Symbol:
Brix1
Name:
biogenesis of ribosomes BRX1
RGD ID:
1308508
Description:
Predicted to enable RNA binding activity. Predicted to be involved in ribosomal large subunit assembly. Predicted to be located in chromosome. Predicted to be active in nucleolus. Orthologous to human BRIX1 (biogenesis of ribosomes BRX1); INTERACTS WITH 2,4-dinitrotoluene; 6-propyl-2-thiouracil; amitrole.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
brix domain containing 2; brix domain-containing protein 2; BRX1, biogenesis of ribosomes; BRX1, biogenesis of ribosomes, homolog; BRX1, biogenesis of ribosomes, homolog (S. cerevisiae); Bxdc2; LOC294799; MGC116151; RGD1308508; ribosome biogenesis protein Brix; ribosome biogenesis protein BRX1 homolog; similar to BRIX
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BRIX1 (biogenesis of ribosomes BRX1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Brix1 (BRX1, biogenesis of ribosomes) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Brix1 (biogenesis of ribosomes BRX1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BRIX1 (biogenesis of ribosomes BRX1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BRIX1 (biogenesis of ribosomes BRX1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Brix1 (biogenesis of ribosomes BRX1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BRIX1 (biogenesis of ribosomes BRX1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BRIX1 (biogenesis of ribosomes BRX1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Brix1 (biogenesis of ribosomes BRX1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Brix1 (BRX1, biogenesis of ribosomes)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
BRIX1 (biogenesis of ribosomes BRX1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bxdc2 (brix domain containing 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
BRX1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG11583
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
K12H4.3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
brix1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 61,177,769 - 61,188,647 (-) NCBI GRCr8 mRatBN7.2 2 59,450,608 - 59,461,486 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 59,450,614 - 59,461,495 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 66,558,326 - 66,569,203 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 64,679,856 - 64,690,733 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 59,681,217 - 59,692,094 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 60,450,547 - 60,461,425 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 60,450,374 - 60,461,458 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 84,212,803 - 84,223,681 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 59,826,894 - 59,837,772 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 59,755,126 - 59,766,005 (-) NCBI Celera 2 59,212,330 - 59,223,208 (+) NCBI Celera Cytogenetic Map 2 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Brix1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1552934 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of BRIX1 mRNA CTD PMID:36331819 Brix1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1552934 6480464 1,2-Dimethylhydrazine results in decreased expression of BRIX1 mRNA CTD PMID:22206623 Brix1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1552934 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of BRIX1 mRNA CTD PMID:22206623 Brix1 Rat 17beta-estradiol affects expression ISO RGD:1605358 6480464 Estradiol affects the expression of BRIX1 mRNA CTD PMID:22574217 Brix1 Rat 17beta-estradiol increases expression ISO RGD:1605358 6480464 Estradiol results in increased expression of BRIX1 mRNA CTD PMID:31614463 Brix1 Rat 17beta-estradiol increases expression ISO RGD:1552934 6480464 Estradiol results in increased expression of BRIX1 mRNA CTD PMID:39298647 Brix1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1605358 6480464 Tetrachlorodibenzodioxin results in decreased expression of BRIX1 mRNA CTD PMID:20106945 Brix1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1552934 6480464 Tetrachlorodibenzodioxin affects the expression of BXDC2 mRNA CTD PMID:21570461 