntAct	PMID:35271311
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:O43711 more ...	150520179	PMID:32296183	IntAct	PMID:32296183
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:O75582 more ...	150520179	PMID:32707033	IntAct	PMID:32707033
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:P19784 more ...	150520179	PMID:10094392	IntAct	PMID:10094392
CSNK2B	Human	protein binding	enables	IPI	UniProtKB:P19784 and UniProtKB:P68400	150520179	PMID:14667819 and PMID:19011756	IntAct	PMID:14667819 and PMID:19011756
CSNK2B	Human	protein domain specific binding	enables	IPI	UniProtKB:Q99698	150520179	PMID:11984006	UniProt	PMID:11984006
CSNK2B	Human	protein kinase regulator activity	enables	NAS		150520179	PMID:2666134	UniProt	PMID:2666134
CSNK2B	Human	protein kinase regulator activity	enables	IBA	CGD:CAL0000176259 more ...	150520179		GO_Central	GO_REF:0000033
CSNK2B	Human	protein kinase regulator activity	enables	IEA	InterPro:IPR000704 more ...	150520179		InterPro	GO_REF:0000002
CSNK2B	Human	protein serine/threonine kinase activity	enables	IDA		150520179	PMID:15723517	CAFA	PMID:15723517
CSNK2B	Human	protein serine/threonine kinase activity	contributes_to	TAS		150520179	PMID:1856204 and PMID:28031292	BHF-UCL	PMID:1856204 and PMID:28031292
CSNK2B	Human	protein-macromolecule adaptor activity	enables	IDA		150520179	PMID:31341047	UniProt	PMID:31341047
CSNK2B	Human	ribonucleoprotein complex binding		ISO	Csnk2b (Rattus norvegicus)	9068941		RGD	PMID:10381337 and REF_RGD_ID:11565844
CSNK2B	Human	RNA polymerase II-specific DNA-binding transcription factor binding	enables	IPI	UniProtKB:Q03014	150520179	PMID:19324893	BHF-UCL	PMID:19324893
CSNK2B	Human	signaling receptor binding	enables	IPI	UniProtKB:Q96A54	150520179	PMID:19233263	BHF-UCL	PMID:19233263
CSNK2B	Human	signaling receptor binding	enables	IPI	UniProtKB:P37023	150520179	PMID:19592636	BHF-UCL	PMID:19592636

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CSNK2B	Human	mitochondrial autophagy pathway		TAS		10400888		RGD

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CSNK2B	Human	measles pathway		IEA		6907045		KEGG	hsa:05162
CSNK2B	Human	ribosome biogenesis pathway		IEA		6907045		KEGG	hsa:03008
CSNK2B	Human	Wnt signaling pathway		IEA		6907045		KEGG	hsa:04310

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CSNK2B	Human	E-cadherin signaling pathway		EXP		6484113		PID	PID:200124
CSNK2B	Human	nuclear factor kappa B signaling pathway		EXP		6484113		PID	PID:200021

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CSNK2B	Human	Autosomal dominant inheritance		IAGP		8699517		HPO	MIM:618732
CSNK2B	Human	Delayed ability to walk		IAGP		8699517		HPO	MIM:618732
CSNK2B	Human	Downturned corners of mouth		IAGP		8699517		HPO	MIM:618732
CSNK2B	Human	Generalized hypotonia		IAGP		8699517		HPO	MIM:618732
CSNK2B	Human	Intellectual disability		IAGP		8699517		HPO	MIM:618732
CSNK2B	Human	Mandibular prognathia		IAGP		8699517		HPO	MIM:618732
CSNK2B	Human	Myoclonic seizure		IAGP		8699517		HPO	MIM:618732
CSNK2B	Human	Open mouth		IAGP		8699517		HPO	MIM:618732
CSNK2B	Human	Protruding tongue		IAGP		8699517		HPO	MIM:618732
CSNK2B	Human	Smooth philtrum		IAGP		8699517		HPO	MIM:618732

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CSNK2B	Human	Abnormal facial shape		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Dysmorphic facies	ClinVar	PMID:25741868 more ...
CSNK2B	Human	Asymmetry of the ears		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Asymmetry of the ears	ClinVar	PMID:25741868 more ...
CSNK2B	Human	Autistic behavior		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism spectrum disorder	ClinVar	PMID:25741868
CSNK2B	Human	Deeply set eye		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Enophthalmos	ClinVar	PMID:25741868 more ...
CSNK2B	Human	Global developmental delay		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental delay	ClinVar
CSNK2B	Human	Intellectual disability		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar
CSNK2B	Human	Intellectual disability		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar	PMID:25741868 more ...
CSNK2B	Human	Mandibular prognathia		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Mandibular prognathia	ClinVar	PMID:25741868 more ...
CSNK2B	Human	Megacolon		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Megacolon	ClinVar	PMID:21681106
CSNK2B	Human	Pointed chin		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Pointed chin	ClinVar	PMID:25741868 more ...
CSNK2B	Human	Seizure		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Seizures	ClinVar
CSNK2B	Human	Seizure		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Seizure	ClinVar	PMID:25741868 more ...
CSNK2B	Human	Syndactyly		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Webbed fingers or toes	ClinVar	PMID:25741868 more ...
CSNK2B	Human	Tapered finger		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Tapered fingers	ClinVar	PMID:25741868 more ...
CSNK2B	Human	Thin upper lip vermilion		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Thin upper lip vermilion	ClinVar	PMID:25741868 more ...
CSNK2B	Human	Toe clinodactyly		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Toe clinodactyly	ClinVar	PMID:25741868 more ...
CSNK2B	Human	Underdeveloped nasal alae		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Underdeveloped nasal alae	ClinVar	PMID:25741868 more ...

#	Reference Title	Reference Citation
1.	Morphological changes and expression of protein kinase CK2 beta subunit in the microglia after hypoglossal nerve transection.	Gesase AP and Kiyama H, J Neurocytol. 2000 Jan;29(1):61-6.
2.	Expression of protein kinase CK2 in astroglial cells of normal and neovascularized retina.	Kramerov AA, etal., Am J Pathol. 2006 May;168(5):1722-36.
3.	Quantitative proteome profiling of human myoma and myometrium tissue reveals kinase expression signatures with potential for therapeutic intervention.	Lemeer S, etal., Proteomics. 2015 Jan;15(2-3):356-64. doi: 10.1002/pmic.201400213. Epub 2014 Dec 17.
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Selective removal of mitochondria via mitophagy: distinct pathways for different mitochondrial stresses.	Wei H, etal., Biochim Biophys Acta. 2015 Oct;1853(10 Pt B):2784-90. doi: 10.1016/j.bbamcr.2015.03.013. Epub 2015 Apr 1.
8.	Differential gene expression in infarct scar and viable myocardium from rat heart following coronary ligation.	Xu YJ, etal., J Cell Mol Med. 2004 Jan-Mar;8(1):85-92.

