Amacr (alpha-methylacyl-CoA racemase)

Advanced Search (OLGA)

Gene: Amacr (alpha-methylacyl-CoA racemase) Rattus norvegicus

Analyze

Symbol:

Amacr

Name:

alpha-methylacyl-CoA racemase

RGD ID:

3048

Description:

Enables alpha-methylacyl-CoA racemase activity. Involved in bile acid biosynthetic process. Located in mitochondrion and peroxisome. Human ortholog(s) of this gene implicated in alpha-methylacyl-CoA racemase deficiency; congenital bile acid synthesis defect 4; and urinary bladder cancer. Orthologous to human AMACR (alpha-methylacyl-CoA racemase); PARTICIPATES IN bile acid biosynthetic pathway; cerebrotendinous xanthomatosis pathway; congenital bile acid synthesis defect pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

2-arylpropionyl-CoA epimerase; 2-methylacyl-CoA racemase; Da1-8; Marc1; methylacyl-CoA racemase alpha

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AMACR (alpha-methylacyl-CoA racemase)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Amacr (alpha-methylacyl-CoA racemase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Amacr (alpha-methylacyl-CoA racemase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AMACR (alpha-methylacyl-CoA racemase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AMACR (alpha-methylacyl-CoA racemase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Amacr (alpha-methylacyl-CoA racemase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AMACR (alpha-methylacyl-CoA racemase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AMACR (alpha-methylacyl-CoA racemase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Amacr (alpha-methylacyl-CoA racemase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GPRIN2 (G protein regulated inducer of neurite outgrowth 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	AMACR (alpha-methylacyl-CoA racemase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Amacr (alpha-methylacyl-CoA racemase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	amacr (alpha-methylacyl-CoA racemase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Amacr	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C24A3.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZK892.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	amacr	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	61,673,291 - 61,685,381 (+)	NCBI		GRCr8
mRatBN7.2	2	59,946,158 - 59,958,255 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	59,946,153 - 59,958,255 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	67,055,385 - 67,067,396 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	65,176,896 - 65,188,909 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	60,178,272 - 60,190,287 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	60,949,276 - 60,961,342 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	60,949,256 - 60,961,326 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	83,723,119 - 83,735,166 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	60,332,292 - 60,344,326 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	60,260,524 - 60,272,557 (+)	NCBI
Celera	2	58,726,090 - 58,738,137 (-)	NCBI		Celera
Cytogenetic Map	2	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenoma (ISO)

alpha-methylacyl-CoA racemase deficiency (ISO,ISS)

breast carcinoma (ISO)

Colorectal Neoplasms (ISO)

congenital bile acid synthesis defect 4 (ISO)

epilepsy (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

liver disease (ISO)

mitochondrial complex I deficiency (ISO)

motor peripheral neuropathy (ISO)

Neurodevelopmental Disorders (ISO)

oculocutaneous albinism (ISO)

prostate carcinoma in situ (ISO)

Prostatic Neoplasms (ISO)

renal cell carcinoma (ISO)

spastic ataxia (ISO)

urinary bladder cancer (ISO)

Urologic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-methylphenanthrene (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (EXP)

acetamide (EXP)

aconitine (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphotericin B (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bicalutamide (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bleomycin A5 (ISO)

butanal (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

cisplatin (ISO)

clofibrate (EXP)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (ISO)

dibenzo[a,l]pyrene (ISO)

dibutyl phthalate (EXP,ISO)

dichlorine (EXP)

diquat (ISO)

dorsomorphin (ISO)

epoxiconazole (ISO)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

gentamycin (EXP)

glafenine (EXP)

hydrazine (EXP)

ibuprofen (ISO)

indometacin (EXP)

isotretinoin (ISO)

mercury dichloride (EXP,ISO)

methapyrilene (EXP)

methotrexate (ISO)

methylmercury chloride (ISO)