Brix1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1552934 6480464 Tetrachlorodibenzodioxin results in decreased expression of BXDC2 mRNA CTD PMID:19770486 Brix1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of BRIX1 mRNA CTD PMID:21346803 Brix1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1605358 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Brix1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1552934 6480464 bisphenol S results in increased expression of BRIX1 mRNA CTD PMID:39298647 Brix1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1605358 6480464 bisphenol S results in increased expression of BRIX1 protein CTD PMID:34186270 Brix1 Rat 5-fluorouracil decreases expression ISO RGD:1605358 6480464 Fluorouracil results in decreased expression of BRIX1 mRNA CTD PMID:16510598 Brix1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of BRIX1 mRNA CTD PMID:30047161|PMID:36843608 Brix1 Rat acetic acid increases expression ISO RGD:1552934 6480464 Acetic Acid results in increased expression of BXDC2 protein CTD PMID:21296659 Brix1 Rat aflatoxin B1 increases expression ISO RGD:1605358 6480464 Aflatoxin B1 results in increased expression of BRIX1 mRNA; Aflatoxin B1 results in increased expression more ... CTD PMID:22100608|PMID:27153756 Brix1 Rat all-trans-retinoic acid decreases expression ISO RGD:1605358 6480464 Tretinoin results in decreased expression of BRIX1 mRNA CTD PMID:33167477 Brix1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of BRIX1 mRNA CTD PMID:30047161 Brix1 Rat Aroclor 1254 decreases expression ISO RGD:1552934 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of BXDC2 mRNA CTD PMID:23650126 Brix1 Rat atrazine increases expression ISO RGD:1605358 6480464 Atrazine results in increased expression of BRIX1 mRNA CTD PMID:22378314 Brix1 Rat benzo[a]pyrene increases expression ISO RGD:1552934 6480464 Benzo(a)pyrene results in increased expression of BXDC2 mRNA CTD PMID:19770486|PMID:22228805 Brix1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BRIX1 mRNA CTD PMID:25181051|PMID:30816183 Brix1 Rat bisphenol A decreases expression ISO RGD:1552934 6480464 bisphenol A results in decreased expression of BRIX1 mRNA CTD PMID:33221593 Brix1 Rat bisphenol A multiple interactions ISO RGD:1605358 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Brix1 Rat bisphenol A decreases expression ISO RGD:1605358 6480464 bisphenol A results in decreased expression of BRIX1 mRNA; bisphenol A results in decreased expression more ... CTD PMID:27685785|PMID:29275510|PMID:34186270 Brix1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of BRIX1 mRNA CTD PMID:19010381 Brix1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of BRIX1 mRNA CTD PMID:33453195 Brix1 Rat calcitriol decreases expression ISO RGD:1605358 6480464 Calcitriol results in decreased expression of BRIX1 mRNA CTD PMID:21592394 Brix1 Rat calcitriol multiple interactions ISO RGD:1605358 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of BRIX1 mRNA CTD PMID:21592394 Brix1 Rat CGP 52608 multiple interactions ISO RGD:1605358 6480464 CGP 52608 promotes the reaction [RORA protein binds to BXDC2 gene] CTD PMID:28238834 Brix1 Rat chromium(6+) affects expression ISO RGD:1552934 6480464 chromium hexavalent ion affects the expression of BRIX1 mRNA CTD PMID:28472532 Brix1 Rat coumarin increases phosphorylation ISO RGD:1605358 6480464 coumarin results in increased phosphorylation of BRIX1 protein CTD PMID:35688186 Brix1 Rat cyclosporin A increases expression ISO RGD:1605358 6480464 Cyclosporine results in increased expression of BRIX1 mRNA CTD PMID:25562108 Brix1 Rat cyclosporin A decreases expression ISO RGD:1552934 6480464 Cyclosporine results in decreased expression of BXDC2 mRNA CTD PMID:19770486 Brix1 Rat DDE increases expression ISO RGD:1605358 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of BRIX1 mRNA CTD PMID:38568856 Brix1 Rat dexamethasone multiple interactions ISO RGD:1605358 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Brix1 Rat dicrotophos decreases expression ISO RGD:1605358 6480464 dicrotophos results in decreased expression of BRIX1 mRNA CTD PMID:28302478 Brix1 Rat dioxygen multiple interactions ISO RGD:1552934 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of BRIX1 mRNA CTD PMID:30529165 Brix1 Rat enzyme inhibitor multiple interactions ISO RGD:1605358 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Brix1 Rat epoxiconazole increases expression ISO RGD:1552934 6480464 epoxiconazole results in increased expression of BRIX1 mRNA CTD PMID:35436446 Brix1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of BRIX1 mRNA CTD PMID:24136188 Brix1 Rat folic acid multiple interactions ISO RGD:1552934 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of BRIX1 mRNA CTD PMID:22206623 Brix1 Rat FR900359 increases phosphorylation ISO RGD:1605358 6480464 FR900359 results in increased phosphorylation of BRIX1 protein CTD PMID:37730182 Brix1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of BRIX1 mRNA CTD PMID:24136188 Brix1 Rat hydrogen peroxide affects expression ISO RGD:1605358 6480464 Hydrogen Peroxide affects the expression of BXDC2 mRNA CTD PMID:20044591 Brix1 Rat indometacin multiple interactions ISO RGD:1605358 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Brix1 Rat ivermectin decreases expression ISO RGD:1605358 6480464 Ivermectin results in decreased expression of BRIX1 protein CTD PMID:32959892 Brix1 Rat methidathion increases expression ISO RGD:1552934 6480464 methidathion results in increased expression of BRIX1 mRNA CTD PMID:34813904 Brix1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of BRIX1 mRNA CTD PMID:24136188 Brix1 Rat nickel atom multiple interactions ISO RGD:1605358 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of BRIX1 mRNA] CTD PMID:14575637 Brix1 Rat nickel atom affects expression ISO RGD:1605358 6480464 Nickel affects the expression of BRIX1 mRNA CTD PMID:14575637 Brix1 Rat nitrates multiple interactions ISO RGD:1552934 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of BRIX1 more ... CTD PMID:35964746 Brix1 Rat perfluorooctane-1-sulfonic acid increases expression ISO RGD:1552934 6480464 perfluorooctane sulfonic acid results in increased expression of BRIX1 protein CTD PMID:26178269 Brix1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1552934 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of BRIX1 mRNA CTD PMID:36331819 Brix1 Rat phenobarbital affects expression ISO RGD:1605358 6480464 Phenobarbital affects the expression of BXDC2 mRNA CTD PMID:19159669 Brix1 Rat phorone affects expression EXP 6480464 phorone affects the expression of BXDC2 mRNA CTD PMID:18198479 Brix1 Rat pirinixic acid increases expression ISO RGD:1552934 6480464 pirinixic acid results in increased expression of BRIX1 mRNA CTD PMID:18301758 Brix1 Rat pregnenolone 16alpha-carbonitrile increases expression ISO RGD:1552934 6480464 Pregnenolone Carbonitrile results in increased expression of BRIX1 mRNA CTD PMID:28903501 Brix1 Rat progesterone decreases expression ISO RGD:1605358 6480464 Progesterone results in decreased expression of BRIX1 mRNA CTD PMID:18037150 Brix1 Rat propiconazole increases expression ISO RGD:1552934 6480464 propiconazole results in increased expression of BRIX1 mRNA CTD PMID:21278054 Brix1 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of BRIX1 mRNA CTD PMID:30047161 Brix1 Rat resveratrol multiple interactions ISO RGD:1605358 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of BXDC2 mRNA CTD PMID:23557933 Brix1 Rat SB 431542 multiple interactions ISO RGD:1605358 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of BRIX1 more ... CTD PMID:37664457 Brix1 Rat silicon dioxide increases expression ISO RGD:1605358 6480464 Silicon Dioxide analog results in increased expression of BRIX1 mRNA CTD PMID:25895662 Brix1 Rat sodium arsenite decreases expression ISO RGD:1605358 6480464 sodium arsenite results in decreased expression of BRIX1 mRNA CTD PMID:38568856 Brix1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of BRIX1 mRNA CTD PMID:25993096 Brix1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of BRIX1 mRNA CTD PMID:30047161 Brix1 Rat testosterone multiple interactions ISO RGD:1605358 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of BRIX1 mRNA CTD PMID:21592394 Brix1 Rat testosterone decreases expression ISO RGD:1605358 6480464 Testosterone results in decreased expression of BRIX1 mRNA CTD PMID:21592394 Brix1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of BRIX1 mRNA CTD PMID:31150632 Brix1 Rat tetrachloromethane increases expression ISO RGD:1552934 6480464 Carbon Tetrachloride results in increased expression of BRIX1 mRNA CTD PMID:31919559 Brix1 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of BRIX1 protein CTD PMID:35544339 Brix1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of BRIX1 mRNA; Thioacetamide results in increased expression of BXDC2 more ... CTD PMID:23411599|PMID:34492290 Brix1 Rat titanium dioxide decreases expression ISO RGD:1552934 6480464 titanium dioxide results in decreased expression of BRIX1 mRNA CTD PMID:29264374 Brix1 Rat titanium dioxide decreases methylation ISO RGD:1552934 6480464 titanium dioxide results in decreased methylation of BRIX1 gene CTD PMID:35295148 Brix1 Rat trichloroethene decreases expression ISO RGD:1552934 6480464 Trichloroethylene results in decreased expression of BXDC2 mRNA CTD PMID:19448997 Brix1 Rat trichostatin A multiple interactions ISO RGD:1605358 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of BRIX1 mRNA] CTD PMID:14575637 Brix1 Rat trichostatin A affects expression ISO RGD:1605358 6480464 trichostatin A affects the expression of BRIX1 mRNA CTD PMID:28542535 Brix1 Rat triphenyl phosphate affects expression ISO RGD:1605358 6480464 triphenyl phosphate affects the expression of BRIX1 mRNA CTD PMID:37042841 Brix1 Rat tunicamycin increases expression ISO RGD:1552934 6480464 Tunicamycin results in increased expression of BRIX1 mRNA CTD PMID:17127020 Brix1 Rat urethane decreases expression ISO RGD:1605358 6480464 Urethane results in decreased expression of BRIX1 mRNA CTD PMID:28818685 Brix1 Rat valproic acid affects expression ISO RGD:1552934 6480464 Valproic Acid affects the expression of BRIX1 mRNA CTD PMID:17292431 Brix1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of BRIX1 mRNA; vinclozolin results in increased expression of BXDC2 more ... CTD PMID:23034163|PMID:23555832
Brix1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 61,177,769 - 61,188,647 (-) NCBI GRCr8 mRatBN7.2 2 59,450,608 - 59,461,486 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 59,450,614 - 59,461,495 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 66,558,326 - 66,569,203 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 64,679,856 - 64,690,733 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 59,681,217 - 59,692,094 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 60,450,547 - 60,461,425 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 60,450,374 - 60,461,458 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 84,212,803 - 84,223,681 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 59,826,894 - 59,837,772 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 59,755,126 - 59,766,005 (-) NCBI Celera 2 59,212,330 - 59,223,208 (+) NCBI Celera Cytogenetic Map 2 q16 NCBI
BRIX1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 34,915,711 - 34,925,996 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 34,915,677 - 34,925,996 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 34,915,816 - 34,926,101 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 34,951,577 - 34,961,544 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 5 34,798,052 - 34,808,019 (+) NCBI Celera Cytogenetic Map 5 p13.2 NCBI HuRef 5 34,864,475 - 34,874,444 (+) NCBI HuRef CHM1_1 5 34,918,180 - 34,928,149 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 35,162,745 - 35,173,028 (+) NCBI T2T-CHM13v2.0
Brix1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 10,474,865 - 10,486,023 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 10,474,865 - 10,486,033 (-) Ensembl GRCm39 Ensembl GRCm38 15 10,474,779 - 10,485,937 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 10,474,779 - 10,485,947 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 10,404,534 - 10,415,692 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 10,420,906 - 10,430,632 (-) NCBI MGSCv36 mm8 Celera 15 10,271,850 - 10,283,020 (-) NCBI Celera Cytogenetic Map 15 A1 NCBI cM Map 15 5.35 NCBI
Brix1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955426 20,042,274 - 20,051,606 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955426 20,042,274 - 20,051,606 (+) NCBI ChiLan1.0 ChiLan1.0
