Symbol:
Kif5a
Name:
kinesin family member 5A
RGD ID:
1303035
Description:
Enables scaffold protein binding activity. Involved in several processes, including axonal transport; cellular response to ethanol; and forebrain development. Located in several cellular components, including P-body; central region of growth cone; and perikaryon. Part of kinesin complex. Human ortholog(s) of this gene implicated in amyotrophic lateral sclerosis type 25; hereditary spastic paraplegia 10; multiple sclerosis; prostate cancer; and rheumatoid arthritis. Orthologous to human KIF5A (kinesin family member 5A); PARTICIPATES IN mitochondria transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; acetamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
kinesin heavy chain isoform 5A; kinesin heavy chain neuron-specific 1; neuronal kinesin heavy chain; NKHC
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KIF5A (kinesin family member 5A) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Kif5a (kinesin family member 5A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kif5a (kinesin family member 5A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KIF5A (kinesin family member 5A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KIF5A (kinesin family member 5A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kif5a (kinesin family member 5A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KIF5A (kinesin family member 5A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KIF5A (kinesin family member 5A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kif5a (kinesin family member 5A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SLC25A28 (solute carrier family 25 member 28) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
KIF5A (kinesin family member 5A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kif5a (kinesin family member 5A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kif5aa (kinesin family member 5A, a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Khc
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SMY1
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
unc-116
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ZC262.7
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
kif5c
Alliance
DIOPT (InParanoid|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
kif5a
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 64,937,210 - 64,974,339 (-) NCBI GRCr8 mRatBN7.2 7 63,051,894 - 63,089,024 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 63,049,424 - 63,092,858 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 64,941,174 - 64,978,298 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 67,143,590 - 67,180,714 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 66,944,692 - 66,982,059 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 70,515,832 - 70,552,897 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 70,513,343 - 70,556,827 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 70,693,375 - 70,727,047 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 67,183,575 - 67,220,766 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 67,204,304 - 67,241,496 (-) NCBI Celera 7 60,193,348 - 60,229,555 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kif5a Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO Kif5a (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kif5a Rat 1,2-dimethylhydrazine increases expression ISO Kif5a (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of KIF5A mRNA CTD PMID:22206623 Kif5a Rat 1,2-dimethylhydrazine multiple interactions ISO Kif5a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of KIF5A mRNA CTD PMID:22206623 Kif5a Rat 1,4-dithiothreitol multiple interactions ISO KIF5A (Homo sapiens) 6480464 Dithiothreitol inhibits the reaction [cupric chloride results in decreased activity of KIF5A protein] CTD PMID:24853401 Kif5a Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Kif5a (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:15329391 Kif5a Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Kif5a (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kif5a Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Kif5a (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kif5a Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO KIF5A (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Kif5a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO KIF5A (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of KIF5A mRNA CTD PMID:27913140 Kif5a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KIF5A mRNA CTD PMID:33387578 Kif5a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KIF5A mRNA CTD PMID:32109520 Kif5a Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO Kif5a (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kif5a Rat 3,4-methylenedioxymethamphetamine increases expression ISO Kif5a (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of KIF5A mRNA CTD PMID:20188158 Kif5a Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of KIF5A mRNA CTD PMID:36041667 Kif5a Rat 4,4'-sulfonyldiphenol affects methylation ISO Kif5a (Mus musculus) 6480464 bisphenol S affects the methylation of KIF5A gene CTD PMID:31683443 Kif5a Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of KIF5A mRNA CTD PMID:31881176 Kif5a Rat arsane multiple interactions ISO KIF5A (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of KIF5A mRNA CTD PMID:39836092 Kif5a Rat arsenic atom multiple interactions ISO KIF5A (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of KIF5A mRNA CTD PMID:39836092 Kif5a Rat ATP multiple interactions ISO KIF5A (Homo sapiens) 6480464 Adenosine Triphosphate inhibits the reaction [zinc chloride results in decreased activity of KIF5A protein] more ... CTD PMID:24239783 and PMID:28122263 Kif5a Rat ATP increases hydrolysis ISO KIF5A (Homo sapiens) 6480464 KIF5A protein results in increased hydrolysis of Adenosine Triphosphate CTD PMID:24239783 Kif5a Rat atrazine increases expression ISO KIF5A (Homo sapiens) 6480464 Atrazine results in increased expression of KIF5A mRNA CTD PMID:22378314 Kif5a Rat benzo[a]pyrene increases expression ISO KIF5A (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of KIF5A mRNA CTD PMID:21871943 Kif5a Rat benzo[a]pyrene increases methylation ISO KIF5A (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KIF5A exon CTD PMID:27901495 Kif5a Rat benzo[a]pyrene affects methylation ISO KIF5A (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of KIF5A promoter CTD PMID:27901495 Kif5a Rat beta-lapachone decreases expression ISO KIF5A (Homo sapiens) 6480464 beta-lapachone results in decreased expression of KIF5A mRNA CTD PMID:38218311 Kif5a Rat bis(2-ethylhexyl) phthalate decreases expression ISO KIF5A (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of KIF5A mRNA CTD PMID:31163220 Kif5a Rat bis(2-ethylhexyl) phthalate increases expression ISO Kif5a (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of KIF5A mRNA CTD PMID:34319233 Kif5a Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KIF5A protein and [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of KIF5A mRNA CTD PMID:37690569 Kif5a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KIF5A mRNA CTD PMID:25181051 more ... Kif5a Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of KIF5A mRNA CTD PMID:36041667 Kif5a Rat bisphenol A decreases expression ISO Kif5a (Mus musculus) 6480464 bisphenol A results in decreased expression of KIF5A mRNA CTD PMID:32156529 Kif5a Rat bisphenol A decreases methylation ISO KIF5A (Homo sapiens) 6480464 bisphenol A results in decreased methylation of KIF5A gene CTD PMID:31601247 Kif5a Rat bisphenol F decreases expression ISO Kif5a (Mus musculus) 6480464 bisphenol F results in decreased expression of KIF5A mRNA CTD PMID:38685157 Kif5a Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of KIF5A mRNA CTD PMID:36041667 Kif5a Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KIF5A protein and [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of KIF5A mRNA CTD PMID:37690569 Kif5a Rat cadmium dichloride decreases activity ISO KIF5A (Homo sapiens) 6480464 Cadmium Chloride results in decreased activity of KIF5A protein CTD PMID:24239783 Kif5a Rat cadmium dichloride multiple interactions ISO KIF5A (Homo sapiens) 6480464 Cadmium Chloride inhibits the reaction [KIF5A protein results in increased hydrolysis of Adenosine Triphosphate] more ... CTD PMID:24239783 Kif5a Rat carmustine decreases expression ISO KIF5A (Homo sapiens) 6480464 Carmustine results in decreased expression of KIF5A mRNA CTD PMID:15980968 Kif5a Rat CGP 52608 multiple interactions ISO KIF5A (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KIF5A gene] CTD PMID:28238834 Kif5a Rat chlorpyrifos increases expression ISO Kif5a (Mus musculus) 6480464 Chlorpyrifos results in increased expression of KIF5A mRNA CTD PMID:37019170 Kif5a Rat choline multiple interactions ISO Kif5a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of KIF5A mRNA CTD PMID:20938992 Kif5a Rat clobetasol decreases expression ISO Kif5a (Mus musculus) 6480464 Clobetasol results in decreased expression of KIF5A mRNA CTD PMID:27462272 Kif5a Rat copper(II) chloride decreases activity ISO KIF5A (Homo sapiens) 6480464 cupric chloride results in decreased activity of KIF5A protein CTD PMID:24853401 Kif5a Rat copper(II) chloride multiple interactions ISO KIF5A (Homo sapiens) 6480464 Cysteine inhibits the reaction [cupric chloride results in decreased activity of KIF5A protein] more ... CTD PMID:24853401 Kif5a Rat dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KIF5A protein and [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of KIF5A mRNA CTD PMID:37690569 Kif5a Rat dicrotophos increases expression ISO KIF5A (Homo sapiens) 6480464 dicrotophos results in increased expression of KIF5A mRNA CTD PMID:28302478 Kif5a Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KIF5A protein and [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of KIF5A mRNA CTD PMID:37690569 Kif5a Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KIF5A protein and [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of KIF5A mRNA CTD PMID:37690569 Kif5a Rat diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KIF5A protein and [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of KIF5A mRNA CTD PMID:37690569 Kif5a Rat diquat increases expression ISO Kif5a (Mus musculus) 6480464 Diquat results in increased expression of KIF5A mRNA CTD PMID:36851058 Kif5a Rat dorsomorphin multiple interactions ISO KIF5A (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KIF5A mRNA CTD PMID:27188386 Kif5a Rat doxorubicin decreases expression ISO KIF5A (Homo sapiens) 6480464 Doxorubicin results in decreased expression of KIF5A mRNA CTD PMID:29803840 Kif5a Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of KIF5A mRNA CTD PMID:29391264 Kif5a Rat ethanol multiple interactions ISO Kif5a (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of KIF5A mRNA CTD PMID:30319688 Kif5a Rat ethanol increases expression ISO Kif5a (Mus musculus) 6480464 Ethanol results in increased expression of KIF5A mRNA CTD PMID:30319688 Kif5a Rat ethylene glycol bis(2-aminoethyl)tetraacetic acid multiple interactions ISO KIF5A (Homo sapiens) 6480464 Egtazic Acid inhibits the reaction [Cadmium Chloride inhibits the reaction [KIF5A protein results in increased hydrolysis of Adenosine Triphosphate]] more ... CTD PMID:24239783 and PMID:24853401 Kif5a Rat fenamidone decreases expression ISO Kif5a (Mus musculus) 6480464 fenamidone results in decreased expression of KIF5A mRNA CTD PMID:27029645 Kif5a Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of KIF5A mRNA CTD PMID:30307764 Kif5a Rat folic acid multiple interactions ISO Kif5a (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Kif5a Rat folic acid increases expression ISO Kif5a (Mus musculus) 6480464 Folic Acid results in increased expression of KIF5A mRNA CTD PMID:25629700 Kif5a Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of KIF5A mRNA CTD PMID:22061828 and PMID:33387578 Kif5a Rat GW 4064 increases expression ISO Kif5a (Mus musculus) 6480464 GW 4064 results in increased expression of KIF5A mRNA CTD PMID:26655953 Kif5a Rat L-1,4-dithiothreitol multiple interactions ISO KIF5A (Homo sapiens) 6480464 Dithiothreitol inhibits the reaction [cupric chloride results in decreased activity of KIF5A protein] CTD PMID:24853401 Kif5a Rat L-cysteine multiple interactions ISO KIF5A (Homo sapiens) 6480464 Cysteine inhibits the reaction [cupric chloride results in decreased activity of KIF5A protein] CTD PMID:24853401 Kif5a Rat L-methionine multiple interactions ISO Kif5a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of KIF5A mRNA CTD PMID:20938992 Kif5a Rat lead diacetate increases expression ISO Kif5a (Mus musculus) 6480464 lead acetate results in increased expression of KIF5A mRNA CTD PMID:22609695 Kif5a Rat lead diacetate multiple interactions