N-acetyl-L-cysteine (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

N-nitrosomorpholine (EXP)

nickel dichloride (EXP)

ozone (EXP)

paclitaxel (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenformin (EXP)

phenobarbital (EXP)

pirinixic acid (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP)

pterostilbene (ISO)

quercetin (ISO)

sarin (ISO)

SB 431542 (ISO)

silibinin (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

tetracycline (ISO)

thalidomide (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

Triptolide (EXP)

trovafloxacin (ISO)

valproic acid (ISO)

vancomycin (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bile acid biosynthetic process (IDA,IEA)

bile acid metabolic process (IBA,IDA,IEA,ISO)

fatty acid metabolic process (IEA)

Cellular Component

cytoplasm (ISO)

intracellular membrane-bounded organelle (ISO)

mitochondrion (IBA,IDA,IEA,ISO)

peroxisome (IDA,IEA,ISO)

plasma membrane (IEA,ISO)

Molecular Function

alpha-methylacyl-CoA racemase activity (IBA,IDA,IEA,ISO)

catalytic activity (IEA)

signaling receptor binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

bile acid biosynthetic pathway (IEA,ISO)

cerebrotendinous xanthomatosis pathway (ISO)

congenital bile acid synthesis defect pathway (ISO)

familial hypercholanemia pathway (ISO)

primary bile acid biosynthetic pathway (IEA)

Zellweger syndrome pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Normalization and subtraction: two approaches to facilitate gene discovery.	Bonaldo MF, etal., Genome Res 1996 Sep;6(9):791-806.
2.	The role of alpha-methylacyl-CoA racemase in bile acid synthesis.	Cuebas DA, etal., Biochem J 2002 May 1;363(Pt 3):801-7.
3.	Subcellular localization and physiological role of alpha-methylacyl-CoA racemase.	Ferdinandusse S, etal., J Lipid Res. 2000 Nov;41(11):1890-6.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Expression of alpha-methylacyl-CoA racemase correlates with histopathologic grading in noninvasive bladder cancer.	Gunia S, etal., Virchows Arch. 2008 Aug;453(2):165-70. Epub 2008 Jul 22.
7.	Aberrant expression and potency as a cancer immunotherapy target of alpha-methylacyl-coenzyme A racemase in prostate cancer.	Honma I, etal., J Transl Med. 2009 Dec 9;7:103.
8.	Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.	Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
9.	Alpha-methylacyl-CoA racemase (AMACR/P504S) protein expression in urothelial carcinoma of the upper urinary tract correlates with tumour progression.	Langner C, etal., Virchows Arch. 2006 Mar;448(3):325-30. Epub 2005 Nov 29.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
13.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
14.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
15.	GOA pipeline	RGD automated data pipeline
16.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	Purification and properties of an alpha-methylacyl-CoA racemase from rat liver.	Schmitz W, etal., Eur J Biochem. 1994 Jun 1;222(2):313-23.
19.	Purification and characterization of an alpha-methylacyl-CoA racemase from human liver.	Schmitz W, etal., Eur J Biochem. 1995 Aug 1;231(3):815-22.
20.	Prognostic significance of alpha-methylacyl-coA racemase among men with high grade prostatic intraepithelial neoplasia in prostate biopsies.	Stewart J, etal., J Urol. 2008 May;179(5):1751-5; discussion 1755. Epub 2008 Mar 17.
21.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
22.	Expression of alpha-methylacyl-CoA racemase in papillary renal cell carcinoma.	Tretiakova MS, etal., Am J Surg Pathol. 2004 Jan;28(1):69-76.
23.	Alpha-methylacyl-CoA racemase protein expression is associated with the degree of differentiation in breast cancer using quantitative image analysis.	Witkiewicz AK, etal., Cancer Epidemiol Biomarkers Prev. 2005 Jun;14(6):1418-23.

Additional References at PubMed

PMID:8615858	PMID:9106621	PMID:9307041	PMID:10655068	PMID:10770938	PMID:11060344	PMID:12477932	PMID:14651853	PMID:18614015	PMID:20102405	PMID:20178365

Genomics

Comparative Map Data

Amacr
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	61,673,291 - 61,685,381 (+)	NCBI		GRCr8
mRatBN7.2	2	59,946,158 - 59,958,255 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	59,946,153 - 59,958,255 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	67,055,385 - 67,067,396 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	65,176,896 - 65,188,909 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	60,178,272 - 60,190,287 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	60,949,276 - 60,961,342 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	60,949,256 - 60,961,326 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	83,723,119 - 83,735,166 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	60,332,292 - 60,344,326 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	60,260,524 - 60,272,557 (+)	NCBI
Celera	2	58,726,090 - 58,738,137 (-)	NCBI		Celera
Cytogenetic Map	2	q16	NCBI

AMACR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	33,986,165 - 34,008,050 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	33,986,165 - 34,008,104 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	33,986,270 - 34,008,155 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	34,023,652 - 34,043,963 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	34,023,658 - 34,043,963	NCBI
Celera	5	33,875,521 - 33,896,657 (-)	NCBI		Celera
Cytogenetic Map	5	p13.2	NCBI
HuRef	5	33,965,051 - 33,986,185 (-)	NCBI		HuRef
CHM1_1	5	33,988,659 - 34,009,789 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	34,108,084 - 34,129,983 (-)	NCBI		T2T-CHM13v2.0

Amacr
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	10,981,875 - 10,995,693 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	10,981,842 - 10,996,712 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	10,981,756 - 10,996,624 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	10,981,756 - 10,996,626 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	10,911,511 - 10,926,379 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	10,926,481 - 10,941,349 (+)	NCBI		MGSCv36	mm8
Celera	15	10,773,835 - 10,788,820 (+)	NCBI		Celera
Cytogenetic Map	15	A1	NCBI
cM Map	15	5.39	NCBI

Amacr
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955426	19,570,070 - 19,580,818 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955426	19,570,179 - 19,580,920 (-)	NCBI	ChiLan1.0	ChiLan1.0

AMACR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	76,300,803 - 76,321,985 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	74,455,666 - 74,477,720 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	76,336,631 - 76,358,724 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	81,722,973 - 81,742,806 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	81,687,891 - 81,742,003 (+)	Ensembl	panpan1.1		panPan2

AMACR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	73,815,438 - 73,836,016 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	73,815,291 - 73,867,437 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	73,431,203 - 73,451,716 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	74,321,712 - 74,342,286 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	74,321,704 - 74,376,263 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	74,068,256 - 74,088,061 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	74,191,815 - 74,212,352 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	74,725,962 - 74,746,514 (+)	NCBI		UU_Cfam_GSD_1.0

Amacr
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	224,282,991 - 224,299,409 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936518	7,072,403 - 7,088,929 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936518	7,072,436 - 7,088,927 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AMACR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	19,956,366 - 20,023,289 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	20,005,741 - 20,023,339 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	20,765,256 - 20,782,844 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AMACR
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	33,221,777 - 33,244,829 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	33,225,754 - 33,244,836 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666071	23,518,099 - 23,540,732 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Amacr
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624759	20,495,980 - 20,510,582 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624759	20,495,697 - 20,506,343 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Amacr
72 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	84
Count of miRNA genes:	36
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000025323, ENSRNOT00000040701
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	59846005	104846005	Rat
6480225	Gdil1	Gastrointestinal dilation QTL 1			enteric ganglion morphology trait (VT:0001045)	length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836)	2	56660879	74786777	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
2293676	Bmd19	Bone mineral density QTL 19	10.7	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	43162366	111362592	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
2293682	Bmd24	Bone mineral density QTL 24	8.9	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	43162366	111362592	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	20304672	65304672	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	38573329	122609194	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
10402051	Gdil2	Gastrointestinal dilation QTL 2			enteric ganglion morphology trait (VT:0001045)	length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836)	2	24903853	74786777	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	40067944	102785628	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
631208	Bw1	Body weight QTL1	5.09		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	2	43171017	83575226	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1300155	Bp174	Blood pressure QTL 174	4.09		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	42804607	60653831	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	59324377	103795077	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
2300168	Bmd47	Bone mineral density QTL 47	6.6	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	2	20662448	65662448	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1357990	Ael1	Aortic elastin QTL 1	3.1	0.00091	aorta elastin amount (VT:0003905)	aortic elastin	2	19076825	64076825	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	16491740	61491740	Rat
61371	Edpm1	Estrogen-dependent pituitary mass QTL 1	4	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	35134841	88029593	Rat
1582246	Cm60	Cardiac mass QTL 60	5.8		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	57605612	76539510	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	59324719	102755241	Rat
7387318	Stl32	Serum triglyceride level QTL 32	3.2	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	22384627	67384627	Rat
10755436	Coatc8	Coat color QTL 8		0.02431	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	35023117	80023117	Rat
10755434	Coatc7	Coat color QTL 7		0.04794	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	30648065	75648065	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	59324377	103795077	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
9590095	Sffal3	Serum free fatty acids level QTL 3	6.78	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	2	27157160	72157160	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	81754745	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1354592	Rf50	Renal function QTL 50	3.5		urine output (VT:0003620)	timed urine volume (CMO:0000260)	2	53822747	74786777	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat

Markers in Region

RH127386

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	59,957,936 - 59,958,155 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	60,961,024 - 60,961,242	NCBI	Rnor6.0
Rnor_5.0	2	83,723,219 - 83,723,437	UniSTS	Rnor5.0
RGSC_v3.4	2	60,344,008 - 60,344,226	UniSTS	RGSC3.4
Celera	2	58,726,190 - 58,726,408	UniSTS
Cytogenetic Map	2	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012816	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101775	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY325250	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC127505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM061736	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U89905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y08172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025323 ⟹ ENSRNOP00000025323

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	59,946,153 - 59,958,255 (+)	Ensembl
Rnor_6.0 Ensembl	2	60,949,256 - 60,961,326 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000040701 ⟹ ENSRNOP00000040100

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	59,946,153 - 59,958,255 (+)	Ensembl
Rnor_6.0 Ensembl	2	60,949,283 - 60,960,987 (+)	Ensembl

RefSeq Acc Id:

NM_012816 ⟹ NP_036948

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	61,673,335 - 61,685,381 (+)	NCBI
mRatBN7.2	2	59,946,209 - 59,958,255 (+)	NCBI
Rnor_6.0	2	60,949,276 - 60,961,342 (+)	NCBI
Rnor_5.0	2	83,723,119 - 83,735,166 (-)	NCBI
RGSC_v3.4	2	60,332,292 - 60,344,326 (+)	RGD
Celera	2	58,726,090 - 58,738,137 (-)	NCBI

Sequence:

show sequence

GTTGGCCATGGCGCTGCGTGGCGTCAGGGTTCTGGAGCTGGCAGGCCTGGCCCCAGGGCCGTTC
TGCGGGATGATCCTGGCGGACTTCGGCGCCGAGGTGGTGCTCGTGGACAGACTGGGCTCCGTGA
ACCACCCCAGTCACCTGGCCCGAGGCAAGCGCTCGCTGGCGCTGGACCTGAAGCGGTCTCCGGG
AGCCGCGGTGTTGCGGCGCATGTGCGCACGCGCGGACGTGTTGCTGGAGCCCTTCCGTTGCGGT
GTCATGGAGAAACTCCAGCTTGGGCCAGAGACTCTACAGCAGGACAATCCAAAGCTCATCTATG
CCAGGCTGAGTGGATTTGGCCAGTCGGGAATTTTCTCCAAAGTAGCTGGCCATGACATCAACTA
TGTGGCTTTGTCAGGTGTCCTGTCAAAGATTGGCAGGAGCGGTGAGAACCCATACCCTCCCCTG
AACCTCCTGGCCGACTTTGGTGGCGGTGGCCTCATGTGCACATTGGGCATTTTGCTGGCTCTCT
TCGAACGCACGCGGTCTGGCCTAGGGCAGGTCATTGATGCGAACATGGTGGAAGGAACGGCATA
CTTAAGTACTTTCCTGTGGAAAACTCAAGCCATGGGTCTGTGGGCACAGCCTCGAGGGCAAAAC
CTGTTAGATGGCGGGGCACCTTTCTACACAACCTACAAGACCGCAGATGGGGAGTTCATGGCTG
TAGGTGCAATAGAACCCCAGTTCTACACACTGCTGCTTAAAGGACTTGGACTTGAGTCTGAGGA
ACTCCCCAGCCAGATGAGCATAGAAGATTGGCCAGAAGTGAAGAAGAAATTTGCAGATGTGTTT
GCAAGGAAGACTAAGGCAGAGTGGTGCCAGATCTTTGACGGGACAGATGCATGTGTGACCCCAG
TGCTGACTCTTGAGGAGGCCCTCCACCACCAGCACAACAGAGAACGGGGCTCCTTCATCACTGA
CGAGGAGCAGCATGCAAGCCCCCGTCCTGCACCCCAGCTTTCCAGAACCCCTGCTGTTCCTTCT
GCCAAAAGGGACCCTTCTGTGGGAGAGCACACTGTAGAGGTGCTTAAAGACTATGGATTCAGTC
AGGAAGAGATCCATCAGCTGCACTCGGATAGAATCATTGAAAGTAATAAGCTAAAAGCCAACCT
CTGACTCAGGTTCACAGCTCAAGTGAATCTGAAGGCTGTATCTGTACTGGAGAAGGATGCCCAC
CACTGTCCGTATGGAAATGTGAATGAACAGTAATGAAGTAATCCAAATATTCCAATCAAGACAC
AACGAAAGACTGATTACAGAGAAATGACTGTGCTCTCACACTGCTCATCCGAGCCTCTGATTGA
GGAGTATTTTTGTGTGTGTACTGATATTAACTTGTGGCAGTTTTCTGCCTTTCAGCTCACTTGG
TGAAGTGCATTCACTGATTAAAACCCTTTTGTAAATGCAACTCTGATAATATATTAAATGAACT
AATATAACTTTAATAAATAAAGCTTTTTTTTTCCTTGAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

hide sequence

RefSeq Acc Id:

XM_039101775 ⟹ XP_038957703

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	61,673,291 - 61,685,381 (+)	NCBI
mRatBN7.2	2	59,946,158 - 59,957,759 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_036948	(Get FASTA)	NCBI Sequence Viewer
	XP_038957703	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB72145	(Get FASTA)	NCBI Sequence Viewer
	AAH78885	(Get FASTA)	NCBI Sequence Viewer
	AAH91163	(Get FASTA)	NCBI Sequence Viewer
	AAI27506	(Get FASTA)	NCBI Sequence Viewer
	AAP92651	(Get FASTA)	NCBI Sequence Viewer
	CAA69358	(Get FASTA)	NCBI Sequence Viewer
	EDL82982	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025323.3
	ENSRNOP00000040100.2
	ENSRNOP00055036056
	ENSRNOP00060030921
	ENSRNOP00065028643
GenBank Protein	P70473	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_036948 ⟸ NM_012816

- UniProtKB:

P70473 (UniProtKB/Swiss-Prot), O09176 (UniProtKB/Swiss-Prot), G3V8F9 (UniProtKB/TrEMBL), A6KJS2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALRGVRVLELAGLAPGPFCGMILADFGAEVVLVDRLGSVNHPSHLARGKRSLALDLKRSPGAA
VLRRMCARADVLLEPFRCGVMEKLQLGPETLQQDNPKLIYARLSGFGQSGIFSKVAGHDINYVA
LSGVLSKIGRSGENPYPPLNLLADFGGGGLMCTLGILLALFERTRSGLGQVIDANMVEGTAYLS
TFLWKTQAMGLWAQPRGQNLLDGGAPFYTTYKTADGEFMAVGAIEPQFYTLLLKGLGLESEELP
SQMSIEDWPEVKKKFADVFARKTKAEWCQIFDGTDACVTPVLTLEEALHHQHNRERGSFITDEE
QHASPRPAPQLSRTPAVPSAKRDPSVGEHTVEVLKDYGFSQEEIHQLHSDRIIESNKLKANL

hide sequence

Ensembl Acc Id:

ENSRNOP00000025323 ⟸ ENSRNOT00000025323

Ensembl Acc Id:

ENSRNOP00000040100 ⟸ ENSRNOT00000040701

RefSeq Acc Id:	XP_038957703 ⟸ XM_039101775
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P70473-F1-model_v2	AlphaFold	P70473	1-382	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691188

Promoter ID:

EPDNEW_R1713

Type:

multiple initiation site

Name:

Amacr_1

Description:

alpha-methylacyl-CoA racemase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	60,949,273 - 60,949,333	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3048	AgrOrtholog
BioCyc Gene	G2FUF-54068	BioCyc
BioCyc Pathway	PWY-6061 [bile acid biosynthesis, neutral pathway]	BioCyc
BioCyc Pathway Image	PWY-6061	BioCyc
Ensembl Genes	ENSRNOG00000018662	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00055025508	UniProtKB/Swiss-Prot
	ENSRNOG00060021618	UniProtKB/Swiss-Prot
	ENSRNOG00065020908	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000025323.6	UniProtKB/TrEMBL
	ENSRNOT00000040701.5	UniProtKB/TrEMBL
	ENSRNOT00055044076	UniProtKB/Swiss-Prot
	ENSRNOT00060037521	UniProtKB/Swiss-Prot
	ENSRNOT00065035542	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.1540.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7110324	IMAGE-MGC_LOAD
	IMAGE:7130642	IMAGE-MGC_LOAD
	IMAGE:7325347	IMAGE-MGC_LOAD
InterPro	CoA-transferase_III	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CoA-Trfase_fam_III	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CoA-Trfase_III_dom3_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CoA-Trfase_III_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25284	UniProtKB/TrEMBL
MGC_CLONE	MGC:108744	IMAGE-MGC_LOAD
	MGC:156672	IMAGE-MGC_LOAD
	MGC:93581	IMAGE-MGC_LOAD
NCBI Gene	25284	ENTREZGENE
PANTHER	ALPHA-METHYLACYL-COA RACEMASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SUCCINYL-COA--D-CITRAMALATE COA-TRANSFERASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CoA_transf_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Amacr	PhenoGen
RatGTEx	ENSRNOG00000018662	RatGTEx
	ENSRNOG00055025508	RatGTEx
	ENSRNOG00060021618	RatGTEx
	ENSRNOG00065020908	RatGTEx
Superfamily-SCOP	SSF89796	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC229699
UniProt	A6KJS2	ENTREZGENE, UniProtKB/TrEMBL
	AMACR_RAT	UniProtKB/Swiss-Prot
	G3V8F9	ENTREZGENE, UniProtKB/TrEMBL
	O09176	ENTREZGENE
	P70473	ENTREZGENE
	Q5BK88_RAT	UniProtKB/TrEMBL
	Q7TP08_RAT	UniProtKB/TrEMBL
UniProt Secondary	O09176	UniProtKB/Swiss-Prot
	Q68FY5	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2001-06-22	Amacr	alpha-methylacyl-CoA racemase			Symbol and Name updated to reflect Human and Mouse nomenclature	67952	APPROVED
2001-06-22	1-Mar	Methylacyl-CoA racemase alpha			Symbol and Name withdrawn	67952	WITHDRAWN

RGD Curation Notes

Note Type	Note	Reference
gene_process	involved in racemization of 2-methyl-branched fatty acid coa esters and responsible for the conversion of pristanoyl-coa and c27-bile acyl-coas to their (s)-stereoisomers	724707
gene_process	has a role in drug metabolism as well as probably in lipid metabolism	724707

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways