Symbol:
Ezh1
Name:
enhancer of zeste 1 polycomb repressive complex 2 subunit
RGD ID:
1305028
Description:
Enables chromatin binding activity. Involved in hippocampus development and positive regulation of transcription by RNA polymerase II. Predicted to be located in chromosome, telomeric region; heterochromatin; and nucleoplasm. Predicted to be part of ESC/E(Z) complex. Predicted to be active in nucleus. Orthologous to human EZH1 (enhancer of zeste 1 polycomb repressive complex 2 subunit); PARTICIPATES IN histone modification pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
enhancer of zeste homolog 1; enhancer of zeste homolog 1 (Drosophila); histone-lysine N-methyltransferase EZH1; LOC303547
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 86,626,307 - 86,662,257 (-) NCBI GRCr8 mRatBN7.2 10 86,126,023 - 86,162,001 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 86,126,015 - 86,161,921 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 91,162,463 - 91,188,804 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 90,641,259 - 90,667,579 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 86,034,424 - 86,060,744 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 89,104,026 - 89,139,978 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 89,104,027 - 89,130,339 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 88,902,522 - 88,938,413 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 90,211,249 - 90,237,563 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 90,227,546 - 90,252,203 (-) NCBI Celera 10 84,843,423 - 84,869,785 (-) NCBI Celera Cytogenetic Map 10 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ezh1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1312814 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of EZH1 mRNA CTD PMID:22206623 Ezh1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1312814 6480464 1,2-Dimethylhydrazine results in increased expression of EZH1 mRNA CTD PMID:22206623 Ezh1 Rat 17beta-estradiol affects expression ISO RGD:1312814 6480464 Estradiol affects the expression of EZH1 mRNA CTD PMID:15598610 Ezh1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1312814 6480464 Tetrachlorodibenzodioxin affects the expression of EZH1 mRNA CTD PMID:21570461 Ezh1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of EZH1 mRNA CTD PMID:32109520 Ezh1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of EZH1 mRNA CTD PMID:21346803 Ezh1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of EZH1 mRNA CTD PMID:21346803 Ezh1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of EZH1 mRNA CTD PMID:30047161 Ezh1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of EZH1 mRNA CTD PMID:30047161 Ezh1 Rat antirheumatic drug increases expression ISO RGD:1312813 6480464 Antirheumatic Agents results in increased expression of EZH1 mRNA CTD PMID:24449571 Ezh1 Rat arsane multiple interactions ISO RGD:1312813 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Ezh1 Rat arsenic atom multiple interactions ISO RGD:1312813 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Ezh1 Rat belinostat increases expression ISO RGD:1312813 6480464 belinostat results in increased expression of EZH1 mRNA CTD PMID:27188386 Ezh1 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of EZH1 mRNA CTD PMID:21839799 Ezh1 Rat benzo[a]pyrene affects methylation ISO RGD:1312813 6480464 Benzo(a)pyrene affects the methylation of EZH1 promoter CTD PMID:27901495 Ezh1 Rat benzo[a]pyrene decreases expression ISO RGD:1312814 6480464 Benzo(a)pyrene results in decreased expression of EZH1 mRNA CTD PMID:22228805 Ezh1 Rat bisphenol A affects expression ISO RGD:1312813 6480464 bisphenol A affects the expression of EZH1 mRNA CTD PMID:20170705 Ezh1 Rat bisphenol A increases expression ISO RGD:1312813 6480464 bisphenol A results in increased expression of EZH1 mRNA CTD PMID:29275510 Ezh1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of EZH1 mRNA CTD PMID:25181051|PMID:30816183 Ezh1 Rat cadmium dichloride decreases expression ISO RGD:1312813 6480464 Cadmium Chloride results in decreased expression of EZH1 mRNA CTD PMID:38568856 Ezh1 Rat carbon nanotube decreases expression ISO RGD:1312814 6480464 Nanotubes, Carbon analog results in decreased expression of EZH1 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Ezh1 Rat chlorpyrifos decreases expression ISO RGD:1312814 6480464 Chlorpyrifos results in decreased expression of EZH1 mRNA CTD PMID:37019170 Ezh1 Rat cisplatin decreases expression ISO RGD:1312813 6480464 