Symbol:
Pold1
Name:
DNA polymerase delta 1, catalytic subunit
RGD ID:
621839
Description:
Enables DNA-directed DNA polymerase activity. Involved in DNA biosynthetic process and DNA-templated DNA replication. Part of delta DNA polymerase complex. Orthologous to human POLD1 (DNA polymerase delta 1, catalytic subunit); PARTICIPATES IN mismatch repair pathway; nucleotide excision repair pathway; base excision repair pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
3'-5' exodeoxyribonuclease; DAN polymerase delta 1, catalytic subunit; DNA polymerase delta catalytic subunit; DNA polymerase delta, catalytic subunit; DNA-directed DNA polymerase delta 1; polymerase (DNA directed), delta 1, catalytic subunit; polymerase (DNA) delta 1, catalytic subunit
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
POLD1 (DNA polymerase delta 1, catalytic subunit) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Pold1 (polymerase (DNA directed), delta 1, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pold1 (DNA polymerase delta 1, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
POLD1 (DNA polymerase delta 1, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
POLD1 (DNA polymerase delta 1, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pold1 (DNA polymerase delta 1, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
POLD1 (DNA polymerase delta 1, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pold1 (DNA polymerase delta 1, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
YWHAE (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
POLD1 (DNA polymerase delta 1, catalytic subunit)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pold1 (polymerase (DNA directed), delta 1, catalytic subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pold1 (polymerase (DNA directed), delta 1, catalytic subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F10C2.4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
DNApol-delta
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
POL3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pold1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 104,161,984 - 104,178,074 (-) NCBI GRCr8 mRatBN7.2 1 95,025,462 - 95,041,559 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 95,025,499 - 95,036,465 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 100,410,903 - 100,421,871 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 108,883,547 - 108,894,515 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 102,173,968 - 102,184,936 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 100,538,066 - 100,554,105 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 100,537,900 - 100,554,488 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 101,603,453 - 101,619,471 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 95,010,719 - 95,021,686 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 95,088,829 - 95,099,797 (-) NCBI Celera 1 89,287,965 - 89,298,931 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pold1 Rat 1,2-dichloroethane increases expression ISO Pold1 (Mus musculus) 6480464 ethylene dichloride results in increased expression of POLD1 mRNA CTD PMID:28960355 Pold1 Rat 1,2-dimethylhydrazine increases expression ISO Pold1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of POLD1 mRNA CTD PMID:22206623 Pold1 Rat 17alpha-ethynylestradiol affects expression ISO Pold1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of POLD1 mRNA CTD PMID:17555576 Pold1 Rat 17alpha-ethynylestradiol multiple interactions ISO Pold1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of POLD1 mRNA CTD PMID:17942748 Pold1 Rat 17alpha-ethynylestradiol increases expression ISO Pold1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of POLD1 mRNA CTD PMID:17942748 Pold1 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of POLD1 mRNA CTD PMID:32145629 Pold1 Rat 17beta-estradiol decreases expression ISO Pold1 (Mus musculus) 6480464 Estradiol results in decreased expression of POLD1 mRNA CTD PMID:39298647 Pold1 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO POLD1 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Pold1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pold1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of POLD1 mRNA CTD PMID:17942748 Pold1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of POLD1 mRNA CTD PMID:33387578 Pold1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO POLD1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of POLD1 mRNA CTD PMID:22574217 Pold1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pold1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of POLD1 mRNA CTD PMID:21570461 Pold1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Pold1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO POLD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of POLD1 mRNA CTD PMID:28628672 Pold1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO POLD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of POLD1 mRNA CTD PMID:28628672 Pold1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Pold1 (Mus musculus) 6480464 bisphenol S results in decreased expression of POLD1 mRNA CTD PMID:39298647 Pold1 Rat 4-hydroperoxycyclophosphamide decreases expression ISO Pold1 (Mus musculus) 6480464 perfosfamide results in decreased expression of POLD1 mRNA CTD PMID:19429390 Pold1 Rat 4-hydroxynon-2-enal decreases expression ISO POLD1 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of POLD1 mRNA CTD PMID:12419474 Pold1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of POLD1 mRNA CTD PMID:30047161 Pold1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of POLD1 mRNA CTD PMID:31881176 Pold1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of POLD1 mRNA CTD PMID:28959563 Pold1 Rat Aflatoxin B2 alpha decreases methylation ISO POLD1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of POLD1 intron CTD PMID:30157460 Pold1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of POLD1 mRNA CTD PMID:30047161 Pold1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of POLD1 mRNA CTD PMID:16483693 Pold1 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of POLD1 mRNA CTD PMID:30779732 Pold1 Rat arsane affects methylation ISO POLD1 (Homo sapiens) 6480464 Arsenic affects the methylation of POLD1 gene CTD PMID:25304211 Pold1 Rat arsenic atom affects methylation ISO POLD1 (Homo sapiens) 6480464 Arsenic affects the methylation of POLD1 gene CTD PMID:25304211 Pold1 Rat arsenous acid increases expression ISO POLD1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of POLD1 mRNA CTD PMID:29633893 Pold1 Rat arsenous acid multiple interactions ISO POLD1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to POLD1 protein] CTD PMID:26598702 Pold1 Rat benzo[a]pyrene increases expression ISO Pold1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of POLD1 mRNA CTD PMID:22228805 Pold1 Rat benzo[e]pyrene decreases methylation ISO POLD1 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of POLD1 intron CTD PMID:30157460 Pold1 Rat Benzo[ghi]perylene increases expression ISO POLD1 (Homo sapiens) 6480464 1 and 12-benzoperylene results in increased expression of POLD1 mRNA CTD PMID:31518672 Pold1 Rat bis(2-chloroethyl) sulfide decreases expression ISO POLD1 (Homo sapiens) 6480464 Mustard Gas results in decreased expression of POLD1 mRNA CTD PMID:25102026 Pold1 Rat bis(2-ethylhexyl) phthalate increases expression ISO POLD1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of POLD1 mRNA CTD PMID:33120273 Pold1 Rat bisphenol A increases expression ISO Pold1 (Mus musculus) 6480464 bisphenol A results in increased expression of POLD1 mRNA CTD PMID:26063408 Pold1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of POLD1 mRNA CTD PMID:34947998 Pold1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of POLD1 mRNA CTD PMID:32145629 Pold1 Rat bisphenol A decreases expression ISO POLD1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of POLD1 mRNA and bisphenol A results in decreased expression of POLD1 protein CTD PMID:29275510 and PMID:37567409 Pold1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of POLD1 gene CTD PMID:28505145 Pold1 Rat bisphenol F decreases expression ISO Pold1 (Mus musculus) 6480464 bisphenol F results in decreased expression of POLD1 mRNA CTD PMID:38685157 Pold1 Rat calcitriol decreases expression ISO POLD1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of POLD1 mRNA CTD PMID:21592394 Pold1 Rat calcitriol multiple interactions ISO POLD1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of POLD1 mRNA CTD PMID:21592394 Pold1 Rat cannabidiol decreases expression ISO POLD1 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of POLD1 mRNA CTD PMID:36519830 Pold1 Rat carbon nanotube increases expression ISO Pold1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of POLD1 mRNA CTD PMID:25554681 Pold1 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of POLD1 mRNA CTD PMID:18500788 Pold1 Rat chlorpyrifos decreases expression ISO Pold1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of POLD1 mRNA CTD PMID:37019170 Pold1 Rat chromium(6+) multiple interactions ISO POLD1 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of POLD1 mRNA CTD PMID:38479592 Pold1 Rat copper atom multiple interactions ISO POLD1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of POLD1 mRNA CTD PMID:20971185 Pold1 Rat copper atom increases expression ISO POLD1 (Homo sapiens) 6480464 Copper results in increased expression of POLD1 mRNA CTD PMID:16391388 Pold1 Rat copper(0) multiple interactions ISO POLD1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of POLD1 mRNA CTD PMID:20971185 Pold1 Rat copper(0) increases expression ISO POLD1 (Homo sapiens) 6480464 Copper results in increased expression of POLD1 mRNA CTD PMID:16391388 Pold1 Rat coumarin increases expression EXP 6480464 coumarin results in increased expression of POLD1 mRNA CTD PMID:18480146 Pold1 Rat coumestrol multiple interactions ISO POLD1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Pold1 Rat coumestrol increases expression ISO POLD1 (Homo sapiens) 6480464 Coumestrol results in increased expression of POLD1 mRNA CTD PMID:19167446 Pold1 Rat cyclosporin A decreases expression ISO POLD1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of POLD1 mRNA CTD PMID:25562108 Pold1 Rat DDE increases expression ISO POLD1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of POLD1 mRNA CTD PMID:38568856 Pold1 Rat dexamethasone multiple interactions ISO POLD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of POLD1 mRNA CTD PMID:28628672 Pold1 Rat Diallyl sulfide multiple interactions EXP 6480464 [allyl sulfide co-treated with Diethylstilbestrol] results in increased expression of POLD1 mRNA CTD PMID:17125941 Pold1 Rat Diallyl sulfide increases expression EXP 6480464 allyl sulfide results in increased expression of POLD1 mRNA CTD PMID:17125941 Pold1 Rat diarsenic trioxide multiple interactions ISO POLD1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to POLD1 protein] CTD PMID:26598702 Pold1 Rat diarsenic trioxide increases expression ISO POLD1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of POLD1 mRNA CTD PMID:29633893 Pold1 Rat Dibutyl phosphate affects expression ISO POLD1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of POLD1 mRNA CTD PMID:37042841 Pold1 Rat dibutyl phthalate decreases expression ISO Pold1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of POLD1 mRNA CTD PMID:21266533 Pold1 Rat dibutyl phthalate increases expression ISO POLD1 (Homo sapiens) 6480464 Dibutyl Phthalate results in increased expression of POLD1 mRNA CTD PMID:33120273 Pold1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of POLD1 mRNA CTD PMID:21266533 Pold1 Rat diethylstilbestrol multiple interactions EXP 6480464 [allyl sulfide co-treated with Diethylstilbestrol] results in increased expression of POLD1 mRNA CTD PMID:17125941 Pold1 Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of POLD1 mRNA CTD PMID:17720352 Pold1 Rat dioxygen decreases expression ISO POLD1 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of POLD1 mRNA CTD PMID:26516004 Pold1 Rat doxorubicin decreases expression ISO POLD1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of POLD1 mRNA CTD PMID:29803840 Pold1 Rat Enterolactone multiple interactions ISO POLD1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of POLD1 mRNA CTD PMID:19167446 Pold1 Rat enzyme inhibitor multiple interactions ISO POLD1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of POLD1 protein CTD PMID:23301498 Pold1 Rat epoxiconazole decreases expression ISO Pold1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of POLD1 mRNA CTD PMID:35436446 Pold1 Rat furan increases expression EXP 6480464 furan results in increased expression of POLD1 mRNA CTD PMID:22079235 and PMID:25539665 Pold1 Rat guanine multiple interactions ISO POLD1 (Homo sapiens) 6480464 Guanine metabolite results in decreased activity of [POLD1 protein binds to POLD2 protein binds to POLD3 protein binds to POLD4 protein] and Guanine metabolite results