BRIX1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 75,410,743 - 75,420,843 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 73,564,375 - 73,574,589 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 75,444,136 - 75,454,911 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 80,723,896 - 80,734,348 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 80,723,896 - 80,734,348 (-) Ensembl panpan1.1 panPan2
BRIX1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 73,375,310 - 73,385,451 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 73,375,304 - 73,385,396 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 72,991,753 - 73,001,881 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 73,881,066 - 73,891,206 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 73,881,060 - 73,891,154 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 73,628,665 - 73,638,767 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 73,752,321 - 73,762,448 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 74,285,566 - 74,295,689 (-) NCBI UU_Cfam_GSD_1.0
Brix1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 224,751,432 - 224,760,886 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936518 6,610,623 - 6,620,383 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936518 6,610,623 - 6,620,369 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BRIX1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 20,512,280 - 20,522,181 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 20,512,281 - 20,520,579 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 21,414,147 - 21,422,488 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BRIX1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 33,807,951 - 33,818,546 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 33,808,309 - 33,820,658 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666071 24,110,260 - 24,121,180 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Brix1
.
Predicted Target Of
Count of predictions: 576 Count of miRNA genes: 256 Interacting mature miRNAs: 313 Transcripts: ENSRNOT00000024285 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
6480225 Gdil1 Gastrointestinal dilation QTL 1 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 56660879 74786777 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2293676 Bmd19 Bone mineral density QTL 19 10.7 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 43162366 111362592 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 2293682 Bmd24 Bone mineral density QTL 24 8.9 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 2 43162366 111362592 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 70174 BpQTLCluster2 Blood pressure QTL cluster 2 4.24 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 40067944 102785628 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 631208 Bw1 Body weight QTL1 5.09 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 2 43171017 83575226 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1300155 Bp174 Blood pressure QTL 174 4.09 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 42804607 60653831 Rat 5684990 Bmd82 Bone mineral density QTL 82 2.8 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 2 59324377 103795077 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat 61371 Edpm1 Estrogen-dependent pituitary mass QTL 1 4 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 35134841 88029593 Rat 1582246 Cm60 Cardiac mass QTL 60 5.8 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 57605612 76539510 Rat 631500 Bp99 Blood pressure QTL 99 2.