Cisplatin results in decreased expression of EZH1 mRNA CTD PMID:27594783 Ezh1 Rat cisplatin increases expression ISO RGD:1312813 6480464 Cisplatin results in increased expression of EZH1 mRNA CTD PMID:27392435 Ezh1 Rat crocidolite asbestos decreases expression ISO RGD:1312814 6480464 Asbestos, Crocidolite results in decreased expression of EZH1 mRNA CTD PMID:29279043 Ezh1 Rat cyclosporin A increases expression ISO RGD:1312813 6480464 Cyclosporine results in increased expression of EZH1 mRNA CTD PMID:25562108 Ezh1 Rat dexamethasone multiple interactions ISO RGD:1312813 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in increased expression of EZH1 more ... CTD PMID:26424790 Ezh1 Rat Dibutyl phosphate affects expression ISO RGD:1312813 6480464 di-n-butylphosphoric acid affects the expression of EZH1 mRNA CTD PMID:37042841 Ezh1 Rat dibutyl phthalate increases expression ISO RGD:1312814 6480464 Dibutyl Phthalate results in increased expression of EZH1 mRNA CTD PMID:21266533 Ezh1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of EZH1 mRNA CTD PMID:21266533 Ezh1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of EZH1 mRNA CTD PMID:37077353 Ezh1 Rat disodium selenite increases expression ISO RGD:1312813 6480464 Sodium Selenite results in increased expression of EZH1 mRNA CTD PMID:18175754 Ezh1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of EZH1 mRNA CTD PMID:25152437 Ezh1 Rat dorsomorphin multiple interactions ISO RGD:1312813 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Ezh1 Rat doxorubicin decreases expression ISO RGD:1312813 6480464 Doxorubicin results in decreased expression of EZH1 mRNA CTD PMID:29803840 Ezh1 Rat ellagic acid increases expression ISO RGD:1312813 6480464 Ellagic Acid results in increased expression of EZH1 mRNA CTD PMID:12002526 Ezh1 Rat ethyl methanesulfonate increases expression ISO RGD:1312813 6480464 Ethyl Methanesulfonate results in increased expression of EZH1 mRNA CTD PMID:23649840 Ezh1 Rat folic acid decreases expression ISO RGD:1312814 6480464 Folic Acid results in decreased expression of EZH1 mRNA CTD PMID:25629700 Ezh1 Rat folic acid multiple interactions ISO RGD:1312814 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of EZH1 mRNA CTD PMID:22206623 Ezh1 Rat FR900359 increases phosphorylation ISO RGD:1312813 6480464 FR900359 results in increased phosphorylation of EZH1 protein CTD PMID:37730182 Ezh1 Rat glycerol 2-phosphate multiple interactions ISO RGD:1312813 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in increased expression of EZH1 more ... CTD PMID:26424790 Ezh1 Rat isoprenaline increases expression ISO RGD:1312814 6480464 Isoproterenol results in increased expression of EZH1 mRNA CTD PMID:20003209 Ezh1 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of EZH1 mRNA CTD PMID:20080153 Ezh1 Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of EZH1 mRNA CTD PMID:37077353 Ezh1 Rat L-ascorbic acid multiple interactions ISO RGD:1312813 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in increased expression of EZH1 more ... CTD PMID:26424790 Ezh1 Rat manganese atom multiple interactions ISO RGD:1312813 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Ezh1 Rat manganese(0) multiple interactions ISO RGD:1312813 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Ezh1 Rat manganese(II) chloride multiple interactions ISO RGD:1312813 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Ezh1 Rat mercury atom increases expression ISO RGD:1312813 6480464 Mercury results in increased expression of EZH1 mRNA CTD PMID:16823088 Ezh1 Rat mercury(0) increases expression ISO RGD:1312813 6480464 Mercury results in increased expression of EZH1 mRNA CTD PMID:16823088 Ezh1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of EZH1 mRNA CTD PMID:30467583 Ezh1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of EZH1 mRNA CTD PMID:30047161 Ezh1 Rat monosodium L-glutamate multiple interactions ISO RGD:1312814 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in decreased expression of EZH1 mRNA CTD PMID:22078008 Ezh1 Rat nickel atom decreases expression ISO RGD:1312813 6480464 Nickel results in decreased expression of EZH1 mRNA CTD PMID:25583101 Ezh1 Rat nitrates multiple interactions ISO RGD:1312814 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of EZH1 more ... CTD PMID:35964746 Ezh1 Rat nitric oxide decreases expression ISO RGD:1312814 6480464 Nitric Oxide deficiency results in decreased expression of EZH1 mRNA CTD PMID:15878706 Ezh1 Rat okadaic acid decreases expression ISO RGD:1312813 6480464 Okadaic Acid results in decreased expression of EZH1 mRNA CTD PMID:38832940 Ezh1 Rat ozone multiple interactions ISO RGD:1312814 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:34911549 Ezh1 Rat phenylmercury acetate decreases expression ISO RGD:1312813 6480464 Phenylmercuric Acetate results in decreased expression of EZH1 mRNA CTD PMID:26272509 Ezh1 Rat phenylmercury acetate multiple interactions ISO RGD:1312813 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Ezh1 Rat resveratrol increases expression ISO RGD:1312813 6480464 resveratrol results in increased expression of EZH1 mRNA CTD PMID:12002526 Ezh1 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine decreases expression ISO RGD:1312814 6480464 Buthionine Sulfoximine results in decreased expression of EZH1 mRNA CTD PMID:15878706 Ezh1 Rat SB 431542 multiple interactions ISO RGD:1312813 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Ezh1 Rat sodium arsenite multiple interactions ISO RGD:1312813 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Ezh1 Rat sodium arsenite increases expression ISO RGD:1312814 6480464 sodium arsenite results in increased expression of EZH1 mRNA CTD PMID:35364107 Ezh1 Rat sodium arsenite multiple interactions ISO RGD:1312814 6480464 GSK-2816126 promotes the reaction [sodium arsenite results in increased expression of EZH1 mRNA] CTD PMID:35364107 Ezh1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of EZH1 mRNA CTD PMID:30047161 Ezh1 Rat tetrachloromethane decreases expression ISO RGD:1312814 6480464 Carbon Tetrachloride results in decreased expression of EZH1 mRNA CTD PMID:17484886 Ezh1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of EZH1 mRNA CTD PMID:23411599 Ezh1 Rat thiram increases expression ISO RGD:1312813 6480464 Thiram results in increased expression of EZH1 mRNA CTD PMID:38568856 Ezh1 Rat titanium dioxide increases expression ISO RGD:1312814 6480464 titanium dioxide results in increased expression of EZH1 mRNA CTD PMID:29264374 Ezh1 Rat titanium dioxide decreases methylation ISO RGD:1312814 6480464 titanium dioxide results in decreased methylation of EZH1 gene CTD PMID:35295148 Ezh1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of EZH1 gene CTD PMID:27618143 Ezh1 Rat trichostatin A decreases expression ISO RGD:1312813 6480464 trichostatin A results in decreased expression of EZH1 mRNA CTD PMID:24935251 Ezh1 Rat triphenyl phosphate affects expression ISO RGD:1312813 6480464 triphenyl phosphate affects the expression of EZH1 mRNA CTD PMID:37042841 Ezh1 Rat tungsten decreases expression ISO RGD:1312814 6480464 Tungsten results in decreased expression of EZH1 mRNA CTD PMID:30912803 Ezh1 Rat urethane decreases expression ISO RGD:1312813 6480464 Urethane results in decreased expression of EZH1 mRNA CTD PMID:28818685 Ezh1 Rat valproic acid affects expression ISO RGD:1312813 6480464 Valproic Acid affects the expression of EZH1 mRNA CTD PMID:25979313 Ezh1 Rat valproic acid decreases expression ISO RGD:1312813 6480464 Valproic Acid results in decreased expression of EZH1 mRNA CTD PMID:23179753|PMID:24383497|PMID:26272509 Ezh1 Rat valproic acid multiple interactions ISO RGD:1312813 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Ezh1 Rat vitamin E increases expression ISO RGD:1312813 6480464 Vitamin E results in increased expression of EZH1 mRNA CTD PMID:19244175
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 6-propyl-2-thiouracil (EXP) amitrole (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) belinostat (ISO) benzo[a]pyrene (EXP,ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) cisplatin (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) diethylstilbestrol (EXP) disodium selenite (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) ellagic acid (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) FR900359 (ISO) glycerol 2-phosphate (ISO) isoprenaline (ISO) ketamine (EXP) ketoconazole (EXP) L-ascorbic acid (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury atom (ISO) mercury(0) (ISO) methapyrilene (EXP) methimazole (EXP) monosodium L-glutamate (ISO) nickel atom (ISO) nitrates (ISO) nitric oxide (ISO) okadaic acid (ISO) ozone (ISO) phenylmercury acetate (ISO) resveratrol (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) SB 431542 (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO) vitamin E (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Ezh1 and Ezh2 differentially regulate PSD-95 gene transcription in developing hippocampal neurons.
Henriquez B, etal., Mol Cell Neurosci. 2013 Nov;57:130-43. doi: 10.1016/j.mcn.2013.07.012. Epub 2013 Aug 8.
4.
SET for life: biochemical activities and biological functions of SET domain-containing proteins.
Herz HM, etal., Trends Biochem Sci. 2013 Dec;38(12):621-39. doi: 10.1016/j.tibs.2013.09.004. Epub 2013 Oct 20.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Occupying chromatin: Polycomb mechanisms for getting to genomic targets, stopping transcriptional traffic, and staying put.
Simon JA and Kingston RE, Mol Cell. 2013 Mar 7;49(5):808-24. doi: 10.1016/j.molcel.2013.02.013.
Ezh1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 86,626,307 - 86,662,257 (-) NCBI GRCr8 mRatBN7.2 10 86,126,023 - 86,162,001 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 86,126,015 - 86,161,921 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 91,162,463 - 91,188,804 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 90,641,259 - 90,667,579 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 86,034,424 - 86,060,744 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 89,104,026 - 89,139,978 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 89,104,027 - 89,130,339 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 88,902,522 - 88,938,413 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 90,211,249 - 90,237,563 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 90,227,546 - 90,252,203 (-) NCBI Celera 10 84,843,423 - 84,869,785 (-) NCBI Celera Cytogenetic Map 10 q31 NCBI
EZH1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 42,700,275 - 42,745,040 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 42,700,275 - 42,745,049 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 40,852,293 - 40,897,058 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 38,105,819 - 38,150,574 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 38,105,819 - 38,150,574 NCBI Celera 17 37,507,762 - 37,552,422 (-) NCBI Celera Cytogenetic Map 17 q21.2 NCBI HuRef 17 36,617,368 - 36,662,170 (-) NCBI HuRef CHM1_1 17 41,087,908 - 41,132,634 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 43,557,412 - 43,602,180 (-) NCBI T2T-CHM13v2.0
Ezh1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 101,081,941 - 101,117,268 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 101,081,941 - 101,117,289 (-) Ensembl GRCm39 Ensembl GRCm38 11 101,191,115 - 101,226,463 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 101,191,115 - 101,226,463 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 101,052,429 - 101,087,764 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 101,007,206 - 101,044,038 (-) NCBI MGSCv36 mm8 Celera 11 112,487,231 - 112,522,681 (-) NCBI Celera Cytogenetic Map 11 D NCBI cM Map 11 64.37 NCBI
Ezh1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955451 16,548,858 - 16,564,310 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955451 16,548,898 - 16,563,449 (-) NCBI ChiLan1.0 ChiLan1.0
EZH1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 22,240,711 - 22,285,877 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 24,130,797 - 24,175,862 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 14,572,868 - 14,618,012 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 14,814,061 - 14,842,295 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 14,814,054 - 14,842,295 (+) Ensembl panpan1.1 panPan2
EZH1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 20,271,729 - 20,292,918 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 20,264,552 - 20,290,712 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 19,724,769 - 19,754,876 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 20,981,842 - 21,011,945 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 20,981,878 - 21,011,945 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 19,767,995 - 19,797,890 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 20,032,956 - 20,063,052 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 20,136,953 - 20,167,063 (+) NCBI UU_Cfam_GSD_1.0
Ezh1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 19,609,211 - 19,644,761 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 17,428,677 - 17,465,877 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 17,430,383 - 17,465,889 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EZH1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 20,115,297 - 20,141,749 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 20,107,744 - 20,139,764 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 20,304,800 - 20,338,128 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EZH1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 63,544,483 - 63,592,651 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 63,558,551 - 63,587,501 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 34,337,734 - 34,385,777 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ezh1
.
Predicted Target Of
Count of predictions: 363 Count of miRNA genes: 210 Interacting mature miRNAs: 259 Transcripts: ENSRNOT00000027640 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631555 Bp134 Blood pressure QTL 134 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 80515287 91230079 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 4889948 Bss91 Bone structure and strength QTL 91 4 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 10 82564856 92369470 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2306792 Ean4 Experimental allergic neuritis QTL 4 4 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 84022321 93995963 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 1358915 Stresp7 Stress response QTL 7 3.52 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 78899655 87307728 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 12880055 Am11 Aortic mass QTL 11 0.004 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 84007272 95933025 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 2301398 Kidm38 Kidney mass QTL 38 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 84007272 95933025 Rat 1600367 Mcs15 Mammary carcinoma susceptibility QTL 15 4.5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 85565469 103884409 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631537 Oia4 Oil induced arthritis QTL 4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 75631887 87055282 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
RH129834
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 86,126,064 - 86,126,262 (+) MAPPER mRatBN7.2 Rnor_6.0 10 89,104,068 - 89,104,265 NCBI Rnor6.0 Rnor_5.0 10 88,902,564 - 88,902,761 UniSTS Rnor5.0 RGSC_v3.4 10 90,211,290 - 90,211,487 UniSTS RGSC3.4 Celera 10 84,843,464 - 84,843,661 UniSTS RH 3.4 Map 10 877.1 UniSTS Cytogenetic Map 10 q32.1 UniSTS
RH134861
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 86,133,121 - 86,133,313 (+) MAPPER mRatBN7.2 Rnor_6.0 10 89,111,125 - 89,111,316 NCBI Rnor6.0 Rnor_5.0 10 88,909,621 - 88,909,812 UniSTS Rnor5.0 RGSC_v3.4 10 90,218,347 - 90,218,538 UniSTS RGSC3.4 Celera 10 84,850,521 - 84,850,712 UniSTS RH 3.4 Map 10 877.1 UniSTS Cytogenetic Map 10 q32.1 UniSTS
MARC_15753-15754:1017935735:1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 86,629,058 - 86,629,870 (+) Marker Load Pipeline mRatBN7.2 10 86,128,774 - 86,129,586 (+) MAPPER mRatBN7.2 Rnor_6.0 10 89,106,778 - 89,107,589 NCBI Rnor6.0 Rnor_5.0 10 88,905,274 - 88,906,085 UniSTS Rnor5.0 RGSC_v3.4 10 90,214,000 - 90,214,811 UniSTS RGSC3.4 Celera 10 84,846,174 - 84,846,985 UniSTS Cytogenetic Map 10 q32.1 UniSTS
BARC0021
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 86,629,817 - 86,630,300 (+) Marker Load Pipeline mRatBN7.2 10 86,129,533 - 86,130,016 (+) MAPPER mRatBN7.2 Rnor_6.0 10 89,107,537 - 89,108,019 NCBI Rnor6.0 Rnor_5.0 10 88,906,033 - 88,906,515 UniSTS Rnor5.0 RGSC_v3.4 10 90,214,759 - 90,215,241 UniSTS RGSC3.4 Celera 10 84,846,933 - 84,847,415 UniSTS Cytogenetic Map 10 q32.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027640 ⟹ ENSRNOP00000027640
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 86,126,026 - 86,161,921 (-) Ensembl Rnor_6.0 Ensembl 10 89,104,027 - 89,130,339 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101475 ⟹ ENSRNOP00000089467