in decreased activity of [POLD1 protein binds to POLD2 protein binds to POLD4 protein] CTD PMID:26010525 Pold1 Rat guanine decreases activity ISO POLD1 (Homo sapiens) 6480464 Guanine metabolite results in decreased activity of POLD1 protein CTD PMID:26010525 Pold1 Rat hydrogen peroxide decreases expression ISO POLD1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of POLD1 mRNA CTD PMID:12419474 and PMID:21751221 Pold1 Rat hypochlorous acid decreases expression ISO Pold1 (Mus musculus) 6480464 Hypochlorous Acid results in decreased expression of POLD1 mRNA CTD PMID:19376150 Pold1 Rat indometacin multiple interactions ISO POLD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of POLD1 mRNA CTD PMID:28628672 Pold1 Rat ivermectin decreases expression ISO POLD1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of POLD1 protein CTD PMID:32959892 Pold1 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of POLD1 mRNA CTD PMID:20080153 Pold1 Rat lead diacetate increases expression ISO Pold1 (Mus musculus) 6480464 lead acetate results in increased expression of POLD1 mRNA CTD PMID:21829687 Pold1 Rat lead nitrate multiple interactions ISO Pold1 (Mus musculus) 6480464 lead nitrate affects the reaction [POLD1 affects the expression of MT1 mRNA] and lead nitrate affects the reaction [POLD1 affects the expression of MT2 mRNA] CTD PMID:11891201 Pold1 Rat lead(0) affects expression ISO POLD1 (Homo sapiens) 6480464 Lead affects the expression of POLD1 mRNA CTD PMID:28903495 Pold1 Rat methapyrilene decreases methylation ISO POLD1 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of POLD1 intron CTD PMID:30157460 Pold1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of POLD1 mRNA CTD PMID:30047161 Pold1 Rat miconazole increases expression EXP 6480464 Miconazole results in increased expression of POLD1 mRNA CTD PMID:22262564 Pold1 Rat mono(2-ethylhexyl) phthalate increases expression ISO POLD1 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of POLD1 mRNA CTD PMID:33120273 Pold1 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Pold1 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of POLD1 mRNA CTD PMID:33162236 Pold1 Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Pold1 (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of POLD1 3' UTR and Ethylnitrosourea results in increased mutagenesis of POLD1 gene CTD PMID:27776689 Pold1 Rat N-nitrosodiethylamine increases expression ISO Pold1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of POLD1 mRNA CTD PMID:17854601 Pold1 Rat N-nitrosodiethylamine multiple interactions ISO Pold1 (Mus musculus) 6480464 RB1 protein inhibits the reaction [Diethylnitrosamine results in increased expression of POLD1 mRNA] CTD PMID:17854601 Pold1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of POLD1 mRNA CTD PMID:20360939 Pold1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 caffeic acid phenethyl ester inhibits the reaction [Diethylnitrosamine results in increased expression of POLD1 mRNA] CTD PMID:20360939 Pold1 Rat nitrates multiple interactions ISO Pold1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of POLD1 mRNA CTD PMID:35964746 Pold1 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of POLD1 mRNA CTD PMID:16716893 Pold1 Rat ozone multiple interactions ISO POLD1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of POLD1 mRNA CTD PMID:35430440 Pold1 Rat ozone multiple interactions ISO Pold1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of POLD1 mRNA CTD PMID:34911549 Pold1 Rat paracetamol affects expression ISO Pold1 (Mus musculus) 6480464 Acetaminophen affects the expression of POLD1 mRNA CTD PMID:17562736 Pold1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of POLD1 mRNA CTD PMID:33387578 Pold1 Rat phenethyl caffeate multiple interactions EXP 6480464 caffeic acid phenethyl ester inhibits the reaction [Diethylnitrosamine results in increased expression of POLD1 mRNA] CTD PMID:20360939 Pold1 Rat phenethyl isothiocyanate decreases expression ISO POLD1 (Homo sapiens) 6480464 phenethyl isothiocyanate results in decreased expression of POLD1 mRNA CTD PMID:26678675 Pold1 Rat phenobarbital affects expression ISO POLD1 (Homo sapiens) 6480464 Phenobarbital affects the expression of POLD1 mRNA CTD PMID:19159669 Pold1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of POLD1 mRNA CTD PMID:19162173 Pold1 Rat progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of POLD1 mRNA CTD PMID:20726854 Pold1 Rat resveratrol multiple interactions ISO POLD1 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of POLD1 mRNA CTD PMID:19167446 Pold1 Rat SB 431542 multiple interactions ISO POLD1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of POLD1 protein CTD PMID:37664457 Pold1 Rat sodium arsenite decreases expression ISO POLD1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of POLD1 mRNA CTD PMID:12377979 more ... Pold1 Rat sodium arsenite increases expression ISO Pold1 (Mus musculus) 6480464 sodium arsenite results in increased expression of POLD1 mRNA CTD PMID:37682722 Pold1 Rat sodium arsenite increases expression ISO POLD1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of POLD1 mRNA CTD PMID:34032870 Pold1 Rat sodium dichromate increases expression ISO Pold1 (Mus musculus) 6480464 sodium bichromate results in increased expression of POLD1 mRNA CTD PMID:22155349 Pold1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of POLD1 mRNA CTD PMID:12325037 and PMID:22110744 Pold1 Rat sodium fluoride increases expression ISO Pold1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of POLD1 protein CTD PMID:28918527 Pold1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of POLD1 mRNA CTD PMID:19281266 Pold1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of POLD1 mRNA CTD PMID:30047161 Pold1 Rat sunitinib decreases expression ISO POLD1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of POLD1 mRNA CTD PMID:31533062 Pold1 Rat taurine increases expression ISO POLD1 (Homo sapiens) 6480464 Taurine results in increased expression of POLD1 mRNA CTD PMID:16579726 Pold1 Rat tert-butyl hydroperoxide decreases expression ISO POLD1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of POLD1 mRNA CTD PMID:12419474 Pold1 Rat testosterone multiple interactions ISO POLD1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of POLD1 mRNA CTD PMID:21592394 Pold1 Rat testosterone decreases expression ISO POLD1 (Homo sapiens) 6480464 Testosterone results in decreased expression of POLD1 mRNA CTD PMID:21592394 Pold1 Rat tetrachloromethane increases expression ISO Pold1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of POLD1 mRNA CTD PMID:31919559 Pold1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of POLD1 mRNA CTD PMID:34492290 Pold1 Rat titanium dioxide decreases methylation ISO Pold1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of POLD1 gene CTD PMID:35295148 Pold1 Rat titanium dioxide increases methylation ISO Pold1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of POLD1 promoter CTD PMID:35295148 Pold1 Rat toluene 2,4-diisocyanate increases expression ISO Pold1 (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in increased expression of POLD1 mRNA CTD PMID:21404309 Pold1 Rat trimellitic anhydride increases expression ISO Pold1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of POLD1 mRNA CTD PMID:19042947 Pold1 Rat troglitazone decreases expression ISO POLD1 (Homo sapiens) 6480464 troglitazone results in decreased expression of POLD1 mRNA CTD PMID:19140230 Pold1 Rat trovafloxacin decreases expression ISO Pold1 (Mus musculus) 6480464 trovafloxacin results in decreased expression of POLD1 mRNA CTD PMID:35537566 Pold1 Rat urethane decreases expression ISO POLD1 (Homo sapiens) 6480464 Urethane results in decreased expression of POLD1 mRNA CTD PMID:28818685 Pold1 Rat valproic acid affects expression ISO Pold1 (Mus musculus) 6480464 Valproic Acid affects the expression of POLD1 mRNA CTD PMID:17292431 Pold1 Rat vancomycin decreases expression ISO Pold1 (Mus musculus) 6480464 Vancomycin results in decreased expression of POLD1 mRNA CTD PMID:18930951
Imported Annotations - KEGG (archival)