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 59324719 102755241 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 10755436 Coatc8 Coat color QTL 8 0.02431 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 35023117 80023117 Rat 10755434 Coatc7 Coat color QTL 7 0.04794 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 30648065 75648065 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 5684996 Bmd85 Bone mineral density QTL 85 4.7 0.024 tibia mineral mass (VT:1000283) bone mineral density (CMO:0001226) 2 59324377 103795077 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 9590095 Sffal3 Serum free fatty acids level QTL 3 6.78 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 2 27157160 72157160 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 1558648 Smcn1 Smooth muscle cell number QTL 1 0.039 blood vessel smooth muscle cell quantity (VT:0010525) aorta smooth muscle cell count per unit vessel length (CMO:0001646) 2 59134147 127460910 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1354592 Rf50 Renal function QTL 50 3.5 urine output (VT:0003620) timed urine volume (CMO:0000260) 2 53822747 74786777 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 61438 Cia7 Collagen induced arthritis QTL 7 4.6 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 2 59324377 141596857 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
RH132206
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 61,177,828 - 61,178,036 (+) Marker Load Pipeline mRatBN7.2 2 59,450,667 - 59,450,875 (+) MAPPER mRatBN7.2 Rnor_6.0 2 60,450,607 - 60,450,814 NCBI Rnor6.0 Rnor_5.0 2 84,223,414 - 84,223,621 UniSTS Rnor5.0 RGSC_v3.4 2 59,826,954 - 59,827,161 UniSTS RGSC3.4 Celera 2 59,222,941 - 59,223,148 UniSTS Cytogenetic Map 2 q16 UniSTS
RH139712
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 59,451,878 - 59,452,059 (+) MAPPER mRatBN7.2 Rnor_6.0 2 60,451,818 - 60,451,998 NCBI Rnor6.0 Rnor_5.0 2 84,222,230 - 84,222,410 UniSTS Rnor5.0 RGSC_v3.4 2 59,828,165 - 59,828,345 UniSTS RGSC3.4 Celera 2 59,221,757 - 59,221,937 UniSTS Cytogenetic Map 2 q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024285 ⟹ ENSRNOP00000024285
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 59,451,810 - 59,461,489 (-) Ensembl Rnor_6.0 Ensembl 2 60,450,374 - 60,461,458 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118075 ⟹ ENSRNOP00000082868
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 59,450,614 - 59,461,495 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119136 ⟹ ENSRNOP00000084824
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 59,450,614 - 59,461,495 (-) Ensembl
RefSeq Acc Id:
NM_001029915 ⟹ NP_001025086
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 61,177,769 - 61,188,647 (-) NCBI mRatBN7.2 2 59,450,608 - 59,461,486 (-) NCBI Rnor_6.0 2 60,450,547 - 60,461,425 (-) NCBI Rnor_5.0 2 84,212,803 - 84,223,681 (+) NCBI RGSC_v3.4 2 59,826,894 - 59,837,772 (-) RGD Celera 2 59,212,330 - 59,223,208 (+) RGD
Sequence:
CAGGATGGCGGCGACTAAGAGAAAGCGGCGTGGGGACCTGGAGGTTCAAGCAAAGAAGCCAAAAAAGAACCGGAAAGATGCCGGGCAGCCAGCTAAGCAGGCCGATGTGGCAAAAGAGGCGGAGGAAG
hide sequence
RefSeq Acc Id:
NP_001025086 ⟸ NM_001029915
- UniProtKB:
Q4QQT6 (UniProtKB/Swiss-Prot), A0A8I6G7Z4 (UniProtKB/TrEMBL), A6KJT1 (UniProtKB/TrEMBL)
- Sequence:
MAATKRKRRGDLEVQAKKPKKNRKDAGQPAKQADVAKEAEEEKDRIPGPVCKGKWKNKERILIFSSRGINFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEAKKKQDLYMW
hide sequence
Ensembl Acc Id:
ENSRNOP00000024285 ⟸ ENSRNOT00000024285
Ensembl Acc Id:
ENSRNOP00000082868 ⟸ ENSRNOT00000118075
Ensembl Acc Id:
ENSRNOP00000084824 ⟸ ENSRNOT00000119136
RGD ID: 13691183 Promoter ID: EPDNEW_R1708 Type: multiple initiation site Name: Brix1_1 Description: BRX1, biogenesis of ribosomes SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 60,461,441 - 60,461,501 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-05-06
Brix1
biogenesis of ribosomes BRX1
Brix1
biogenesis of ribosomes BRX1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2019-04-10
Brix1
biogenesis of ribosomes BRX1
Brix1
BRX1, biogenesis of ribosomes
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-02-19
Brix1
BRX1, biogenesis of ribosomes
Brix1
BRX1, biogenesis of ribosomes, homolog (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-07-28
Brix1
BRX1, biogenesis of ribosomes, homolog (S. cerevisiae)
Bxdc2
brix domain containing 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Bxdc2
brix domain containing 2
RGD1308508
similar to BRIX
Symbol and Name updated
1299863 APPROVED
2005-12-06
RGD1308508
similar to BRIX
RGD1308508_predicted
similar to BRIX (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1308508_predicted
similar to BRIX (predicted)
LOC294799_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC294799_predicted
similar to BRIX (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