PMID:1541298	PMID:1694965	PMID:1856204	PMID:1939094	PMID:2276748	PMID:2300566	PMID:2513884	PMID:2666134	PMID:7491787	PMID:7578274	PMID:7689229	PMID:7768894
PMID:7794916	PMID:7838153	PMID:7942276	PMID:8089108	PMID:8107101	PMID:8119294	PMID:8139011	PMID:8349691	PMID:8548340	PMID:8659106	PMID:8806611	PMID:8806671
PMID:8812450	PMID:8943850	PMID:9013635	PMID:9042965	PMID:9092824	PMID:9151826	PMID:9185604	PMID:9188720	PMID:9299532	PMID:9478999	PMID:9503014	PMID:9571630
PMID:9654140	PMID:9677319	PMID:9685505	PMID:9738462	PMID:9881639	PMID:10094392	PMID:10094400	PMID:10214938	PMID:10327653	PMID:10381337	PMID:10398585	PMID:10403822
PMID:10491318	PMID:10506147	PMID:10512750	PMID:10549165	PMID:10549869	PMID:10561590	PMID:10641798	PMID:10679299	PMID:10747897	PMID:10753899	PMID:10764587	PMID:10799509
PMID:10931861	PMID:10944435	PMID:10951572	PMID:10964683	PMID:10984616	PMID:11062072	PMID:11092945	PMID:11239457	PMID:11298324	PMID:11378439	PMID:11396975	PMID:11485312
PMID:11535139	PMID:11546811	PMID:11574463	PMID:11583622	PMID:11709713	PMID:11710515	PMID:11713579	PMID:11827166	PMID:11827167	PMID:11827168	PMID:11827171	PMID:11827172
PMID:11827174	PMID:11827176	PMID:11827177	PMID:11827178	PMID:11861906	PMID:11883897	PMID:11940573	PMID:11972058	PMID:11984006	PMID:12037680	PMID:12102635	PMID:12145206
PMID:12220519	PMID:12393879	PMID:12432063	PMID:12470599	PMID:12477932	PMID:12511551	PMID:12527891	PMID:12591939	PMID:12628923	PMID:12748192	PMID:12769847	PMID:12804768
PMID:12901717	PMID:12902976	PMID:12954211	PMID:14574404	PMID:14634006	PMID:14645218	PMID:14656967	PMID:14667819	PMID:14744259	PMID:15218032	PMID:15225637	PMID:15485924
PMID:15489334	PMID:15723517	PMID:15893730	PMID:15940255	PMID:16159877	PMID:16225457	PMID:16335536	PMID:16713569	PMID:16741955	PMID:16806200	PMID:16895915	PMID:16977309
PMID:17038328	PMID:17081983	PMID:17092945	PMID:17209043	PMID:17353931	PMID:17391060	PMID:17643375	PMID:17681943	PMID:17709345	PMID:17912454	PMID:18062282	PMID:18086883
PMID:18186541	PMID:18276110	PMID:18451726	PMID:18469858	PMID:18508765	PMID:18553059	PMID:18560763	PMID:18583988	PMID:18587631	PMID:18824508	PMID:18835879	PMID:18839019
PMID:19011756	PMID:19039329	PMID:19056846	PMID:19091862	PMID:19233263	PMID:19294699	PMID:19324893	PMID:19542537	PMID:19592636	PMID:19615732	PMID:19616115	PMID:19738201
PMID:19759161	PMID:19808671	PMID:19851445	PMID:19851886	PMID:19913121	PMID:20044958	PMID:20372791	PMID:20458337	PMID:20545769	PMID:20576813	PMID:20628086	PMID:20664522
PMID:20719947	PMID:20797629	PMID:20811636	PMID:20869595	PMID:21068236	PMID:21078624	PMID:21142136	PMID:21282530	PMID:21323541	PMID:21486957	PMID:21507959	PMID:21514207
PMID:21515457	PMID:21630459	PMID:21653829	PMID:21675959	PMID:21750988	PMID:21755461	PMID:21777522	PMID:21873635	PMID:21900206	PMID:21944249	PMID:21968188	PMID:21988832
PMID:22174317	PMID:22325352	PMID:22506723	PMID:22562247	PMID:22623428	PMID:22658674	PMID:22810585	PMID:22863883	PMID:22939629	PMID:22990118	PMID:23076192	PMID:23383273
PMID:23402259	PMID:23455922	PMID:23508102	PMID:23521802	PMID:23555304	PMID:23580615	PMID:23599180	PMID:23602568	PMID:23751493	PMID:23752268	PMID:23816881	PMID:23858473
PMID:24104479	PMID:24175891	PMID:24216761	PMID:24366813	PMID:24457600	PMID:24535599	PMID:24711643	PMID:24981860	PMID:25344690	PMID:25437307	PMID:25486430	PMID:25519132
PMID:25640309	PMID:25648896	PMID:25693804	PMID:25737280	PMID:25788269	PMID:25852190	PMID:25921289	PMID:26108355	PMID:26186194	PMID:26264872	PMID:26344197	PMID:26496610
PMID:26549023	PMID:26562092	PMID:26562283	PMID:26582913	PMID:26673895	PMID:26711270	PMID:26725010	PMID:26816005	PMID:26972000	PMID:27129302	PMID:27173435	PMID:27609421
PMID:27634302	PMID:27684187	PMID:27705803	PMID:27920254	PMID:27959425	PMID:28031292	PMID:28077445	PMID:28201649	PMID:28298427	PMID:28514442	PMID:28515276	PMID:28572157
PMID:28585349	PMID:28700943	PMID:29037858	PMID:29128334	PMID:29229926	PMID:29298432	PMID:29467282	PMID:29483533	PMID:29491746	PMID:29509190	PMID:29564676	PMID:29778533
PMID:29802200	PMID:29845934	PMID:29997244	PMID:29999490	PMID:30196744	PMID:30240640	PMID:30279146	PMID:30462309	PMID:30463901	PMID:30554943	PMID:30655572	PMID:30833792
PMID:30884312	PMID:30885251	PMID:30948266	PMID:31076518	PMID:31091453	PMID:31239290	PMID:31340145	PMID:31341047	PMID:31560077	PMID:31586073	PMID:31617661	PMID:31678930
PMID:31722399	PMID:31753913	PMID:31784560	PMID:31832700	PMID:31901862	PMID:31910234	PMID:31941600	PMID:31980649	PMID:32129710	PMID:32296183	PMID:32353859	PMID:32416067
PMID:32460013	PMID:32552912	PMID:32640226	PMID:32687490	PMID:32707033	PMID:32780723	PMID:32814053	PMID:33060197	PMID:33166063	PMID:33187986	PMID:33239621	PMID:33526068
PMID:33545068	PMID:33640491	PMID:33658012	PMID:33729478	PMID:33916271	PMID:33961781	PMID:34041744	PMID:34079125	PMID:34163012	PMID:34244565	PMID:34370157	PMID:34373451
PMID:34578187	PMID:34597346	PMID:34728620	PMID:35140242	PMID:35182466	PMID:35211278	PMID:35253629	PMID:35256949	PMID:35271311	PMID:35325203	PMID:35446349	PMID:35563538
PMID:35813202	PMID:35831314	PMID:35869491	PMID:35871297	PMID:35914814	PMID:35944360	PMID:36057605	PMID:36089195	PMID:36215168	PMID:36244648	PMID:36273042	PMID:36373674
PMID:36398662	PMID:36424410	PMID:36537216	PMID:36617978	PMID:36629882	PMID:36736316	PMID:36833176	PMID:36949045	PMID:37014752	PMID:37022795	PMID:37094077	PMID:37314216
PMID:37448957	PMID:37483225	PMID:37705046	PMID:37974198	PMID:38113892	PMID:38177924	PMID:38225382	PMID:38580884	PMID:39147351	PMID:39236211	PMID:39358380	PMID:39501047

CSNK2B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	31,666,080 - 31,670,067 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	31,665,227 - 31,670,343 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	31,633,857 - 31,637,844 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	31,741,636 - 31,745,822 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	31,741,635 - 31,745,822	NCBI
Celera	6	33,231,878 - 33,236,064 (+)	NCBI		Celera
Cytogenetic Map	6	p21.33	NCBI
HuRef	6	31,419,882 - 31,424,068 (+)	NCBI		HuRef
CHM1_1	6	31,635,793 - 31,639,979 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	31,519,114 - 31,523,101 (+)	NCBI		T2T-CHM13v2.0

Csnk2b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	35,335,171 - 35,341,029 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	35,335,172 - 35,341,029 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	35,116,195 - 35,122,053 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	35,116,196 - 35,122,053 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	35,253,140 - 35,258,392 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	34,724,251 - 34,729,503 (-)	NCBI		MGSCv36	mm8
Celera	17	38,213,147 - 38,218,397 (-)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	18.59	NCBI

Csnk2b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	3,704,833 - 3,709,999 (+)	NCBI		GRCr8
mRatBN7.2	20	3,700,363 - 3,705,331 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,698,733 - 3,707,133 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,399,893 - 4,404,317 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,761,951 - 3,766,375 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,299,839 - 4,304,262 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,108,692 - 5,113,675 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,106,890 - 5,113,112 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	7,181,951 - 7,186,861 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	3,764,565 - 3,768,985 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	3,764,954 - 3,769,209 (+)	NCBI
Celera	20	4,320,311 - 4,324,731 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

Csnk2b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	210,838 - 219,694 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	210,541 - 215,725 (+)	NCBI	ChiLan1.0	ChiLan1.0

CSNK2B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	46,143,115 - 46,147,114 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	42,104,623 - 42,108,622 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	31,327,250 - 31,331,250 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	32,216,283 - 32,221,131 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

CSNK2B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	1,149,467 - 1,154,417 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	1,149,548 - 1,154,418 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	1,285,676 - 1,290,594 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	1,294,469 - 1,299,387 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	1,294,519 - 1,301,941 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	1,153,768 - 1,158,617 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	1,221,041 - 1,225,991 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	1,288,118 - 1,293,071 (+)	NCBI		UU_Cfam_GSD_1.0