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroperoxycyclophosphamide (ISO) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) Aflatoxin B2 alpha (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) Benzo[ghi]perylene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) calcitriol (ISO) cannabidiol (ISO) carbon nanotube (ISO) cefaloridine (EXP) chlorpyrifos (ISO) chromium(6+) (ISO) copper atom (ISO) copper(0) (ISO) coumarin (EXP) coumestrol (ISO) cyclosporin A (ISO) DDE (ISO) dexamethasone (ISO) Diallyl sulfide (EXP) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) diethylstilbestrol (EXP) dimethylarsinic acid (EXP) dioxygen (ISO) doxorubicin (ISO) Enterolactone (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) furan (EXP) guanine (ISO) hydrogen peroxide (ISO) hypochlorous acid (ISO) indometacin (ISO) ivermectin (ISO) ketamine (EXP) lead diacetate (ISO) lead nitrate (ISO) lead(0) (ISO) methapyrilene (ISO) methimazole (EXP) miconazole (EXP) mono(2-ethylhexyl) phthalate (ISO) N-ethyl-N-nitrosourea (ISO) N-nitrosodiethylamine (EXP,ISO) nitrates (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) phenethyl caffeate (EXP) phenethyl isothiocyanate (ISO) phenobarbital (ISO) pirinixic acid (EXP) progesterone (EXP) resveratrol (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium dichromate (EXP,ISO) sodium fluoride (ISO) Soman (EXP) sulfadimethoxine (EXP) sunitinib (ISO) taurine (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) trimellitic anhydride (ISO) troglitazone (ISO) trovafloxacin (ISO) urethane (ISO) valproic acid (ISO) vancomycin (ISO)
Biological Process
base-excision repair, gap-filling (IBA,IEA,ISO) cellular response to UV (IEA,ISO,ISS) DNA biosynthetic process (IEA,IMP,ISO) DNA damage response (IEA) DNA repair (IEA) DNA replication (IDA,IEA,ISO) DNA replication proofreading (IBA,IEA,ISO) DNA synthesis involved in DNA repair (IEA,ISO,ISS) DNA-templated DNA replication (IBA,IDA,IEA,IMP,ISO) error-free translesion synthesis (IEA,ISO,ISS) fatty acid homeostasis (IEA,ISO,ISS) nucleotide-excision repair, DNA gap filling (IBA,IEA,ISO)
Cellular Component
aggresome (IEA,ISO) chromosome, telomeric region (IEA,ISO) cytosol (IEA,ISO) delta DNA polymerase complex (IBA,IC,IDA,IEA,ISO) nucleoplasm (IEA,ISO) nucleotide-excision repair complex (IEA,ISO) nucleus (IEA,ISO)
Molecular Function
3'-5' exonuclease activity (IEA,ISO) 3'-5'-DNA exonuclease activity (IBA) 4 iron, 4 sulfur cluster binding (IEA) chromatin binding (IEA,ISO,ISS) damaged DNA binding (IEA,ISO,ISS) DNA binding (IEA,ISO) DNA polymerase activity (IEA) DNA-directed DNA polymerase activity (IBA,IDA,IEA,IMP,ISO) enzyme binding (IEA,ISO) exonuclease activity (IEA) hydrolase activity (IEA) iron-sulfur cluster binding (IEA) metal ion binding (IEA) nuclease activity (IEA) nucleic acid binding (IEA) nucleotide binding (IEA) nucleotidyltransferase activity (IEA) protein binding (ISO) transferase activity (IEA) zinc ion binding (IEA)
1.
Tenofovir diphosphate is a poor substrate and a weak inhibitor of rat DNA polymerases alpha, delta, and epsilon*.
Birkus G, etal., Antimicrob Agents Chemother. 2002 May;46(5):1610-3.
2.
Evidence for reduced copying fidelity of DNA polymerases alpha, delta, and epsilon from Novikoff hepatoma cells.
Fox G, etal., J Cancer Res Clin Oncol. 1997;123(11-12):659-68.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
High incidence of epithelial cancers in mice deficient for DNA polymerase delta proofreading.
Goldsby RE, etal., Proc Natl Acad Sci U S A 2002 Nov 26;99(24):15560-5. Epub 2002 Nov 12.
6.
DNA polymerases and repair synthesis in NER in human cells.
Lehmann AR DNA Repair (Amst). 2011 Jul 15;10(7):730-3. doi: 10.1016/j.dnarep.2011.04.023. Epub 2011 May 20.
7.
Mechanisms and functions of DNA mismatch repair.
Li GM Cell Res. 2008 Jan;18(1):85-98.
8.
Calmodulin is involved in the induction of DNA polymerases alpha and delta activities in normal rat kidney cells activated to proliferate.
Lopez-Girona A, etal., Biochem Biophys Res Commun. 1995 Dec 14;217(2):566-74.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
12.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
13.
A mutation detected in DNA polymerase delta cDNA from Novikoff hepatoma cells correlates with abnormal catalytic properties of the enzyme.
Popanda O, etal., J Cancer Res Clin Oncol 1999 Nov;125(11):598-608.
14.
DNA polymerases delta and epsilon in developing and aging rat brain.
Prapurna DR and Rao KS, Int J Dev Neurosci. 1997 Feb;15(1):67-73.
15.
Reactome: A Knowledgebase of Biological Processes
Reactome
16.
GOA pipeline
RGD automated data pipeline
17.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
Comprehensive gene review and curation
RGD comprehensive gene curation
20.
POLD1 and POLE Gene Mutations in Jewish Cohorts of Early-Onset Colorectal Cancer and of Multiple Colorectal Adenomas.
Rosner G, etal., Dis Colon Rectum. 2018 Sep;61(9):1073-1079. doi: 10.1097/DCR.0000000000001150.