ISO Kif5a (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of KIF5A mRNA and [lead acetate results in increased abundance of Lead] which results in increased methylation of KIF5A intron CTD PMID:32458983 and PMID:33445541 Kif5a Rat lead(0) multiple interactions ISO Kif5a (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of KIF5A mRNA and [lead acetate results in increased abundance of Lead] which results in increased methylation of KIF5A intron CTD PMID:32458983 and PMID:33445541 Kif5a Rat Licochalcone B increases expression ISO KIF5A (Homo sapiens) 6480464 licochalcone B results in increased expression of KIF5A mRNA CTD PMID:33647349 Kif5a Rat lipopolysaccharide multiple interactions ISO KIF5A (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Kif5a Rat lithium chloride decreases expression ISO KIF5A (Homo sapiens) 6480464 Lithium Chloride results in decreased expression of KIF5A mRNA CTD PMID:23527032 Kif5a Rat magnesium dichloride multiple interactions ISO KIF5A (Homo sapiens) 6480464 Magnesium Chloride affects the reaction [zinc chloride results in decreased activity of KIF5A protein] CTD PMID:28122263 Kif5a Rat manganese atom multiple interactions ISO KIF5A (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of KIF5A mRNA CTD PMID:39836092 Kif5a Rat manganese(0) multiple interactions ISO KIF5A (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of KIF5A mRNA CTD PMID:39836092 Kif5a Rat manganese(II) chloride multiple interactions ISO KIF5A (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of KIF5A mRNA CTD PMID:39836092 Kif5a Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of KIF5A gene CTD PMID:23303685 Kif5a Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of KIF5A gene CTD PMID:35440735 Kif5a Rat methylmercury chloride decreases expression ISO KIF5A (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of KIF5A mRNA CTD PMID:28001369 Kif5a Rat N-nitrosodiethylamine increases expression ISO Kif5a (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of KIF5A mRNA CTD PMID:17854601 Kif5a Rat N-nitrosodiethylamine multiple interactions ISO Kif5a (Mus musculus) 6480464 RB1 protein inhibits the reaction [Diethylnitrosamine results in increased expression of KIF5A mRNA] CTD PMID:17854601 Kif5a Rat okadaic acid increases expression ISO KIF5A (Homo sapiens) 6480464 Okadaic Acid results in increased expression of KIF5A mRNA CTD PMID:38832940 Kif5a Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of KIF5A mRNA CTD PMID:33387578 Kif5a Rat PCB138 multiple interactions ISO Kif5a (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kif5a Rat phenylmercury acetate decreases expression ISO KIF5A (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of KIF5A mRNA CTD PMID:26272509 Kif5a Rat phenylmercury acetate multiple interactions ISO KIF5A (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KIF5A mRNA CTD PMID:27188386 Kif5a Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of KIF5A mRNA CTD PMID:23263842 Kif5a Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO KIF5A (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Kif5a Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO KIF5A (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of KIF5A mRNA CTD PMID:35811015 Kif5a Rat SB 431542 multiple interactions ISO KIF5A (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KIF5A mRNA CTD PMID:27188386 Kif5a Rat sodium arsenate increases expression ISO Kif5a (Mus musculus) 6480464 sodium arsenate results in increased expression of KIF5A mRNA CTD PMID:21795629 Kif5a Rat sodium arsenite increases expression ISO KIF5A (Homo sapiens) 6480464 sodium arsenite results in increased expression of KIF5A mRNA CTD PMID:38568856 Kif5a Rat sodium arsenite multiple interactions ISO KIF5A (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of KIF5A mRNA and sodium arsenite promotes the reaction [KIF5A protein binds to CAPRIN1 protein] CTD PMID:33939924 and PMID:39836092 Kif5a Rat tebuconazole decreases expression ISO KIF5A (Homo sapiens) 6480464 tebuconazole results in decreased expression of KIF5A mRNA CTD PMID:30458266 Kif5a Rat titanium dioxide decreases methylation ISO Kif5a (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KIF5A gene CTD PMID:35295148 Kif5a Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of