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 86,126,015 - 86,161,917 (-) Ensembl
RefSeq Acc Id:
NM_001107051 ⟹ NP_001100521
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 86,626,308 - 86,652,620 (-) NCBI mRatBN7.2 10 86,126,024 - 86,152,338 (-) NCBI Rnor_6.0 10 89,104,027 - 89,130,339 (-) NCBI Rnor_5.0 10 88,902,522 - 88,938,413 (-) NCBI RGSC_v3.4 10 90,211,249 - 90,237,563 (-) RGD Celera 10 84,843,423 - 84,869,785 (-) RGD
Sequence:
GGTCTCGCCATTCTTCTGAAGAACAGAGGTACAGTATAAAGTCCAACATTTCCTGCTGCATTCCGTGAGGAAAATGGATATAGCAAGTCCCCCAACTTCCAAATGCATCACATACTGGAAAAGAAAGG
hide sequence
RefSeq Acc Id:
XM_006247318 ⟹ XP_006247380
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 86,626,307 - 86,662,257 (-) NCBI mRatBN7.2 10 86,126,023 - 86,162,001 (-) NCBI Rnor_6.0 10 89,104,026 - 89,139,978 (-) NCBI Rnor_5.0 10 88,902,522 - 88,938,413 (-) NCBI
Sequence:
CGCGGGGCGTGGCCGCGGCGCAGGGGCGTGGCCGTAGCGCGCAGGCGTCCTAGTGGCGAGTGTC
hide sequence
RefSeq Acc Id:
XM_006247319 ⟹ XP_006247381
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 86,626,307 - 86,662,112 (-) NCBI mRatBN7.2 10 86,126,023 - 86,161,848 (-) NCBI Rnor_6.0 10 89,104,026 - 89,139,890 (-) NCBI Rnor_5.0 10 88,902,522 - 88,938,413 (-) NCBI
Sequence:
GAGTAAACAAGCCGGGGCTGGGCGGTGGGGCCGGGCCTCGGCATGGCGTGACATCGGAAACTCA
hide sequence
RefSeq Acc Id:
XM_008768052 ⟹ XP_008766274
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 86,626,307 - 86,662,240 (-) NCBI mRatBN7.2 10 86,126,023 - 86,162,001 (-) NCBI Rnor_6.0 10 89,104,026 - 89,139,978 (-) NCBI
Sequence:
CGCGGGGCGTGGCCGCGGCGCAGGGGCGTGGCCGTAGCGCGCAGGCGTCCTAGTGGCGAGTGTCTGCGTCTCAGGATGGAGGGTCTCGCCATTCTTCTGAAGAACAGAGGTACAGTATAAAGTCCAAC
hide sequence
RefSeq Acc Id:
NP_001100521 ⟸ NM_001107051
- UniProtKB:
A6HJ95 (UniProtKB/TrEMBL), F1LZH3 (UniProtKB/TrEMBL)
- Sequence:
MDIASPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEWKKLRVQPVQPMKPVSGHPFLKKCTIESIFPGFDSQDMLMRSLNTVALVPIMYSWSPLQQNFMVEDETV
hide sequence
RefSeq Acc Id:
XP_006247380 ⟸ XM_006247318
- Peptide Label:
isoform X1
- UniProtKB:
F1LZH3 (UniProtKB/TrEMBL)
- Sequence:
MDIASPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQLLNEEWKKLRVQPVQPMKPVSGHPFLKKCTIESIFPGFDSQDMLMRSLNTVALVPIMYSWSPLQQNFMVEDETV
hide sequence
RefSeq Acc Id:
XP_006247381 ⟸ XM_006247319
- Peptide Label:
isoform X1
- UniProtKB:
F1LZH3 (UniProtKB/TrEMBL)
- Sequence:
MDIASPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQLLNEEWKKLRVQPVQPMKPVSGHPFLKKCTIESIFPGFDSQDMLMRSLNTVALVPIMYSWSPLQQNFMVEDETV
hide sequence
RefSeq Acc Id:
XP_008766274 ⟸ XM_008768052
- Peptide Label:
isoform X1
- UniProtKB:
F1LZH3 (UniProtKB/TrEMBL)
- Sequence:
MDIASPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQLLNEEWKKLRVQPVQPMKPVSGHPFLKKCTIESIFPGFDSQDMLMRSLNTVALVPIMYSWSPLQQNFMVEDETV
hide sequence
Ensembl Acc Id:
ENSRNOP00000027640 ⟸ ENSRNOT00000027640
Ensembl Acc Id:
ENSRNOP00000089467 ⟸ ENSRNOT00000101475
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-06-06
Ezh1
enhancer of zeste 1 polycomb repressive complex 2 subunit
Ezh1
enhancer of zeste homolog 1 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Ezh1
enhancer of zeste homolog 1 (Drosophila)
Ezh1_predicted
enhancer of zeste homolog 1 (Drosophila) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Ezh1_predicted
enhancer of zeste homolog 1 (Drosophila) (predicted)
Symbol and Name status set to approved
70820 APPROVED