21.
POLE and POLD1 germline exonuclease domain pathogenic variants, a rare event in colorectal cancer from the Middle East.
Siraj AK, etal., Mol Genet Genomic Med. 2020 Aug;8(8):e1368. doi: 10.1002/mgg3.1368. Epub 2020 Jun 22.
22.
Single nucleotide polymorphisms of nucleotide excision repair pathway are significantly associated with outcomes of platinum-based chemotherapy in lung cancer.
Song X, etal., Sci Rep. 2017 Sep 18;7(1):11785. doi: 10.1038/s41598-017-08257-7.
Pold1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 104,161,984 - 104,178,074 (-) NCBI GRCr8 mRatBN7.2 1 95,025,462 - 95,041,559 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 95,025,499 - 95,036,465 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 100,410,903 - 100,421,871 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 108,883,547 - 108,894,515 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 102,173,968 - 102,184,936 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 100,538,066 - 100,554,105 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 100,537,900 - 100,554,488 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 101,603,453 - 101,619,471 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 95,010,719 - 95,021,686 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 95,088,829 - 95,099,797 (-) NCBI Celera 1 89,287,965 - 89,298,931 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI
POLD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 50,384,323 - 50,418,018 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 50,384,204 - 50,418,018 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 50,887,580 - 50,921,275 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 55,579,405 - 55,613,083 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 55,579,407 - 55,613,082 NCBI Celera 19 47,937,836 - 47,971,517 (+) NCBI Celera Cytogenetic Map 19 q13.33 NCBI HuRef 19 47,225,718 - 47,259,759 (+) NCBI HuRef CHM1_1 19 50,889,357 - 50,923,058 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 53,471,875 - 53,505,574 (+) NCBI T2T-CHM13v2.0
Pold1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 44,182,168 - 44,198,239 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 44,182,170 - 44,198,273 (-) Ensembl GRCm39 Ensembl GRCm38 7 44,532,744 - 44,548,815 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 44,532,746 - 44,548,849 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 51,788,114 - 51,804,185 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 44,400,791 - 44,416,858 (-) NCBI MGSCv36 mm8 Celera 7 39,982,884 - 39,998,944 (-) NCBI Celera Cytogenetic Map 7 B3 NCBI cM Map 7 28.83 NCBI
Pold1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955559 712,321 - 725,661 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955559 712,375 - 730,551 (-) NCBI ChiLan1.0 ChiLan1.0
POLD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 56,449,766 - 56,483,752 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 58,371,169 - 58,405,169 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 47,347,919 - 47,381,772 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 56,251,356 - 56,284,263 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 56,251,356 - 56,297,611 (+) Ensembl panpan1.1 panPan2
POLD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 106,302,583 - 106,331,353 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 106,302,574 - 106,331,385 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 105,875,694 - 105,904,437 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 106,813,663 - 106,842,434 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 1 106,485,820 - 106,514,537 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 106,127,322 - 106,156,071 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 106,967,996 - 106,996,721 (-) NCBI UU_Cfam_GSD_1.0
Pold1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 22,355,338 - 22,382,953 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936889 251,874 - 258,201 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 Ensembl NW_004936889 231,373 - 250,987 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936889 231,373 - 250,985 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
POLD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 55,247,880 - 55,272,085 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 55,247,799 - 55,272,087 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 51,096,669 - 51,120,965 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
Pold1
.
Predicted Target Of
Count of predictions: 180 Count of miRNA genes: 140 Interacting mature miRNAs: 159 Transcripts: ENSRNOT00000026797 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 1331800 Scl25 Serum cholesterol level QTL 25 3.013 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 94494440 117601394 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
RH144354
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 95,028,872 - 95,029,168 (+) MAPPER mRatBN7.2 Rnor_6.0 1 100,541,472 - 100,541,767 NCBI Rnor6.0 Rnor_5.0 1 101,606,859 - 101,607,154 UniSTS Rnor5.0 RGSC_v3.4 1 95,014,093 - 95,014,388 UniSTS RGSC3.4 Celera 1 89,291,339 - 89,291,634 UniSTS RH 3.4 Map 1 903.69 UniSTS Cytogenetic Map 1 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026797 ⟹ ENSRNOP00000026797
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 95,025,499 - 95,036,465 (-) Ensembl Rnor_6.0 Ensembl 1 100,537,900 - 100,554,488 (-) Ensembl
RefSeq Acc Id:
NM_021662 ⟹ NP_067694
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 104,162,016 - 104,172,982 (-) NCBI mRatBN7.2 1 95,025,499 - 95,036,465 (-) NCBI Rnor_6.0 1 100,538,098 - 100,549,064 (-) NCBI Rnor_5.0 1 101,603,453 - 101,619,471 (-) NCBI RGSC_v3.4 1 95,010,719 - 95,021,686 (-) RGD Celera 1 89,287,965 - 89,298,931 (-) RGD
Sequence:
GATGGATGGTAAACGGCGGCAAGCGCCCAGCTCTGGGGTGCCCCCAAAGCGGGCTTGCAAGGGCCTCTGGGATGAAGATGAGCCGTCACAGTTTGAGGAGAACCTGGCGCTGCTGGAGGAGATAGAGG
hide sequence
RefSeq Acc Id:
XM_006229142 ⟹ XP_006229204
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 104,161,984 - 104,178,074 (-) NCBI mRatBN7.2 1 95,025,462 - 95,041,559 (-) NCBI Rnor_6.0 1 100,538,066 - 100,554,105 (-) NCBI Rnor_5.0 1 101,603,453 - 101,619,471 (-) NCBI
Sequence:
CAGGGGCGGGGCCTAGCGGGCGTGCCTCAGCTCTGGGCCTGCGCGCGTAGGGTTCATGGGTCACGGCGGCGTACCTTGTGGCGGGAAAAGCTGTTTGACGCGATGGATGGTAAACGGCGGCAAGCGCC
hide sequence
RefSeq Acc Id:
XM_063272283 ⟹ XP_063128353
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 104,161,984 - 104,177,938 (-) NCBI
RefSeq Acc Id:
NP_067694 ⟸ NM_021662
- UniProtKB:
O54747 (UniProtKB/Swiss-Prot), A6JAQ5 (UniProtKB/TrEMBL)
- Sequence:
MDGKRRQAPSSGVPPKRACKGLWDEDEPSQFEENLALLEEIEAENRLQEAEEELQLPPEGIVGGQFSTADIDPRWLRPTPLALDPSTEPLIFQQLEIDHYVGTSPPLPEGPPASRNSVPILRAFGVTD
hide sequence
RefSeq Acc Id:
XP_006229204 ⟸ XM_006229142
- Peptide Label:
isoform X1
- UniProtKB:
G3V8M1 (UniProtKB/TrEMBL), A6JAQ6 (UniProtKB/TrEMBL), A6JAQ5 (UniProtKB/TrEMBL)
- Sequence:
MDGKRRQAPSSGVPPKRACKGLWDEDEPSQFEENLALLEEIEAENRLQEAEEELQLPPEGIVGGQFSTADIDPRWLRPTPLALDPSTEPLIFQQLEIDHYVGTSPPLPEGPPASRNSVPILRAFGVTD
hide sequence
Ensembl Acc Id:
ENSRNOP00000026797 ⟸ ENSRNOT00000026797
RefSeq Acc Id:
XP_063128353 ⟸ XM_063272283
- Peptide Label:
isoform X1
- UniProtKB:
A6JAQ6 (UniProtKB/TrEMBL), G3V8M1 (UniProtKB/TrEMBL), A6JAQ5 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-29
Pold1
DNA polymerase delta 1, catalytic subunit
Pold1
DAN polymerase delta 1, catalytic subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-07-21
Pold1
DAN polymerase delta 1, catalytic subunit
Pold1
polymerase (DNA) delta 1, catalytic subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-03-09
Pold1
polymerase (DNA) delta 1, catalytic subunit
Pold1
polymerase (DNA directed), delta 1, catalytic subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Pold1
polymerase (DNA directed), delta 1, catalytic subunit
DNA polymerase delta, catalytic subunit
Name updated
1299863 APPROVED
2002-08-07
Pold1
DNA polymerase delta, catalytic subunit
Symbol and Name status set to provisional
70820 PROVISIONAL