KIF5A mRNA CTD PMID:33387578 Kif5a Rat trimellitic anhydride decreases expression ISO Kif5a (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of KIF5A mRNA CTD PMID:19042947 Kif5a Rat urethane increases expression ISO KIF5A (Homo sapiens) 6480464 Urethane results in increased expression of KIF5A mRNA CTD PMID:28818685 Kif5a Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of KIF5A mRNA CTD PMID:29427782 Kif5a Rat venlafaxine hydrochloride decreases expression EXP 6480464 Venlafaxine Hydrochloride results in decreased expression of KIF5A mRNA CTD PMID:25423262 Kif5a Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of KIF5A mRNA CTD PMID:19015723 Kif5a Rat zalcitabine multiple interactions EXP 6480464 [gp120 protein and Human immunodeficiency virus 1 co-treated with Zalcitabine] results in decreased expression of KIF5A mRNA CTD PMID:18606552 Kif5a Rat zinc dichloride multiple interactions ISO KIF5A (Homo sapiens) 6480464 Adenosine Triphosphate inhibits the reaction [zinc chloride results in decreased activity of KIF5A protein] and Magnesium Chloride affects the reaction [zinc chloride results in decreased activity of KIF5A protein] CTD PMID:28122263 Kif5a Rat zinc dichloride decreases activity ISO KIF5A (Homo sapiens) 6480464 zinc chloride results in decreased activity of KIF5A protein CTD PMID:28122263
1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dimethylhydrazine (ISO) 1,4-dithiothreitol (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) acetamide (EXP) arsane (ISO) arsenic atom (ISO) ATP (ISO) atrazine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) Butylbenzyl phthalate (EXP) cadmium dichloride (ISO) carmustine (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) clobetasol (ISO) copper(II) chloride (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diethyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) diquat (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) ethylene glycol bis(2-aminoethyl)tetraacetic acid (ISO) fenamidone (ISO) fenvalerate (EXP) folic acid (ISO) gentamycin (EXP) GW 4064 (ISO) L-1,4-dithiothreitol (ISO) L-cysteine (ISO) L-methionine (ISO) lead diacetate (ISO) lead(0) (ISO) Licochalcone B (ISO) lipopolysaccharide (ISO) lithium chloride (ISO) magnesium dichloride (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methoxychlor (EXP) methylmercury chloride (ISO) N-nitrosodiethylamine (ISO) okadaic acid (ISO) paracetamol (EXP) PCB138 (ISO) phenylmercury acetate (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (ISO) tebuconazole (ISO) titanium dioxide (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) urethane (ISO) valproic acid (EXP) venlafaxine hydrochloride (EXP) vinclozolin (EXP) zalcitabine (EXP) zinc dichloride (ISO)
Cellular Component
apical dendrite (IDA) axon (IDA) axon cytoplasm (IEA) central region of growth cone (IDA) ciliary rootlet (IEA,ISO) cytoplasm (IBA,IEA,ISO) cytoskeleton (IEA) dendrite (IDA) dendrite cytoplasm (IEA) kinesin complex (IBA,IDA,TAS) microtubule (IBA,IDA,IEA) neuron projection (IEA,ISO) neuronal cell body (IEA,ISO) P-body (IDA) perikaryon (IDA,IEA) perinuclear region of cytoplasm (IEA) postsynaptic cytosol (IEA,ISO)
1.
The autoimmune disease-associated KIF5A, CD226 and SH2B3 gene variants confer susceptibility for multiple sclerosis.
Alcina A, etal., Genes Immun. 2010 Jul;11(5):439-45. doi: 10.1038/gene.2010.30. Epub 2010 May 27.
2.
Diabetes alters KIF1A and KIF5B motor proteins in the hippocampus.
Baptista FI, etal., PLoS One. 2013 Jun 12;8(6):e65515. doi: 10.1371/journal.pone.0065515. Print 2013.
3.
Hereditary spastic paraplegia: a novel mutation and expansion of the phenotype variability in SPG10.
Carosi L, etal., J Neurol Neurosurg Psychiatry. 2015 Jun;86(6):702-4. doi: 10.1136/jnnp-2014-308625. Epub 2014 Oct 28.
4.
Association of variants in MMEL1 and CTLA4 with rheumatoid arthritis in the Han Chinese population.
Danoy P, etal., Ann Rheum Dis. 2011 Oct;70(10):1793-7. doi: 10.1136/ard.2010.144576. Epub 2011 Jul 21.
5.
Evidence of kinesin heavy chain (KIF5A) involvement in pure hereditary spastic paraplegia.
Fichera M, etal., Neurology. 2004 Sep 28;63(6):1108-10.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
MAP2 Defines a Pre-axonal Filtering Zone to Regulate KIF1- versus KIF5-Dependent Cargo Transport in Sensory Neurons.
Gumy LF, etal., Neuron. 2017 Apr 19;94(2):347-362.e7. doi: 10.1016/j.neuron.2017.03.046.
9.
Replication of European rheumatoid arthritis loci in a Pakistani population.
Jalil SF, etal., J Rheumatol. 2013 Apr;40(4):401-7. doi: 10.3899/jrheum.121050. Epub 2013 Feb 1.
10.
Axonal transport deficit in a KIF5A( -/- ) mouse model.
Karle KN, etal., Neurogenetics. 2012 May;13(2):169-79. doi: 10.1007/s10048-012-0324-y. Epub 2012 Apr 1.
11.
Kinesin expression in the central nervous system of humans and transgenic hSOD1G93A mice with amyotrophic lateral sclerosis.
Kuzma-Kozakiewicz M, etal., Neurodegener Dis. 2013;12(2):71-80. doi: 10.1159/000339529. Epub 2012 Sep 21.
12.
Regulation of mitochondrial transport in neurons.
Lin MY and Sheng ZH, Exp Cell Res. 2015 May 15;334(1):35-44. doi: 10.1016/j.yexcr.2015.01.004. Epub 2015 Jan 19.
13.
The mitochondrial and autosomal mutation landscapes of prostate cancer.
Lindberg J, etal., Eur Urol. 2013 Apr;63(4):702-8. doi: 10.1016/j.eururo.2012.11.053. Epub 2012 Dec 5.
14.
Hereditary spastic paraplegia in Greece: characterisation of a previously unexplored population using next-generation sequencing.
Lynch DS, etal., Eur J Hum Genet. 2016 Jun;24(6):857-63. doi: 10.1038/ejhg.2015.200. Epub 2015 Sep 16.
15.
Huntingtin mediates dendritic transport of beta-actin mRNA in rat neurons.
Ma B, etal., Sci Rep. 2011;1:140. Epub 2011 Nov 3.
16.
Beta-dystrobrevin interacts directly with kinesin heavy chain in brain.
Macioce P, etal., J Cell Sci 2003 Dec 1;116(Pt 23):4847-56.
17.
Rotenone-dependent changes of anterograde motor protein expression and mitochondrial mobility in brain areas related to neurodegenerative diseases.
Melo TQ, etal., Cell Mol Neurobiol. 2013 Apr;33(3):327-35. doi: 10.1007/s10571-012-9898-z. Epub 2012 Dec 22.
18.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
19.
A novel KIF5A mutation in an Italian family marked by spastic paraparesis and congenital deafness.
Muglia M, etal., J Neurol Sci. 2014 Aug 15;343(1-2):218-20. doi: 10.1016/j.jns.2014.05.063. Epub 2014 Jun 5.
20.
Molecular motor KIF5A is essential for GABA(A) receptor transport, and KIF5A deletion causes epilepsy.
Nakajima K, etal., Neuron. 2012 Dec 6;76(5):945-61. doi: 10.1016/j.neuron.2012.10.012.
21.
Activity-dependent synaptic localization of processing bodies and their role in dendritic structural plasticity.
Oh JY, etal., J Cell Sci. 2013 May 1;126(Pt 9):2114-23. doi: 10.1242/jcs.125690. Epub 2013 Mar 13.
22.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
23.
A kinesin heavy chain (KIF5A) mutation in hereditary spastic paraplegia (SPG10).
Reid E, etal., Am J Hum Genet. 2002 Nov;71(5):1189-94. Epub 2002 Sep 24.
24.
GOA pipeline
RGD automated data pipeline
25.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
26.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
27.
Chronic alcohol exposure affects the cell components involved in membrane traffic in neuronal dendrites.
Romero AM, etal., Neurotox Res. 2015 Jan;27(1):43-54. doi: 10.1007/s12640-014-9484-x. Epub 2014 Jul 15.
28.
SPG10 is a rare cause of spastic paraplegia in European families.
Schüle R, etal., J Neurol Neurosurg Psychiatry. 2008 May;79(5):584-7. doi: 10.1136/jnnp.2007.137596. Epub 2008 Feb 1.
29.
DISC1 regulates neurotrophin-induced axon elongation via interaction with Grb2.
Shinoda T, etal., J Neurosci. 2007 Jan 3;27(1):4-14.
30.
c-Jun NH2-terminal kinase (JNK)-interacting protein-3 (JIP3) regulates neuronal axon elongation in a kinesin- and JNK-dependent manner.
Sun T, etal., J Biol Chem. 2013 May 17;288(20):14531-43. doi: 10.1074/jbc.M113.464453. Epub 2013 Apr 10.
31.
DISC1 regulates the transport of the NUDEL/LIS1/14-3-3epsilon complex through kinesin-1.
Taya S, etal., J Neurosci. 2007 Jan 3;27(1):15-26.
32.
Proteomic detection of cancer in asbestosis patients using SELDI-TOF discovered serum protein biomarkers.
Tooker BC, etal., Biomarkers. 2011 Mar;16(2):181-91. doi: 10.3109/1354750X.2010.543289. Epub 2011 Jan 14.
33.
Differential expression of ubiquitous and neuronal kinesin heavy chains during differentiation of human neuroblastoma and PC12 cells.
Vignali G, etal., Eur J Neurosci. 1996 Mar;8(3):536-44.
34.
Expression of neuronal kinesin heavy chain is developmentally regulated in the central nervous system of the rat.
Vignali G, etal., J Neurochem. 1997 Nov;69(5):1840-9.
Kif5a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 64,937,210 - 64,974,339 (-) NCBI GRCr8 mRatBN7.2 7 63,051,894 - 63,089,024 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 63,049,424 - 63,092,858 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 64,941,174 - 64,978,298 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 67,143,590 - 67,180,714 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 66,944,692 - 66,982,059 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 70,515,832 - 70,552,897 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 70,513,343 - 70,556,827 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 70,693,375 - 70,727,047 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 67,183,575 - 67,220,766 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 67,204,304 - 67,241,496 (-) NCBI Celera 7 60,193,348 - 60,229,555 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
KIF5A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 57,550,044 - 57,586,633 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 57,546,026 - 57,586,633 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 57,943,827 - 57,980,416 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 56,230,114 - 56,264,821 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 56,230,113 - 56,264,821 NCBI Celera 12 57,599,677 - 57,634,382 (+) NCBI Celera Cytogenetic Map 12 q13.3 NCBI HuRef 12 54,981,745 - 55,016,257 (+) NCBI HuRef CHM1_1 12 57,911,685 - 57,946,386 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 57,518,283 - 57,554,872 (+) NCBI T2T-CHM13v2.0
Kif5a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 127,061,564 - 127,102,217 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 127,061,565 - 127,099,217 (-) Ensembl GRCm39 Ensembl GRCm38 10 127,225,695 - 127,266,348 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 127,225,696 - 127,263,348 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 126,662,751 - 126,700,419 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 126,628,648 - 126,666,029 (-) NCBI MGSCv36 mm8 Celera 10 129,618,645 - 129,655,868 (-) NCBI Celera Cytogenetic Map 10 D3 NCBI cM Map 10 74.5 NCBI
Kif5a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 5,287,111 - 5,310,962 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 5,264,274 - 5,310,962 (+) NCBI ChiLan1.0 ChiLan1.0
KIF5A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 36,754,420 - 36,791,175 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 36,751,196 - 36,787,946 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 31,340,201 - 31,376,849 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 31,599,376 - 31,635,677 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 31,599,376 - 31,635,327 (-) Ensembl panpan1.1 panPan2
KIF5A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 1,637,007 - 1,666,790 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 1,636,932 - 1,664,767 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 1,700,232 - 1,729,959 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 1,646,391 - 1,676,129 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 1,646,235 - 1,676,121 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 1,624,071 - 1,653,916 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 1,865,983 - 1,895,693 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 1,990,984 - 2,020,928 (+) NCBI UU_Cfam_GSD_1.0
Kif5a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 57,137,419 - 57,172,692 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936646 1,697,492 - 1,732,832 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936646 1,697,531 - 1,730,376 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KIF5A
KIF5A
Kif5a
.
Predicted Target Of
Count of predictions: 595 Count of miRNA genes: 263 Interacting mature miRNAs: 334 Transcripts: ENSRNOT00000007721 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 10059605 Kidm47 Kidney mass QTL 47 2.91 0.05 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 47251783 65728867 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1559283 Emca4 Estrogen-induced mammary cancer QTL 4 3.7 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 7 62004452 101773158 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1576303 Ept7 Estrogen-induced pituitary tumorigenesis QTL 7 3.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 7 62004452 101773158 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat
BF388221
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 63,050,720 - 63,050,898 (+) MAPPER mRatBN7.2 Rnor_6.0 7 70,514,659 - 70,514,836 NCBI Rnor6.0 Rnor_5.0 7 70,692,202 - 70,692,379 UniSTS Rnor5.0 RGSC_v3.4 7 67,182,402 - 67,182,579 UniSTS RGSC3.4 Celera 7 60,192,175 - 60,192,352 UniSTS Cytogenetic Map 7 q22 UniSTS
Kif5a
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 63,056,621 - 63,058,321 (+) MAPPER mRatBN7.2 Rnor_6.0 7 70,520,496 - 70,522,195 NCBI Rnor6.0 Rnor_5.0 7 70,694,646 - 70,696,345 UniSTS Rnor5.0 RGSC_v3.4 7 67,188,357 - 67,190,056 UniSTS RGSC3.4 Celera 7 60,196,964 - 60,198,663 UniSTS Cytogenetic Map 7 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007721 ⟹ ENSRNOP00000007721
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 63,049,424 - 63,092,858 (-) Ensembl Rnor_6.0 Ensembl 7 70,513,343 - 70,556,827 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000080594 ⟹ ENSRNOP00000071539
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 63,049,424 - 63,089,064 (-) Ensembl Rnor_6.0 Ensembl 7 70,515,832 - 70,552,897 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112903 ⟹ ENSRNOP00000095825
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 63,049,424 - 63,089,064 (-) Ensembl
RefSeq Acc Id:
NM_212523 ⟹ NP_997688
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 64,937,210 - 64,974,339 (-) NCBI mRatBN7.2 7 63,051,894 - 63,089,024 (-) NCBI Rnor_6.0 7 70,515,832 - 70,552,897 (-) NCBI Rnor_5.0 7 70,693,375 - 70,727,047 (-) NCBI RGSC_v3.4 7 67,183,575 - 67,220,766 (-) RGD Celera 7 60,193,348 - 60,229,555 (-) RGD
Sequence:
CAAAAGCCCAGGTCGCCCGCATCCAGTGCCGCAGGACACCAAAAGCGCACCTTCGCCTGGGCATCCCAGCTGCTCCCTTGGCCTCAGCGACAGATCACCTGTCCTCCGCCTCAACCCCAACCCAGCGC
hide sequence
RefSeq Acc Id:
NP_997688 ⟸ NM_212523
- UniProtKB:
Q6QLM7 (UniProtKB/Swiss-Prot), A0A0G2K0Q2 (UniProtKB/TrEMBL)
- Sequence:
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVIIGGKPYVFDRVFPPNTTQEQVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHIYSMDENLE
hide sequence
Ensembl Acc Id:
ENSRNOP00000071539 ⟸ ENSRNOT00000080594
Ensembl Acc Id:
ENSRNOP00000007721 ⟸ ENSRNOT00000007721
Ensembl Acc Id:
ENSRNOP00000095825 ⟸ ENSRNOT00000112903
RGD ID: 13695254 Promoter ID: EPDNEW_R5779 Type: initiation region Name: Kif5a_1 Description: kinesin family member 5A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 70,552,915 - 70,552,975 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Kif5a
kinesin family member 5A
Symbol and Name status set to approved
1299863 APPROVED
2005-02-14
Kif5a
kinesin family member 5A
Symbol and Name status set to provisional
70820 PROVISIONAL