Csnk2b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	35,698,801 - 35,703,748 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936727	1,857,596 - 1,862,002 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936727	1,857,596 - 1,862,551 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CSNK2B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	23,786,717 - 23,788,302 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1 Ensembl	7	23,780,210 - 23,792,502 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	23,781,194 - 23,787,914 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	27,464,062 - 27,471,599 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CSNK2B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	40,354,520 - 40,359,136 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	40,352,367 - 40,358,401 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	31,577,195 - 31,581,146 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Csnk2b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624754	24,533,134 - 24,538,233 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in CSNK2B
141 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
NM_001320.7(CSNK2B):c.27del (p.Ser8_Trp9insTer)	deletion	not provided [RCV000519863]	Chr6:31666857 [GRCh38] Chr6:31634634 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.494A>G (p.His165Arg)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV002246284]\|See cases [RCV001291643]\|not provided [RCV004584874]	Chr6:31669445 [GRCh38] Chr6:31637222 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.292-2A>C	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV001331966]	Chr6:31669095 [GRCh38] Chr6:31636872 [GRCh37] Chr6:6p21.33	pathogenic
GRCh38/hg38 6p25.3-12.3(chr6:156974-46789291)x3	copy number gain	See cases [RCV000143497]	Chr6:156974..46789291 [GRCh38] Chr6:156974..46757028 [GRCh37] Chr6:101974..46864987 [NCBI36] Chr6:6p25.3-12.3	pathogenic
NM_001320.7(CSNK2B):c.139C>T (p.Arg47Ter)	single nucleotide variant	CSNK2B-related disorder [RCV003942606]\|Inborn genetic diseases [RCV001267434]\|Poirier-Bienvenu neurodevelopmental syndrome [RCV002468581]\|not provided [RCV001281589]	Chr6:31667934 [GRCh38] Chr6:31635711 [GRCh37] Chr6:6p21.33	pathogenic\|uncertain significance
NM_001320.7(CSNK2B):c.73-2A>G	single nucleotide variant	Inborn genetic diseases [RCV000624000]\|Poirier-Bienvenu neurodevelopmental syndrome [RCV004797842]	Chr6:31667866 [GRCh38] Chr6:31635643 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.94G>A (p.Asp32Asn)	single nucleotide variant	CSNK2B-related disorder [RCV003411469]\|Inborn genetic diseases [RCV000624714]\|Poirier-Bienvenu neurodevelopmental syndrome [RCV003139949]\|Seizure [RCV002221564]\|not provided [RCV001860419]	Chr6:31667889 [GRCh38] Chr6:31635666 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic\|uncertain significance\|no classifications from unflagged records
NM_001320.7(CSNK2B):c.105dup (p.Leu36fs)	duplication	not provided [RCV000598578]	Chr6:31667899..31667900 [GRCh38] Chr6:31635676..31635677 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.2T>A (p.Met1Lys)	single nucleotide variant	not provided [RCV000681657]	Chr6:31666833 [GRCh38] Chr6:31634610 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.181G>T (p.Glu61Ter)	single nucleotide variant	not provided [RCV000681658]	Chr6:31668544 [GRCh38] Chr6:31636321 [GRCh37] Chr6:6p21.33	likely pathogenic
GRCh37/hg19 6p21.33(chr6:31384577-31902308)x3	copy number gain	See cases [RCV000448679]	Chr6:31384577..31902308 [GRCh37] Chr6:6p21.33	uncertain significance
GRCh37/hg19 6p25.3-q27(chr6:156975-170919482)x3	copy number gain	See cases [RCV000512067]	Chr6:156975..170919482 [GRCh37] Chr6:6p25.3-q27	pathogenic
GRCh37/hg19 6p25.3-q27(chr6:156975-170919482)	copy number gain	See cases [RCV000510595]	Chr6:156975..170919482 [GRCh37] Chr6:6p25.3-q27	pathogenic
NM_001320.7(CSNK2B):c.36G>A (p.Trp12Ter)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV003448326]\|not provided [RCV000578649]	Chr6:31666867 [GRCh38] Chr6:31634644 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.108dup (p.Thr37fs)	duplication	Intellectual disability and seizures [RCV000495848]\|Poirier-Bienvenu neurodevelopmental syndrome [RCV000993566]	Chr6:31667901..31667902 [GRCh38] Chr6:31635678..31635679 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.491C>T (p.Pro164Leu)	single nucleotide variant	Inborn genetic diseases [RCV003257416]	Chr6:31669442 [GRCh38] Chr6:31637219 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.238T>A (p.Tyr80Asn)	single nucleotide variant	Inborn genetic diseases [RCV000624903]	Chr6:31668601 [GRCh38] Chr6:31636378 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.62TCT[1] (p.Phe22del)	microsatellite	not provided [RCV001760623]	Chr6:31666892..31666894 [GRCh38] Chr6:31634669..31634671 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.367+2T>C	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV001003349]	Chr6:31669174 [GRCh38] Chr6:31636951 [GRCh37] Chr6:6p21.33	pathogenic
GRCh37/hg19 6p25.3-q27(chr6:108666-170980171)x3	copy number gain	not provided [RCV000745403]	Chr6:108666..170980171 [GRCh37] Chr6:6p25.3-q27	pathogenic
GRCh37/hg19 6p25.3-q27(chr6:60107-171054786)x3	copy number gain	not provided [RCV000745400]	Chr6:60107..171054786 [GRCh37] Chr6:6p25.3-q27	pathogenic
GRCh37/hg19 6p25.3-q27(chr6:165632-170919470)x3	copy number gain	not provided [RCV000745404]	Chr6:165632..170919470 [GRCh37] Chr6:6p25.3-q27	pathogenic
GRCh37/hg19 6p22.1-21.32(chr6:28130359-32108367)x3	copy number gain	not provided [RCV000745592]	Chr6:28130359..32108367 [GRCh37] Chr6:6p22.1-21.32	uncertain significance
NM_001320.7(CSNK2B):c.175+2T>G	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV000993565]\|not provided [RCV004818102]	Chr6:31667972 [GRCh38] Chr6:31635749 [GRCh37] Chr6:6p21.33	pathogenic
GRCh37/hg19 6p22.1-q14.1(chr6:29455465-81447367)	copy number gain	not provided [RCV000767714]	Chr6:29455465..81447367 [GRCh37] Chr6:6p22.1-q14.1	pathogenic
NM_001320.7(CSNK2B):c.108T>A (p.Leu36=)	single nucleotide variant	not provided [RCV000884603]	Chr6:31667903 [GRCh38] Chr6:31635680 [GRCh37] Chr6:6p21.33	benign
NM_001320.7(CSNK2B):c.265del (p.Thr90fs)	deletion	Poirier-Bienvenu neurodevelopmental syndrome [RCV000993569]	Chr6:31668627 [GRCh38] Chr6:31636404 [GRCh37] Chr6:6p21.33	pathogenic\|uncertain significance
NM_001320.7(CSNK2B):c.621dup (p.Lys208fs)	duplication	Poirier-Bienvenu neurodevelopmental syndrome [RCV000993568]	Chr6:31669898..31669899 [GRCh38] Chr6:31637675..31637676 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.340T>C (p.Cys114Arg)	single nucleotide variant	not provided [RCV001090484]	Chr6:31669145 [GRCh38] Chr6:31636922 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.367+5del	deletion	Poirier-Bienvenu neurodevelopmental syndrome [RCV002221588]\|Seizure [RCV000845042]\|not provided [RCV001560828]	Chr6:31669177 [GRCh38] Chr6:31636954 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic\|not provided
NM_001320.7(CSNK2B):c.533_534insGT (p.Pro179fs)	insertion	Poirier-Bienvenu neurodevelopmental syndrome [RCV000993567]	Chr6:31669484..31669485 [GRCh38] Chr6:31637261..31637262 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.318T>G (p.Phe106Leu)	single nucleotide variant	not provided [RCV000998553]	Chr6:31669123 [GRCh38] Chr6:31636900 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.229G>T (p.Glu77Ter)	single nucleotide variant	not provided [RCV000851179]	Chr6:31668592 [GRCh38] Chr6:31636369 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.368-2A>G	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV000993570]	Chr6:31669317 [GRCh38] Chr6:31637094 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.291+1G>A	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV004785107]	Chr6:31668655 [GRCh38] Chr6:31636432 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.575T>G (p.Ile192Ser)	single nucleotide variant	not provided [RCV004784794]	Chr6:31669853 [GRCh38] Chr6:31637630 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.72+1G>T	single nucleotide variant	Autism spectrum disorder [RCV003127240]	Chr6:31666904 [GRCh38] Chr6:31634681 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.277G>A (p.Gly93Ser)	single nucleotide variant	not provided [RCV003127091]	Chr6:31668640 [GRCh38] Chr6:31636417 [GRCh37] Chr6:6p21.33	uncertain significance
NC_000006.11:g.(?_30695893)_(31937492_?)dup	duplication	not provided [RCV003107453]	Chr6:30695893..31937492 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.367+6T>C	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV001706783]	Chr6:31669178 [GRCh38] Chr6:31636955 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.229G>A (p.Glu77Lys)	single nucleotide variant	not provided [RCV001561261]	Chr6:31668592 [GRCh38] Chr6:31636369 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.175+217_175+220del	deletion	not provided [RCV001642106]	Chr6:31668187..31668190 [GRCh38] Chr6:31635964..31635967 [GRCh37] Chr6:6p21.33	benign
NM_001320.7(CSNK2B):c.462G>T (p.Thr154=)	single nucleotide variant	not provided [RCV000978390]	Chr6:31669413 [GRCh38] Chr6:31637190 [GRCh37] Chr6:6p21.33	likely benign
NM_001320.7(CSNK2B):c.1A>G (p.Met1Val)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV004726946]\|not provided [RCV001200288]	Chr6:31666832 [GRCh38] Chr6:31634609 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.32C>T (p.Ser11Phe)	single nucleotide variant	not provided [RCV002466997]	Chr6:31666863 [GRCh38] Chr6:31634640 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.268dup (p.Thr90fs)	duplication	CSNK2B-related intellectual disability with or without epilepsy [RCV001563630]	Chr6:31668630..31668631 [GRCh38] Chr6:31636407..31636408 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.307C>T (p.Gln103Ter)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV004796791]\|not provided [RCV003234508]	Chr6:31669112 [GRCh38] Chr6:31636889 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.*104C>T	single nucleotide variant	not provided [RCV001662895]	Chr6:31670030 [GRCh38] Chr6:31637807 [GRCh37] Chr6:6p21.33	benign
NM_001320.7(CSNK2B):c.73-1G>A	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV002255105]	Chr6:31667867 [GRCh38] Chr6:31635644 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.257G>C (p.Arg86Pro)	single nucleotide variant	not provided [RCV002467250]	Chr6:31668620 [GRCh38] Chr6:31636397 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.325T>C (p.Cys109Arg)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV002472183]	Chr6:31669130 [GRCh38] Chr6:31636907 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.332G>T (p.Arg111Leu)	single nucleotide variant	not provided [RCV004814775]	Chr6:31669137 [GRCh38] Chr6:31636914 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.396_411delinsACTG (p.Met132_Cys137delinsIleLeu)	indel	Poirier-Bienvenu neurodevelopmental syndrome [RCV004799136]	Chr6:31669347..31669362 [GRCh38] Chr6:31637124..31637139 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.101T>G (p.Phe34Cys)	single nucleotide variant	not provided [RCV001682651]	Chr6:31667896 [GRCh38] Chr6:31635673 [GRCh37] Chr6:6p21.33	likely pathogenic
GRCh37/hg19 6p21.33-21.31(chr6:31036397-34088832)x3	copy number gain	not provided [RCV001005791]	Chr6:31036397..34088832 [GRCh37] Chr6:6p21.33-21.31	likely pathogenic
NM_001320.7(CSNK2B):c.2T>G (p.Met1Arg)	single nucleotide variant	not provided [RCV001658785]	Chr6:31666833 [GRCh38] Chr6:31634610 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.175+213_175+215del	deletion	not provided [RCV001684298]	Chr6:31668182..31668184 [GRCh38] Chr6:31635959..31635961 [GRCh37] Chr6:6p21.33	benign
NM_001320.7(CSNK2B):c.491C>G (p.Pro164Arg)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV001706908]\|not provided [RCV004774462]	Chr6:31669442 [GRCh38] Chr6:31637219 [GRCh37] Chr6:6p21.33	likely pathogenic\|uncertain significance
NM_001320.7(CSNK2B):c.-11-28A>C	single nucleotide variant	not provided [RCV001649101]	Chr6:31666793 [GRCh38] Chr6:31634570 [GRCh37] Chr6:6p21.33	benign
NM_001320.7(CSNK2B):c.*31A>T	single nucleotide variant	not provided [RCV001652060]	Chr6:31669957 [GRCh38] Chr6:31637734 [GRCh37] Chr6:6p21.33	benign
NM_001320.7(CSNK2B):c.292-2A>T	single nucleotide variant	not provided [RCV001531621]	Chr6:31669095 [GRCh38] Chr6:31636872 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.303C>G (p.Tyr101Ter)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV001249833]	Chr6:31669108 [GRCh38] Chr6:31636885 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.68G>T (p.Cys23Phe)	single nucleotide variant	not provided [RCV001090483]	Chr6:31666899 [GRCh38] Chr6:31634676 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.554_555dup (p.Arg186fs)	duplication	Poirier-Bienvenu neurodevelopmental syndrome [RCV001253734]	Chr6:31669503..31669504 [GRCh38] Chr6:31637280..31637281 [GRCh37] Chr6:6p21.33	likely pathogenic\|uncertain significance
NM_001320.7(CSNK2B):c.72+1G>A	single nucleotide variant	Inborn genetic diseases [RCV001265893]\|Poirier-Bienvenu neurodevelopmental syndrome [RCV001732100]\|not provided [RCV004727061]	Chr6:31666904 [GRCh38] Chr6:31634681 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.245T>A (p.Leu82Ter)	single nucleotide variant	Inborn genetic diseases [RCV001266304]	Chr6:31668608 [GRCh38] Chr6:31636385 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.560T>C (p.Leu187Pro)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV001261948]	Chr6:31669838 [GRCh38] Chr6:31637615 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.256C>T (p.Arg86Cys)	single nucleotide variant	Inborn genetic diseases [RCV001266165]\|Poirier-Bienvenu neurodevelopmental syndrome [RCV004796398]\|not provided [RCV001664792]	Chr6:31668619 [GRCh38] Chr6:31636396 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic\|uncertain significance
NM_001320.7(CSNK2B):c.566G>T (p.Gly189Val)	single nucleotide variant	Inborn genetic diseases [RCV001265804]	Chr6:31669844 [GRCh38] Chr6:31637621 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.577del (p.His193fs)	deletion	not provided [RCV001280794]	Chr6:31669854 [GRCh38] Chr6:31637631 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.91C>T (p.Gln31Ter)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV001376051]	Chr6:31667886 [GRCh38] Chr6:31635663 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.72+78G>A	single nucleotide variant	not provided [RCV001694703]	Chr6:31666981 [GRCh38] Chr6:31634758 [GRCh37] Chr6:6p21.33	benign
NM_001320.7(CSNK2B):c.292-132A>G	single nucleotide variant	not provided [RCV001539744]	Chr6:31668965 [GRCh38] Chr6:31636742 [GRCh37] Chr6:6p21.33	benign
NM_001320.7(CSNK2B):c.94G>T (p.Asp32Tyr)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV002249847]\|not provided [RCV004820239]	Chr6:31667889 [GRCh38] Chr6:31635666 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.107T>C (p.Leu36Pro)	single nucleotide variant	Inborn genetic diseases [RCV004612160]\|not provided [RCV002251812]	Chr6:31667902 [GRCh38] Chr6:31635679 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.472del (p.Tyr158fs)	deletion	Poirier-Bienvenu neurodevelopmental syndrome [RCV001730004]	Chr6:31669423 [GRCh38] Chr6:31637200 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.292-2A>G	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV001775388]	Chr6:31669095 [GRCh38] Chr6:31636872 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.367+1G>A	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV001733825]	Chr6:31669173 [GRCh38] Chr6:31636950 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.557+1G>A	single nucleotide variant	not provided [RCV001799935]	Chr6:31669509 [GRCh38] Chr6:31637286 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.557G>T (p.Arg186Met)	single nucleotide variant	not provided [RCV001766909]	Chr6:31669508 [GRCh38] Chr6:31637285 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.332G>C (p.Arg111Pro)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV001775375]\|not provided [RCV004815630]	Chr6:31669137 [GRCh38] Chr6:31636914 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.565G>A (p.Gly189Ser)	single nucleotide variant	not provided [RCV001770655]	Chr6:31669843 [GRCh38] Chr6:31637620 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.236T>C (p.Leu79Pro)	single nucleotide variant	not provided [RCV001779827]	Chr6:31668599 [GRCh38] Chr6:31636376 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.631G>A (p.Val211Ile)	single nucleotide variant	not provided [RCV001786870]	Chr6:31669909 [GRCh38] Chr6:31637686 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.194dup (p.Asn65fs)	duplication	not provided [RCV001816422]	Chr6:31668555..31668556 [GRCh38] Chr6:31636332..31636333 [GRCh37] Chr6:6p21.33	likely pathogenic
NC_000006.11:g.28005012_31683185del	deletion	Megacolon [RCV001290055]	Chr6:28005012..31683185 [GRCh37] Chr6:6p22.1-21.33	likely pathogenic
NM_001320.7(CSNK2B):c.560T>G (p.Leu187Arg)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV001808922]	Chr6:31669838 [GRCh38] Chr6:31637615 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.146C>A (p.Ala49Asp)	single nucleotide variant	not provided [RCV001806939]	Chr6:31667941 [GRCh38] Chr6:31635718 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.251A>T (p.His84Leu)	single nucleotide variant	not provided [RCV004801560]	Chr6:31668614 [GRCh38] Chr6:31636391 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.70G>T (p.Glu24Ter)	single nucleotide variant	CSNK2B-related disorder [RCV004545832]	Chr6:31666901 [GRCh38] Chr6:31634678 [GRCh37] Chr6:6p21.33	not provided
NM_001320.7(CSNK2B):c.467G>A (p.Gly156Asp)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV001842238]	Chr6:31669418 [GRCh38] Chr6:31637195 [GRCh37] Chr6:6p21.33	pathogenic\|conflicting interpretations of pathogenicity
NM_001320.7(CSNK2B):c.474C>G (p.Tyr158Ter)	single nucleotide variant	not provided [RCV001847406]	Chr6:31669425 [GRCh38] Chr6:31637202 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.467_468delinsTT (p.Gly156Val)	indel	Poirier-Bienvenu neurodevelopmental syndrome [RCV001842244]	Chr6:31669418..31669419 [GRCh38] Chr6:31637195..31637196 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.72+2T>G	single nucleotide variant	Autosomal dominant non-syndromic intellectual disability [RCV002052288]	Chr6:31666905 [GRCh38] Chr6:31634682 [GRCh37] Chr6:6p21.33	likely pathogenic
GRCh37/hg19 6p21.33(chr6:31384577-31902308)	copy number gain	not specified [RCV002053564]	Chr6:31384577..31902308 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.583_586dup (p.Ala196fs)	duplication	Poirier-Bienvenu neurodevelopmental syndrome [RCV001825158]	Chr6:31669859..31669860 [GRCh38] Chr6:31637636..31637637 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.291+1G>T	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV002071022]	Chr6:31668655 [GRCh38] Chr6:31636432 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.202C>T (p.Gln68Ter)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV002246197]\|not provided [RCV004729111]	Chr6:31668565 [GRCh38] Chr6:31636342 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.304C>T (p.Gln102Ter)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV002468656]\|not provided [RCV002244566]	Chr6:31669109 [GRCh38] Chr6:31636886 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.374C>G (p.Ser125Ter)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV002221700]		pathogenic
NM_001320.7(CSNK2B):c.94G>C (p.Asp32His)	single nucleotide variant	Intellectual disability-craniodigital syndrome [RCV002221707]		pathogenic
NC_000006.11:g.(?_30695893)_(36953949_?)dup	duplication	Proteasome-associated autoinflammatory syndrome 1 [RCV003113679]	Chr6:30695893..36953949 [GRCh37] Chr6:6p21.33-21.2	uncertain significance
NM_001320.7(CSNK2B):c.27G>A (p.Trp9Ter)	single nucleotide variant	not provided [RCV003156489]	Chr6:31666858 [GRCh38] Chr6:31634635 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.349C>T (p.Gln117Ter)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV002227636]	Chr6:31669154 [GRCh38] Chr6:31636931 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.116T>G (p.Leu39Arg)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV002249016]	Chr6:31667911 [GRCh38] Chr6:31635688 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.291G>A (p.Met97Ile)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV002249017]	Chr6:31668654 [GRCh38] Chr6:31636431 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.495_496del (p.Met166fs)	microsatellite	Inborn genetic diseases [RCV003164406]\|Neurodevelopmental disorder [RCV002277651]\|Poirier-Bienvenu neurodevelopmental syndrome [RCV004770436]	Chr6:31669444..31669445 [GRCh38] Chr6:31637221..31637222 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.410G>A (p.Cys137Tyr)	single nucleotide variant	Neurodevelopmental disorder [RCV002277666]\|Poirier-Bienvenu neurodevelopmental syndrome [RCV004596533]	Chr6:31669361 [GRCh38] Chr6:31637138 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.99dup (p.Phe34fs)	duplication	Poirier-Bienvenu neurodevelopmental syndrome [RCV002289423]	Chr6:31667891..31667892 [GRCh38] Chr6:31635668..31635669 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.446C>G (p.Ser149Ter)	single nucleotide variant	Inborn genetic diseases [RCV003308101]\|Poirier-Bienvenu neurodevelopmental syndrome [RCV002290076]	Chr6:31669397 [GRCh38] Chr6:31637174 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.365T>C (p.Ile122Thr)	single nucleotide variant	not provided [RCV002474155]	Chr6:31669170 [GRCh38] Chr6:31636947 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.569T>C (p.Phe190Ser)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV002470194]	Chr6:31669847 [GRCh38] Chr6:31637624 [GRCh37] Chr6:6p21.33	likely pathogenic\|uncertain significance
NM_001320.7(CSNK2B):c.592dup (p.Gln198fs)	duplication	Poirier-Bienvenu neurodevelopmental syndrome [RCV002468693]	Chr6:31669868..31669869 [GRCh38] Chr6:31637645..31637646 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.286C>T (p.Gln96Ter)	single nucleotide variant	not provided [RCV002300878]	Chr6:31668649 [GRCh38] Chr6:31636426 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.558-11C>T	single nucleotide variant	not specified [RCV002308681]	Chr6:31669825 [GRCh38] Chr6:31637602 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.116T>C (p.Leu39Pro)	single nucleotide variant	Inborn genetic diseases [RCV002712549]	Chr6:31667911 [GRCh38] Chr6:31635688 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.67T>C (p.Cys23Arg)	single nucleotide variant	Inborn genetic diseases [RCV002717833]	Chr6:31666898 [GRCh38] Chr6:31634675 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.464_467del (p.Asp155fs)	deletion	Inborn genetic diseases [RCV002831557]\|not provided [RCV004786857]	Chr6:31669413..31669416 [GRCh38] Chr6:31637190..31637193 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.291+5G>C	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV003149116]	Chr6:31668659 [GRCh38] Chr6:31636436 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.368G>A (p.Gly123Asp)	single nucleotide variant	not provided [RCV003327745]	Chr6:31669319 [GRCh38] Chr6:31637096 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.257G>A (p.Arg86His)	single nucleotide variant	not provided [RCV003229322]	Chr6:31668620 [GRCh38] Chr6:31636397 [GRCh37] Chr6:6p21.33	pathogenic\|conflicting interpretations of pathogenicity
NM_001320.7(CSNK2B):c.475T>G (p.Phe159Val)	single nucleotide variant	not provided [RCV003229317]	Chr6:31669426 [GRCh38] Chr6:31637203 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.310G>T (p.Gly104Ter)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV003225013]	Chr6:31669115 [GRCh38] Chr6:31636892 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.557+1G>C	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV003143862]	Chr6:31669509 [GRCh38] Chr6:31637286 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.501C>T (p.Leu167=)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV003225802]	Chr6:31669452 [GRCh38] Chr6:31637229 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.278G>T (p.Gly93Val)	single nucleotide variant	not provided [RCV003327262]	Chr6:31668641 [GRCh38] Chr6:31636418 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.124C>T (p.Gln42Ter)	single nucleotide variant	Inborn genetic diseases [RCV004614421]\|Poirier-Bienvenu neurodevelopmental syndrome [RCV003330297]\|not provided [RCV004823148]	Chr6:31667919 [GRCh38] Chr6:31635696 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.581C>T (p.Pro194Leu)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV003340718]	Chr6:31669859 [GRCh38] Chr6:31637636 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.192del (p.Asp64fs)	deletion	not provided [RCV003334278]	Chr6:31668555 [GRCh38] Chr6:31636332 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.341G>A (p.Cys114Tyr)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV004795810]	Chr6:31669146 [GRCh38] Chr6:31636923 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.582G>A (p.Pro194=)	single nucleotide variant	not provided [RCV003431757]	Chr6:31669860 [GRCh38] Chr6:31637637 [GRCh37] Chr6:6p21.33	likely benign
NM_001320.7(CSNK2B):c.13G>T (p.Glu5Ter)	single nucleotide variant	not provided [RCV003431756]	Chr6:31666844 [GRCh38] Chr6:31634621 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.505A>G (p.Met169Val)	single nucleotide variant	CSNK2B-related disorder [RCV003397536]	Chr6:31669456 [GRCh38] Chr6:31637233 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.175+1G>A	single nucleotide variant	CSNK2B-related disorder [RCV003397265]\|Poirier-Bienvenu neurodevelopmental syndrome [RCV004798041]	Chr6:31667971 [GRCh38] Chr6:31635748 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.289A>G (p.Met97Val)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV003885413]	Chr6:31668652 [GRCh38] Chr6:31636429 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.6C>T (p.Ser2=)	single nucleotide variant	CSNK2B-related disorder [RCV003952045]	Chr6:31666837 [GRCh38] Chr6:31634614 [GRCh37] Chr6:6p21.33	likely benign
NM_021221.3(LY6G5B):c.-3007T>C	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV003983759]	Chr6:31667944 [GRCh38] Chr6:31635721 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.252C>T (p.His84=)	single nucleotide variant	CSNK2B-related disorder [RCV003964014]	Chr6:31668615 [GRCh38] Chr6:31636392 [GRCh37] Chr6:6p21.33	likely benign
NM_001320.7(CSNK2B):c.292T>C (p.Leu98=)	single nucleotide variant	CSNK2B-related disorder [RCV003966810]	Chr6:31669097 [GRCh38] Chr6:31636874 [GRCh37] Chr6:6p21.33	likely benign
NM_001320.7(CSNK2B):c.462G>A (p.Thr154=)	single nucleotide variant	CSNK2B-related disorder [RCV003961971]	Chr6:31669413 [GRCh38] Chr6:31637190 [GRCh37] Chr6:6p21.33	likely benign
NM_001320.7(CSNK2B):c.95A>C (p.Asp32Ala)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV003885419]	Chr6:31667890 [GRCh38] Chr6:31635667 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.639G>A (p.Thr213=)	single nucleotide variant	CSNK2B-related disorder [RCV003954591]	Chr6:31669917 [GRCh38] Chr6:31637694 [GRCh37] Chr6:6p21.33	likely benign
NM_001320.7(CSNK2B):c.59_62dup (p.Phe21fs)	duplication	not provided [RCV003887744]	Chr6:31666889..31666890 [GRCh38] Chr6:31634666..31634667 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.-1G>C	single nucleotide variant	CSNK2B-related disorder [RCV003957109]	Chr6:31666831 [GRCh38] Chr6:31634608 [GRCh37] Chr6:6p21.33	likely benign
NM_001320.7(CSNK2B):c.203A>T (p.Gln68Leu)	single nucleotide variant	not provided [RCV004585465]	Chr6:31668566 [GRCh38] Chr6:31636343 [GRCh37] Chr6:6p21.33	uncertain significance
NC_000006.11:g.(?_31631971)_(31895135_?)del	deletion	not provided [RCV004578802]	Chr6:31631971..31895135 [GRCh37] Chr6:6p21.33	pathogenic
NC_000006.11:g.(?_31620520)_(31937492_?)del	deletion	not provided [RCV004578883]	Chr6:31620520..31937492 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.367+1G>C	single nucleotide variant	not provided [RCV004697366]	Chr6:31669173 [GRCh38] Chr6:31636950 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.422T>C (p.Met141Thr)	single nucleotide variant	not provided [RCV004592461]	Chr6:31669373 [GRCh38] Chr6:31637150 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.408C>G (p.Tyr136Ter)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV004594924]	Chr6:31669359 [GRCh38] Chr6:31637136 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.463G>C (p.Asp155His)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV004594926]	Chr6:31669414 [GRCh38] Chr6:31637191 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.216dup (p.Glu73Ter)	duplication	not provided [RCV004696835]	Chr6:31668577..31668578 [GRCh38] Chr6:31636354..31636355 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.419_420delinsTA (p.Cys140Leu)	indel	not provided [RCV004779941]	Chr6:31669370..31669371 [GRCh38] Chr6:31637147..31637148 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.3G>A (p.Met1Ile)	single nucleotide variant	not provided [RCV004727286]	Chr6:31666834 [GRCh38] Chr6:31634611 [GRCh37] Chr6:6p21.33	pathogenic\|likely pathogenic
NM_001320.7(CSNK2B):c.558-2A>G	single nucleotide variant	not provided [RCV004727677]	Chr6:31669834 [GRCh38] Chr6:31637611 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.647G>C (p.Ter216Ser)	single nucleotide variant	not provided [RCV004759867]		uncertain significance
NM_001320.7(CSNK2B):c.409T>C (p.Cys137Arg)	single nucleotide variant	not provided [RCV004727676]	Chr6:31669360 [GRCh38] Chr6:31637137 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.516C>T (p.Pro172=)	single nucleotide variant	not provided [RCV004727222]	Chr6:31669467 [GRCh38] Chr6:31637244 [GRCh37] Chr6:6p21.33	likely benign
NM_001320.7(CSNK2B):c.558-2A>C	single nucleotide variant	CSNK2B-related disorder [RCV004739039]	Chr6:31669834 [GRCh38] Chr6:31637611 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.481del (p.Thr161fs)	deletion	Poirier-Bienvenu neurodevelopmental syndrome [RCV004798689]	Chr6:31669432 [GRCh38] Chr6:31637209 [GRCh37] Chr6:6p21.33	pathogenic
GRCh37/hg19 6p21.33(chr6:31630124-31657924)x1	copy number loss	Poirier-Bienvenu neurodevelopmental syndrome [RCV004767742]	Chr6:31630124..31657924 [GRCh37] Chr6:6p21.33	likely pathogenic
NM_001320.7(CSNK2B):c.517G>A (p.Glu173Lys)	single nucleotide variant	not specified [RCV004702975]	Chr6:31669468 [GRCh38] Chr6:31637245 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.475T>C (p.Phe159Leu)	single nucleotide variant	Poirier-Bienvenu neurodevelopmental syndrome [RCV005052285]	Chr6:31669426 [GRCh38] Chr6:31637203 [GRCh37] Chr6:6p21.33	uncertain significance
NM_001320.7(CSNK2B):c.19dup (p.Val7fs)	duplication	not provided [RCV005052434]	Chr6:31666848..31666849 [GRCh38] Chr6:31634625..31634626 [GRCh37] Chr6:6p21.33	pathogenic
NM_001320.7(CSNK2B):c.367+3_367+5delinsAAA	indel	Inborn genetic diseases [RCV004979264]	Chr6:31669175..31669177 [GRCh38] Chr6:31636952..31636954 [GRCh37] Chr6:6p21.33	likely pathogenic

Predicted Target Of

	Summary Value
Count of predictions:	3426
Count of miRNA genes:	984
Interacting mature miRNAs:	1190
Transcripts:	ENST00000375865, ENST00000375866, ENST00000375880, ENST00000375882, ENST00000375885, ENST00000409691, ENST00000465481, ENST00000468255, ENST00000475875, ENST00000481269
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358854	MULTSCL4_H	Multiple sclerosis susceptibility QTL 4 (human)			Multiple sclerosis susceptibility		6	6911960	32911960	Human
1358839	MULTSCL5_H	Multiple sclerosis susceptibility QTL 5 (human)			Multiple sclerosis susceptibility		6	19584311	45584311	Human
597428026	GWAS1524100_H	Inguinal hernia QTL GWAS1524100 (human)		3e-10	Inguinal hernia		6	31668965	31668966	Human
1643377	BW325_H	Body weight QTL 325 (human)	2.32	0.0005	Body fat amount		6	6911960	32911960	Human
1643569	GLUCO21_H	Glucose level QTL 21 (human)		0.021	Glucose level	non-insulin-dependent	6	6911960	32911960	Human
1298458	BW9_H	Body weight QTL 9 (human)	2.7	0.0002	Body fat amount		6	6911960	32911960	Human
597357955	GWAS1454029_H	cutaneous lupus erythematosus QTL GWAS1454029 (human)		3e-14	cutaneous lupus erythematosus		6	31668965	31668966	Human
597400290	GWAS1496364_H	systemic lupus erythematosus QTL GWAS1496364 (human)		8e-08	systemic lupus erythematosus		6	31668965	31668966	Human
597399536	GWAS1495610_H	BMI-adjusted hip circumference QTL GWAS1495610 (human)		4e-12	BMI-adjusted hip circumference	hip circumference (CMO:0000014)	6	31668166	31668167	Human
1298431	RA11_H	Rheumatoid arthritis QTL 11 (human)		0.0000024	Joint/bone inflammation	rheumatoid arthritis	6	19911883	40191709	Human
1358857	MULTSCL19_H	Multiple sclerosis susceptibility QTL 19 (human)			Multiple sclerosis susceptibility		6	19584311	45584311	Human
1643399	BMD5_H	Bone mineral density QTL 5 (human)	2.32	0.0005	Bone mineral density		6	6911960	32911960	Human

G54110

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,637,713 - 31,637,844	UniSTS	GRCh37
Build 36	6	31,745,692 - 31,745,823	RGD	NCBI36
Celera	6	33,235,934 - 33,236,065	RGD
Cytogenetic Map	6	p21.3	UniSTS
HuRef	6	31,423,938 - 31,424,069	UniSTS

G54062

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,637,669 - 31,637,815	UniSTS	GRCh37
Build 36	6	31,745,648 - 31,745,794	RGD	NCBI36
Celera	6	33,235,890 - 33,236,036	RGD
Cytogenetic Map	6	p21.3	UniSTS
HuRef	6	31,423,894 - 31,424,040	UniSTS

CSNK2B

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,637,619 - 31,637,817	UniSTS	GRCh37
Build 36	6	31,745,598 - 31,745,796	RGD	NCBI36
Celera	6	33,235,840 - 33,236,038	RGD
HuRef	6	31,423,844 - 31,424,042	UniSTS

RH16232

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,632,110 - 31,632,238	UniSTS	GRCh37
Build 36	6	31,740,089 - 31,740,217	RGD	NCBI36
Celera	6	33,230,331 - 33,230,459	RGD
Cytogenetic Map	6	p21.3	UniSTS
HuRef	6	31,418,335 - 31,418,463	UniSTS
GeneMap99-GB4 RH Map	6	145.45	UniSTS

MARC_3347-3348:991937077:1

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,637,116 - 31,637,637	UniSTS	GRCh37
Build 36	6	31,745,095 - 31,745,616	RGD	NCBI36
Celera	6	33,235,337 - 33,235,858	RGD
HuRef	6	31,423,341 - 31,423,862	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2630	2790	2291	5422	1888	2819	12	743	2487	587	2570	8266	7067	106	3888	2	1020	2008	1953	187	2


RefSeq Transcripts	NM_001282385	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001320	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF129756	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK300671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK308742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK310551	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK310954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK311860	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL662899	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL670886	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL805934	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY113186	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BA000025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC112017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC112019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BQ643177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX511262	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471081	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068272	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR354443	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR541699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR753842	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR759761	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DB570461	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ314868	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HE864443	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HE864444	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HE864445	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HE864446	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HE864447	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HE864453	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HE864454	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HE864455	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HE864458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HE864459	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KY500275	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KY500276	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	OP121236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	OP121237	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X16312	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X16937	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X57152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000375865 ⟹ ENSP00000365025

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,666,292 - 31,670,070 (+)	Ensembl

Ensembl Acc Id:

ENST00000375866 ⟹ ENSP00000365026

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,666,355 - 31,670,070 (+)	Ensembl

Ensembl Acc Id:

ENST00000375880 ⟹ ENSP00000365040

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,666,102 - 31,673,546 (+)	Ensembl

Ensembl Acc Id:

ENST00000375882 ⟹ ENSP00000365042

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,666,080 - 31,670,067 (+)	Ensembl

Ensembl Acc Id:

ENST00000375885 ⟹ ENSP00000365046

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,665,236 - 31,670,070 (+)	Ensembl

Ensembl Acc Id:

ENST00000409691 ⟹ ENSP00000387322

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,669,118 - 31,673,546 (+)	Ensembl

Ensembl Acc Id:

ENST00000465481

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,666,087 - 31,668,830 (+)	Ensembl

Ensembl Acc Id:

ENST00000468255

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,666,081 - 31,670,343 (+)	Ensembl

Ensembl Acc Id:

ENST00000475875

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,666,101 - 31,670,067 (+)	Ensembl

Ensembl Acc Id:

ENST00000481269

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,666,094 - 31,669,464 (+)	Ensembl

Ensembl Acc Id:

ENST00000617558 ⟹ ENSP00000483989

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,666,820 - 31,672,346 (+)	Ensembl

Ensembl Acc Id:

ENST00000677388 ⟹ ENSP00000504290

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,665,227 - 31,670,067 (+)	Ensembl

Ensembl Acc Id:

ENST00000677536 ⟹ ENSP00000502967

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,665,234 - 31,670,074 (+)	Ensembl

Ensembl Acc Id:

ENST00000677758 ⟹ ENSP00000504242

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,665,234 - 31,670,066 (+)	Ensembl

RefSeq Acc Id:

NM_001282385 ⟹ NP_001269314

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	31,666,080 - 31,670,067 (+)	NCBI
HuRef	6	31,419,882 - 31,424,072 (+)	NCBI
CHM1_1	6	31,635,793 - 31,639,983 (+)	NCBI
T2T-CHM13v2.0	6	31,519,114 - 31,523,101 (+)	NCBI

Sequence:

show sequence

AATTTCCACTCCCCCCACCCCACTTCGCCTGCCGCGGTCGGGTCCGCGGCCTGCGCTGTAGCGGTCGCCGCCGTTCCCTGGAAGTAGCAACTTCCCTACCCCACCCCAGTCCTGGTCCCCGTCCAGCC
GCTGACGTGAAGATGAGCAGCTCAGAGGAGGTGTCCTGGATTTCCTGGTTCTGTGGGCTCCGTGGCAATGAATTCTTCTGTGAAGTGGATGAAGACTACATCCAGGACAAATTTAATCTTACTGGACT
CAATGAGCAGGTCCCTCACTATCGACAAGCTCTAGACATGATCTTGGACCTGGAGCCTGATGAAGAACTGGAAGACAACCCCAACCAGAGTGACCTGATTGAGCAGGCAGCCGAGATGCTTTATGGAT
TGATCCACGCCCGCTACATCCTTACCAACCGTGGCATCGCCCAGATGTTGGAAAAGTACCAGCAAGGAGACTTTGGTTACTGTCCTCGTGTGTACTGTGAGAACCAGCCAATGCTTCCCATTGACATC
CCAGGTGAAGCCATGGTGAAGCTCTACTGCCCCAAGTGCATGGATGTGTACACACCCAAGTCATCAAGACACCATCACACGGATGGCGCCTACTTCGGCACTGGTTTCCCTCACATGCTCTTCATGGT
GCATCCCGAGTACCGGCCCAAGAGACCTGCCAACCAGTTTGTGCCCAGGCTCTACGGTTTCAAGATCCATCCGATGGCCTACCAGCTGCAGCTCCAAGCCGCCAGCAACTTCAAGAGCCCAGTCAAGA
CGATTCGCTGATTCCCTCCCCCACCTGTCCTGCAGTCTTTGACTTTTCCTTTCTTTTTTGCCACCCTTTCAGGAACCCTGTATGGTTTTTAGTTTAAATTAAAGGAGTCGTTATCGTGGTGGGAATAT
GAAATAAAGTAGAAGAAAAGGCCA

hide sequence

RefSeq Acc Id:

NM_001320 ⟹ NP_001311

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	31,666,080 - 31,670,067 (+)	NCBI
GRCh37	6	31,632,995 - 31,637,844 (+)	NCBI
Build 36	6	31,741,636 - 31,745,822 (+)	NCBI Archive
HuRef	6	31,419,882 - 31,424,072 (+)	NCBI
CHM1_1	6	31,635,793 - 31,639,983 (+)	NCBI
T2T-CHM13v2.0	6	31,519,114 - 31,523,101 (+)	NCBI

Sequence:

show sequence

AATTTCCACTCCCCCCACCCCACTTCGCCTGCCGCGGTCGGGTCCGCGGCCTGCGCTGTAGCGG
TCGCCGCCGTTCCCTGGAAGTAGCAACTTCCCTACCCCACCCCAGTCCTGGTCCCCGTCCAGCCGCTGACGTGAAGATGAGCAGCTCAGAGGAGGTGTCCTGGATTTCCTGGTTCTGTGGGCTCCGTG
GCAATGAATTCTTCTGTGAAGTGGATGAAGACTACATCCAGGACAAATTTAATCTTACTGGACTCAATGAGCAGGTCCCTCACTATCGACAAGCTCTAGACATGATCTTGGACCTGGAGCCTGATGAA
GAACTGGAAGACAACCCCAACCAGAGTGACCTGATTGAGCAGGCAGCCGAGATGCTTTATGGATTGATCCACGCCCGCTACATCCTTACCAACCGTGGCATCGCCCAGATGTTGGAAAAGTACCAGCA
AGGAGACTTTGGTTACTGTCCTCGTGTGTACTGTGAGAACCAGCCAATGCTTCCCATTGGCCTTTCAGACATCCCAGGTGAAGCCATGGTGAAGCTCTACTGCCCCAAGTGCATGGATGTGTACACAC
CCAAGTCATCAAGACACCATCACACGGATGGCGCCTACTTCGGCACTGGTTTCCCTCACATGCTCTTCATGGTGCATCCCGAGTACCGGCCCAAGAGACCTGCCAACCAGTTTGTGCCCAGGCTCTAC
GGTTTCAAGATCCATCCGATGGCCTACCAGCTGCAGCTCCAAGCCGCCAGCAACTTCAAGAGCCCAGTCAAGACGATTCGCTGATTCCCTCCCCCACCTGTCCTGCAGTCTTTGACTTTTCCTTTCTT
TTTTGCCACCCTTTCAGGAACCCTGTATGGTTTTTAGTTTAAATTAAAGGAGTCGTTATCGTGGTGGGAATATGAAATAAAGTAGAAGAAAAGGCCA

hide sequence


Protein RefSeqs	NP_001269314	(Get FASTA)	NCBI Sequence Viewer
	NP_001311	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD18081	(Get FASTA)	NCBI Sequence Viewer
	AAI12018	(Get FASTA)	NCBI Sequence Viewer
	AAI12020	(Get FASTA)	NCBI Sequence Viewer
	AAM50092	(Get FASTA)	NCBI Sequence Viewer
	ABC40727	(Get FASTA)	NCBI Sequence Viewer
	AQY76763	(Get FASTA)	NCBI Sequence Viewer
	AQY76764	(Get FASTA)	NCBI Sequence Viewer
	BAB63386	(Get FASTA)	NCBI Sequence Viewer
	BAG34801	(Get FASTA)	NCBI Sequence Viewer
	BAG62356	(Get FASTA)	NCBI Sequence Viewer
	CAA34379	(Get FASTA)	NCBI Sequence Viewer
	CAA34811	(Get FASTA)	NCBI Sequence Viewer
	CAA40442	(Get FASTA)	NCBI Sequence Viewer
	CAG46500	(Get FASTA)	NCBI Sequence Viewer
	CCI79680	(Get FASTA)	NCBI Sequence Viewer
	CCI79681	(Get FASTA)	NCBI Sequence Viewer
	CCI79682	(Get FASTA)	NCBI Sequence Viewer
	CCI79683	(Get FASTA)	NCBI Sequence Viewer
	CCI79684	(Get FASTA)	NCBI Sequence Viewer
	CCI79690	(Get FASTA)	NCBI Sequence Viewer
	CCI79691	(Get FASTA)	NCBI Sequence Viewer
	CCI79692	(Get FASTA)	NCBI Sequence Viewer
	CCI79695	(Get FASTA)	NCBI Sequence Viewer
	CCI79696	(Get FASTA)	NCBI Sequence Viewer
	EAX03472	(Get FASTA)	NCBI Sequence Viewer
	EAX03473	(Get FASTA)	NCBI Sequence Viewer
	EAX03474	(Get FASTA)	NCBI Sequence Viewer
	EAX03475	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000365025.2
	ENSP00000365026.2
	ENSP00000365042
	ENSP00000365042.3
	ENSP00000372919.2
	ENSP00000372925.4
	ENSP00000382980.1
	ENSP00000390900.2
	ENSP00000391038.1
	ENSP00000393756.1
	ENSP00000394855.1
	ENSP00000395275.1
	ENSP00000400188.2
	ENSP00000407018.2
	ENSP00000407379.1
	ENSP00000409510.1
	ENSP00000410802.1
	ENSP00000411322.1
	ENSP00000412520.1
	ENSP00000413469.1
	ENSP00000415237.2
	ENSP00000415303.2
	ENSP00000502967
GenBank Protein	P67870	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001311 ⟸ NM_001320
- Peptide Label:	isoform 1
- UniProtKB:	P13862 (UniProtKB/Swiss-Prot), P07312 (UniProtKB/Swiss-Prot), B0UXA9 (UniProtKB/Swiss-Prot), Q4VX47 (UniProtKB/Swiss-Prot), P67870 (UniProtKB/Swiss-Prot), N0E4C7 (UniProtKB/TrEMBL), Q5SRQ3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR hide sequence

RefSeq Acc Id:	NP_001269314 ⟸ NM_001282385
- Peptide Label:	isoform 2
- UniProtKB:	A0A1U9X7J2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIDIPGEA MVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR hide sequence

Ensembl Acc Id:

ENSP00000365025 ⟸ ENST00000375865

Ensembl Acc Id:

ENSP00000365026 ⟸ ENST00000375866

Ensembl Acc Id:

ENSP00000365042 ⟸ ENST00000375882

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P67870-F1-model_v2	AlphaFold	P67870	1-215	view protein structure

RGD ID:

6872568

Promoter ID:

EPDNEW_H9449

Type:

initiation region

Name:

CSNK2B_3

Description:

casein kinase 2 beta

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H9450 EPDNEW_H9454

Experiment Methods:

Single-end sequencing.; Paired-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	31,665,838 - 31,665,898	EPDNEW

RGD ID:

6872570

Promoter ID:

EPDNEW_H9450

Type:

initiation region

Name:

CSNK2B_1

Description:

casein kinase 2 beta

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H9449 EPDNEW_H9454

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	31,666,087 - 31,666,147	EPDNEW

RGD ID:

6872578

Promoter ID:

EPDNEW_H9454

Type:

initiation region

Name:

CSNK2B_2

Description:

casein kinase 2 beta

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H9449 EPDNEW_H9450

Experiment Methods:

Single-end sequencing.; Paired-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	31,668,621 - 31,668,681	EPDNEW

RGD ID:

6804150

Promoter ID:

HG_KWN:52959

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4

Transcripts:

ENST00000375865, ENST00000375866, ENST00000375872, ENST00000375873, ENST00000375875, ENST00000375885, OTTHUMT00000076063, OTTHUMT00000076065, OTTHUMT00000076069, OTTHUMT00000144422, UC003NVS.1, UC010JSZ.1, UC010JTA.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	6	31,740,116 - 31,741,512 (+)	MPROMDB

RGD ID:

6852422

Promoter ID:

EP74020

Type:

initiation region

Name:

HS_CSNK2B

Description:

Casein kinase 2, beta polypeptide.

SO ACC ID:

SO:0000170

Source:

EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Mammalian gene collection (MGC) full-length cDNA cloning

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	6	31,741,594 - 31,741,654	EPD

RGD ID:

6804152

Promoter ID:

HG_KWN:52961

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, HeLa_S3, K562, Lymphoblastoid

Transcripts:

ENST00000409525, OTTHUMT00000124389, OTTHUMT00000335081

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	6	31,746,326 - 31,746,867 (+)	MPROMDB

Database	Acc Id	Source(s)
COSMIC	CSNK2B	COSMIC
Ensembl Genes	ENSG00000204435	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSG00000206406	UniProtKB/Swiss-Prot
	ENSG00000224398	UniProtKB/Swiss-Prot
	ENSG00000224774	UniProtKB/Swiss-Prot
	ENSG00000228875	UniProtKB/Swiss-Prot
	ENSG00000230700	UniProtKB/Swiss-Prot
	ENSG00000232960	UniProtKB/Swiss-Prot
	ENSG00000263020	Ensembl
Ensembl Transcript	ENST00000375865.6	UniProtKB/Swiss-Prot
	ENST00000375866.2	UniProtKB/Swiss-Prot
	ENST00000375882	ENTREZGENE
	ENST00000375882.7	UniProtKB/Swiss-Prot
	ENST00000383427.6	UniProtKB/Swiss-Prot
	ENST00000383433.8	UniProtKB/Swiss-Prot
	ENST00000400110.5	UniProtKB/Swiss-Prot
	ENST00000412802.5	UniProtKB/Swiss-Prot
	ENST00000418230.5	UniProtKB/Swiss-Prot
	ENST00000422567.6	UniProtKB/Swiss-Prot
	ENST00000429633.5	UniProtKB/Swiss-Prot
	ENST00000431476.5	UniProtKB/Swiss-Prot
	ENST00000436169.5	UniProtKB/Swiss-Prot
	ENST00000443673.6	UniProtKB/Swiss-Prot
	ENST00000448596.1	UniProtKB/Swiss-Prot
	ENST00000451917.6	UniProtKB/Swiss-Prot
	ENST00000452985.6	UniProtKB/Swiss-Prot
	ENST00000453234.5	UniProtKB/Swiss-Prot
	ENST00000454382.6	UniProtKB/Swiss-Prot
	ENST00000454511.5	UniProtKB/Swiss-Prot
	ENST00000455161.1	UniProtKB/Swiss-Prot
	ENST00000458330.5	UniProtKB/Swiss-Prot
	ENST00000677536	ENTREZGENE
Gene3D-CATH	1.10.1820.10	UniProtKB/Swiss-Prot
	2.20.25.20	UniProtKB/Swiss-Prot
GTEx	ENSG00000204435	GTEx
	ENSG00000206406	GTEx
	ENSG00000224398	GTEx
	ENSG00000224774	GTEx
	ENSG00000228875	GTEx
	ENSG00000230700	GTEx
	ENSG00000232960	GTEx
	ENSG00000263020	GTEx
HGNC ID	HGNC:2460	ENTREZGENE
Human Proteome Map	CSNK2B	Human Proteome Map
InterPro	Casein_kin_II_reg-sub_N	UniProtKB/Swiss-Prot
	Casein_kinase_II_beta-like	UniProtKB/Swiss-Prot
	Casein_kinase_II_reg-sub	UniProtKB/Swiss-Prot
KEGG Report	hsa:1460	UniProtKB/Swiss-Prot
NCBI Gene	1460	ENTREZGENE
OMIM	115441	OMIM
PANTHER	CASEIN KINASE II SUBUNIT BETA	UniProtKB/Swiss-Prot
	PTHR11740	UniProtKB/Swiss-Prot
Pfam	CK_II_beta	UniProtKB/Swiss-Prot
PharmGKB	PA26960	PharmGKB
PRINTS	CASNKINASEII	UniProtKB/Swiss-Prot
PROSITE	CK2_BETA	UniProtKB/Swiss-Prot
RNAcentral	URS0002617AE7	RNACentral
	URS0002618237	RNACentral
	URS000261828F	RNACentral
SMART	CK_II_beta	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57798	UniProtKB/Swiss-Prot
UniProt	A0A0G2JM12_HUMAN	UniProtKB/TrEMBL
	A0A0G2JM58_HUMAN	UniProtKB/TrEMBL
	A0A1U9X7J2	ENTREZGENE, UniProtKB/TrEMBL
	A0A7I2V500_HUMAN	UniProtKB/TrEMBL
	A0A7I2YQ78_HUMAN	UniProtKB/TrEMBL
	A0A7I2YQQ2_HUMAN	UniProtKB/TrEMBL
	B0UXA9	ENTREZGENE
	B4DUJ4_HUMAN	UniProtKB/TrEMBL
	CSK2B_HUMAN	UniProtKB/Swiss-Prot
	H0Y6P8_HUMAN	UniProtKB/TrEMBL
	N0E466_HUMAN	UniProtKB/TrEMBL
	N0E472_HUMAN	UniProtKB/TrEMBL
	N0E4C7	ENTREZGENE, UniProtKB/TrEMBL
	N0E638_HUMAN	UniProtKB/TrEMBL
	N0E644_HUMAN	UniProtKB/TrEMBL
	N0E650_HUMAN	UniProtKB/TrEMBL
	N0E6I8_HUMAN	UniProtKB/TrEMBL
	P07312	ENTREZGENE
	P13862	ENTREZGENE
	P67870	ENTREZGENE
	Q4VX47	ENTREZGENE
	Q5SRQ3	ENTREZGENE, UniProtKB/TrEMBL
	Q5SRQ6_HUMAN	UniProtKB/TrEMBL
UniProt Secondary	B0UXA9	UniProtKB/Swiss-Prot
	P07312	UniProtKB/Swiss-Prot
	P13862	UniProtKB/Swiss-Prot
	Q4VX47	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-26	CSNK2B	casein kinase 2 beta	CSNK2B	casein kinase 2, beta polypeptide	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Imported Human Phenotype Annotations - HPO

Imported Human Phenotype Annotations - ClinVar

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Imported Human Phenotype Annotations - HPO

Imported Human Phenotype Annotations - ClinVar