Advanced Search (OLGA)

Gene: Abhd11 (abhydrolase domain containing 11) Rattus norvegicus

Analyze

Symbol:

Abhd11

Name:

abhydrolase domain containing 11

RGD ID:

1304681

Description:

Predicted to enable lipase activity. Predicted to be involved in lipid metabolic process. Predicted to be located in mitochondrial matrix. Predicted to be part of oxoglutarate dehydrogenase complex. Predicted to be active in mitochondrion. Orthologous to human ABHD11 (abhydrolase domain containing 11); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; amitrole.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Abhd11l1; abhydrolase domain containing 11-like 1; alpha/beta hydrolase domain-containing protein 11; sn-1-specific diacylglycerol lipase ABHD11; Wbscr21; Williams Beuren syndrome chromosome region 21

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ABHD11 (abhydrolase domain containing 11)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Abhd11 (abhydrolase domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Abhd11 (abhydrolase domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ABHD11 (abhydrolase domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ABHD11 (abhydrolase domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Abhd11 (abhydrolase domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ABHD11 (abhydrolase domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ABHD11 (abhydrolase domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Abhd11 (abhydrolase domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ABHD11 (abhydrolase domain containing 11)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Abhd11 (abhydrolase domain containing 11)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	abhd11 (abhydrolase domain containing 11)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG14717	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder)
Drosophila melanogaster (fruit fly):	CG2059	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	IMO32	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	abhd-11.1	Alliance	DIOPT (InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	abhd-11.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	abhd11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,318,739 - 27,322,016 (-)	NCBI		GRCr8
mRatBN7.2	12	21,682,206 - 21,685,331 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,682,202 - 21,685,398 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	22,823,227 - 22,825,957 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	23,435,546 - 23,438,280 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	22,503,442 - 22,506,162 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	24,722,277 - 24,725,760 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	24,722,283 - 24,724,997 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	26,722,547 - 26,725,267 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	12	23,412,608 - 23,447,868 (-)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

autistic disorder (ISO)

intestinal volvulus (ISO)

Neurodevelopmental Disorders (ISO)

pleomorphic xanthoastrocytoma (ISO)

schizophrenia (ISO)

supravalvular aortic stenosis (ISO)

Volvulus Of Midgut (ISO)

Williams-Beuren syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

atrazine (EXP)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

Brodifacoum (EXP)

cadmium dichloride (ISO)

carbon nanotube (ISO)

carnosic acid (ISO)

choline (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

copper atom (ISO)

copper(0) (ISO)

coumestrol (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

diuron (ISO)

dorsomorphin (ISO)

Enterolactone (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

gallic acid (ISO)

genistein (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

ivermectin (ISO)

L-methionine (ISO)

lithium chloride (ISO)

methimazole (EXP)

ozone (EXP,ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

progesterone (ISO)

resveratrol (ISO)

SB 431542 (ISO)

senecionine (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tanespimycin (ISO)

tetrachloromethane (ISO)

theophylline (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trametinib (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

lipid metabolic process (IBA)

Cellular Component

mitochondrial matrix (ISO)

mitochondrion (IBA,ISO)

oxoglutarate dehydrogenase complex (ISO)

Molecular Function

carboxylic ester hydrolase activity (IBA)

lipase activity (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12477932	PMID:18614015

Genomics

Comparative Map Data

Abhd11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,318,739 - 27,322,016 (-)	NCBI		GRCr8
mRatBN7.2	12	21,682,206 - 21,685,331 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,682,202 - 21,685,398 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	22,823,227 - 22,825,957 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	23,435,546 - 23,438,280 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	22,503,442 - 22,506,162 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	24,722,277 - 24,725,760 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	24,722,283 - 24,724,997 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	26,722,547 - 26,725,267 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	12	23,412,608 - 23,447,868 (-)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

ABHD11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	73,736,094 - 73,738,802 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	73,736,094 - 73,738,852 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	73,150,424 - 73,153,132 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	72,788,363 - 72,791,120 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	7	68,628,612 - 68,631,377 (-)	NCBI		Celera
Cytogenetic Map	7	q11.23	NCBI
HuRef	7	69,033,148 - 69,035,914 (-)	NCBI		HuRef
CHM1_1	7	73,296,148 - 73,298,913 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	74,936,993 - 74,939,701 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	72,483,496 - 72,486,262 (-)	NCBI

Abhd11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	135,038,006 - 135,041,029 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	135,038,006 - 135,041,029 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	135,009,152 - 135,012,175 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	135,009,152 - 135,012,175 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	135,485,022 - 135,488,045 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	135,293,926 - 135,296,797 (+)	NCBI		MGSCv36	mm8
Celera	5	132,019,360 - 132,022,383 (+)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	74.94	NCBI

Abhd11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	14,018,109 - 14,021,483 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955456	14,019,073 - 14,021,536 (+)	NCBI	ChiLan1.0	ChiLan1.0

ABHD11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	91,160,995 - 91,163,780 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	139,425,641 - 139,428,411 (+)	NCBI		NHGRI_mPanPan1
PanPan1.1	7	80,889,063 - 80,891,826 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	80,889,063 - 80,891,826 (-)	Ensembl	panpan1.1		panPan2

ABHD11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	6,550,929 - 6,553,392 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	6,550,923 - 6,553,362 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	8,248,442 - 8,250,868 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	6,366,074 - 6,368,503 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	6,366,028 - 6,371,424 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	6,355,576 - 6,358,002 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	6,303,330 - 6,305,756 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	6,467,029 - 6,469,455 (+)	NCBI		UU_Cfam_GSD_1.0

Abhd11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	131,100,366 - 131,102,815 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	2,930,786 - 2,936,218 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	2,933,752 - 2,936,122 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ABHD11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	11,000,998 - 11,003,795 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	11,000,991 - 11,003,789 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	10,697,167 - 10,700,542 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ABHD11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	9,330,037 - 9,332,788 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	9,329,923 - 9,334,816 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666070	7,171,267 - 7,174,005 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Abhd11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	14,093,439 - 14,095,994 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	14,093,587 - 14,099,465 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Abhd11
16 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	8525423	28064601	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	23297788	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
10755457	Coatc14	Coat color QTL 14		0.01759	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	12	1	22591684	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	28064557	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	19610870	24139202	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	1	29333307	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	11073825	24234895	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	13635523	30827399	Rat
631521	Pia12	Pristane induced arthritis QTL 12	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	20259417	23672083	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	8449490	28302290	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

Markers in Region

AI462243

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,681,703 - 21,681,802 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	24,721,775 - 24,721,873	NCBI	Rnor6.0
Rnor_5.0	12	26,722,045 - 26,722,143	UniSTS	Rnor5.0
RGSC_v3.4	12	22,776,837 - 22,776,935	UniSTS	RGSC3.4
Celera	12	23,444,675 - 23,444,773	UniSTS
Cytogenetic Map	12	q12	UniSTS

BF397463

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	27,292,979 - 27,293,453 (+)	Marker Load Pipeline
mRatBN7.2	12	21,656,433 - 21,656,907 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	24,696,511 - 24,696,984	NCBI	Rnor6.0
Rnor_5.0	12	26,696,781 - 26,697,254	UniSTS	Rnor5.0
RGSC_v3.4	12	22,751,573 - 22,752,046	UniSTS	RGSC3.4
Celera	12	23,419,618 - 23,420,091	UniSTS
RH 3.4 Map	12	327.3	UniSTS
Cytogenetic Map	12	q12	UniSTS

AU048378

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,650,148 - 21,650,283 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	24,690,228 - 24,690,360	NCBI	Rnor6.0
Rnor_5.0	12	26,690,498 - 26,690,630	UniSTS	Rnor5.0
RGSC_v3.4	12	22,745,290 - 22,745,422	UniSTS	RGSC3.4
Celera	12	23,413,335 - 23,413,467	UniSTS
Cytogenetic Map	12	q12	UniSTS

RH140758

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	27,319,008 - 27,319,395 (+)	Marker Load Pipeline
mRatBN7.2	12	21,682,471 - 21,682,858 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	24,722,543 - 24,722,929	NCBI	Rnor6.0
Rnor_5.0	12	26,722,813 - 26,723,199	UniSTS	Rnor5.0
RGSC_v3.4	12	22,777,605 - 22,777,991	UniSTS	RGSC3.4
Celera	12	23,445,414 - 23,445,800	UniSTS
RH 3.4 Map	12	309.2	UniSTS
Cytogenetic Map	12	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001271180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213935	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025560 ⟹ ENSRNOP00000025560

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	21,682,202 - 21,684,930 (-)	Ensembl
Rnor_6.0 Ensembl	12	24,722,283 - 24,724,997 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096497 ⟹ ENSRNOP00000094705

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	21,682,202 - 21,685,398 (-)	Ensembl

RefSeq Acc Id:

NM_001271180 ⟹ NP_001258109

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	27,318,743 - 27,321,463 (-)	NCBI
mRatBN7.2	12	21,682,206 - 21,684,927 (-)	NCBI
Rnor_6.0	12	24,722,277 - 24,724,997 (-)	NCBI
Rnor_5.0	12	26,722,547 - 26,725,267 (-)	NCBI
Celera	12	23,412,608 - 23,447,868 (-)	NCBI

Sequence:

show sequence

GCGTGCGCAGGAAGCACGTTTTGAGAGCTGTGAGAATGTTCTGCTGGGCGCGAGCTTGGAGGGT
CCCCCGTGGGACAATCGGTGCCTCCTCTCCCAGGAGTTCGGCGGTTCCTGTCACGTTCAGTAGC
AGCCGCAGTAGTGGCCAAGGAAACGCTGATCCGAGGCCGCTGCCGCTGTCCTATAATCTTCTAG
ATGGAGACGCGACACTCCCAGCCATCGTCCTTTTGCATGGACTCTTCGGCAGCAAAAGCAACTT
CAACTCCCTCGCCAAGGCGTTGGTTCAGAGGACCGGCAGGAGGGTGCTGACAGTGGATGCTCGG
AATCATGGTGACAGTCCCCACAGTCCAGATGCAAGCTATGAGGCCATGAGTCAGGACCTCCAGG
GCCTCCTCCCCCAGCTGGGCCTGGTGCCCAGTGTCCTCGTTGGCCACAGCATGGGAGGAAAGAC
AGCCATGCTACTGGCACTGCAGAGGCCAGATGTTGTGGAACGACTGGTTGTCGTAGACATAAGC
CCAGCAGGAACCACACCGGGATCATACCTCGGAAACTTCATAGCAGCCATGAAGGCCGTTGATA
TCCCAGAGAACATACCGCACTCCCGGGCCCGAAAACTGGCGGATGAGCAGCTTAGCTCGGTTGT
CAAGGAAGCGAGCGTTCGGCAGTTCCTGCTCACTAACCTGGTGGAGGTGAATGGGCGCTTCTCC
TGGAGAGTGAACTTGGATGCCTTAGCTCAGCAGTTGGACAAGATTTTGACCTTCCCACAGCAAC
TTGAATCCTACCCGGGGTCAACTCTCTTTCTGCTTGGTGGAAATTCTCCCTACGTACCACCCAG
CCACCACTCAGCGATTAGGCGGCTCTTCCCTCAAACCCAGATTCAGACTGTGCCTAATGCTGGC
CACTGGGTCCACAGCGACAAACCCCAAGACTTCATGGATGCTGTCATCAGCTTCTTGGCTTAAG
AAGTAGCTCTTTGGGGCTGGAGAGATAGCTCAGGGGTTAAGAGCACTGACCGCTCTTCCAGAGG
TCCTGAGTTCAATTCCCAGCAACCACATGGTGGCTCACAACCATCTGTAGTGGGATCTTGGCGC
CCTCTTCTGGCGCCCAGGCACATATGCAGGCAGAACACTGTACATAATAAATCTTTTAAAAAA

hide sequence

RefSeq Acc Id:

XM_063271552 ⟹ XP_063127622

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	27,318,739 - 27,322,016 (-)	NCBI

RefSeq Acc Id:

XM_063271553 ⟹ XP_063127623

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	27,319,651 - 27,322,016 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001258109	(Get FASTA)	NCBI Sequence Viewer
	XP_063127622	(Get FASTA)	NCBI Sequence Viewer
	XP_063127623	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025560.4
	ENSRNOP00000094705.1

RefSeq Acc Id:

NP_001258109 ⟸ NM_001271180

- UniProtKB:

D3ZXK4 (UniProtKB/TrEMBL), A6J0G1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MFCWARAWRVPRGTIGASSPRSSAVPVTFSSSRSSGQGNADPRPLPLSYNLLDGDATLPAIVLL
HGLFGSKSNFNSLAKALVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPSV
LVGHSMGGKTAMLLALQRPDVVERLVVVDISPAGTTPGSYLGNFIAAMKAVDIPENIPHSRARK
LADEQLSSVVKEASVRQFLLTNLVEVNGRFSWRVNLDALAQQLDKILTFPQQLESYPGSTLFLL
GGNSPYVPPSHHSAIRRLFPQTQIQTVPNAGHWVHSDKPQDFMDAVISFLA

hide sequence

Ensembl Acc Id:

ENSRNOP00000025560 ⟸ ENSRNOT00000025560

Ensembl Acc Id:

ENSRNOP00000094705 ⟸ ENSRNOT00000096497

RefSeq Acc Id:	XP_063127622 ⟸ XM_063271552
- Peptide Label:	isoform X1
- UniProtKB:	A6J0G1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063127623 ⟸ XM_063271553
- Peptide Label:	isoform X2

Protein Domains

AB hydrolase-1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZXK4-F1-model_v2	AlphaFold	D3ZXK4	1-307	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698563

Promoter ID:

EPDNEW_R9088

Type:

multiple initiation site

Name:

Abhd11_1

Description:

abhydrolase domain containing 11

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	24,724,989 - 24,725,049	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304681	AgrOrtholog
BioCyc Gene	G2FUF-19599	BioCyc
Ensembl Genes	ENSRNOG00000018910	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025560.7	UniProtKB/TrEMBL
	ENSRNOT00000096497.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.1820	UniProtKB/TrEMBL
InterPro	AB_hydrolase	UniProtKB/TrEMBL
	AB_hydrolase_1	UniProtKB/TrEMBL
	Epox_hydrolase-like	UniProtKB/TrEMBL
KEGG Report	rno:360831	UniProtKB/TrEMBL
NCBI Gene	Abhd11	ENTREZGENE
PANTHER	PROTEIN ABHD11	UniProtKB/TrEMBL
	PROTEIN ABHD11	UniProtKB/TrEMBL
Pfam	Abhydrolase_1	UniProtKB/TrEMBL
PhenoGen	Abhd11	PhenoGen
PRINTS	ABHYDROLASE	UniProtKB/TrEMBL
	EPOXHYDRLASE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018910	RatGTEx
Superfamily-SCOP	SSF53474	UniProtKB/TrEMBL
UniProt	A0A8I6AS56_RAT	UniProtKB/TrEMBL
	A6J0G1	ENTREZGENE, UniProtKB/TrEMBL
	D3ZXK4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-11-30	Abhd11	abhydrolase domain containing 11	Abhd11l1	abhydrolase domain containing 11-like 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar