Advanced Search (OLGA)

Gene: Kctd7 (potassium channel tetramerization domain containing 7) Rattus norvegicus

Analyze

Symbol:

Kctd7

Name:

potassium channel tetramerization domain containing 7

RGD ID:

1582914

Description:

Predicted to enable identical protein binding activity. Predicted to be involved in several processes, including intracellular glutamate homeostasis; intracellular potassium ion homeostasis; and membrane hyperpolarization. Predicted to be located in cytoplasm. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in progressive myoclonus epilepsy 3. Orthologous to human KCTD7 (potassium channel tetramerization domain containing 7); INTERACTS WITH 17alpha-ethynylestradiol; bisphenol A; endosulfan.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

BTB/POZ domain-containing protein KCTD7; LOC687365; LOC688993; MGC188043; potassium channel tetramerisation domain containing 7; similar to potassium channel tetramerisation domain containing 7

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	32,157,141 - 32,168,463 (-)	NCBI		GRCr8
mRatBN7.2	12	26,520,969 - 26,532,327 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	26,523,142 - 26,532,138 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	27,671,087 - 27,680,095 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	28,281,596 - 28,290,609 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	27,343,186 - 27,352,200 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	30,024,080 - 30,033,357 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	30,024,081 - 30,033,357 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	31,961,818 - 31,970,830 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	27,564,093 - 27,573,372 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	12	28,237,507 - 28,246,407 (-)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

argininosuccinic aciduria (ISO)

epilepsy (ISO)

Generalized Epilepsy (ISO)

genetic disease (ISO)

intellectual disability (ISO)

neuronal ceroid lipofuscinosis (ISO)

neuronal ceroid lipofuscinosis 1 (ISO)

pleomorphic xanthoastrocytoma (ISO)

progressive myoclonus epilepsy (ISO)

progressive myoclonus epilepsy 3 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

antirheumatic drug (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cisplatin (ISO)

diuron (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethanol (ISO)

gentamycin (EXP)

leflunomide (ISO)

methylmercury chloride (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

sodium arsenite (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intracellular glutamate homeostasis (ISO)

intracellular potassium ion homeostasis (ISO)

membrane hyperpolarization (IBA,ISO)

positive regulation of transporter activity (ISO)

protein homooligomerization (IEA)

Cellular Component

cytoplasm (ISO)

cytosol (IEA)

plasma membrane (IBA,IEA,ISO)

Molecular Function

identical protein binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15632090	PMID:16751776	PMID:22748208	PMID:27742667

Genomics

Comparative Map Data

Kctd7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	32,157,141 - 32,168,463 (-)	NCBI		GRCr8
mRatBN7.2	12	26,520,969 - 26,532,327 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	26,523,142 - 26,532,138 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	27,671,087 - 27,680,095 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	28,281,596 - 28,290,609 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	27,343,186 - 27,352,200 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	30,024,080 - 30,033,357 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	30,024,081 - 30,033,357 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	31,961,818 - 31,970,830 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	27,564,093 - 27,573,372 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	12	28,237,507 - 28,246,407 (-)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

KCTD7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	66,628,881 - 66,643,229 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	66,628,881 - 66,649,067 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	66,093,868 - 66,108,216 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	65,731,380 - 65,743,252 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	65,538,094 - 65,549,967	NCBI
Celera	7	66,008,064 - 66,022,242 (-)	NCBI		Celera
Cytogenetic Map	7	q11.21	NCBI
HuRef	7	62,278,875 - 62,293,196 (+)	NCBI		HuRef
CHM1_1	7	66,189,128 - 66,203,476 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	67,848,529 - 67,862,889 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	65,431,411 - 65,445,769 (+)	NCBI

Kctd7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	130,166,814 - 130,183,960 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	130,173,702 - 130,184,647 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	130,137,978 - 130,155,119 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	130,144,861 - 130,155,806 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	130,620,758 - 130,631,678 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	130,429,591 - 130,440,511 (+)	NCBI		MGSCv36	mm8
Celera	5	127,151,737 - 127,162,650 (+)	NCBI		Celera
Cytogenetic Map	5	G1.3	NCBI
cM Map	5	68.72	NCBI

Kctd7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	8,627,763 - 8,636,206 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955456	8,627,763 - 8,637,882 (+)	NCBI	ChiLan1.0	ChiLan1.0

KCTD7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	81,942,145 - 81,988,301 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	130,269,315 - 130,328,801 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	59,392,366 - 59,435,993 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	73,687,965 - 73,697,728 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	73,687,952 - 73,697,728 (+)	Ensembl	panpan1.1		panPan2

KCTD7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	6	2,764,741 - 2,791,265 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	869,955 - 896,567 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	869,908 - 986,852 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	804,950 - 831,471 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	807,116 - 833,698 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	978,947 - 1,005,464 (+)	NCBI		UU_Cfam_GSD_1.0

KCTD7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	16,385,006 - 16,393,841 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	16,382,333 - 16,393,861 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	16,636,406 - 16,646,076 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KCTD7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	2,255,817 - 2,276,616 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	2,256,743 - 2,271,099 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666070	14,356,688 - 14,370,912 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kctd7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	8,598,309 - 8,609,696 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	8,588,339 - 8,609,541 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Kctd7
87 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	79
Count of miRNA genes:	67
Interacting mature miRNAs:	73
Transcripts:	ENSRNOT00000001198
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	44726024	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	8525423	28064601	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	43551788	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	24234777	31894213	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	28064557	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	1	29333307	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	13635523	30827399	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	8449490	28302290	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

Markers in Region

RH137475

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	26,523,154 - 26,523,357 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	30,024,094 - 30,024,296	NCBI	Rnor6.0
Rnor_5.0	12	31,961,832 - 31,962,034	UniSTS	Rnor5.0
RGSC_v3.4	12	27,564,107 - 27,564,309	UniSTS	RGSC3.4
Celera	12	28,237,521 - 28,237,723	UniSTS
Cytogenetic Map	12	q13	UniSTS

RH135160

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	26,528,005 - 26,528,216 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	30,029,226 - 30,029,436	NCBI	Rnor6.0
Rnor_5.0	12	31,966,699 - 31,966,909	UniSTS	Rnor5.0
RGSC_v3.4	12	27,569,241 - 27,569,451	UniSTS	RGSC3.4
Celera	12	28,242,276 - 28,242,486	UniSTS
RH 3.4 Map	12	450.0	UniSTS
Cytogenetic Map	12	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001128194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005491672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC116246	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC162055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ613620	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001198 ⟹ ENSRNOP00000001198

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,523,142 - 26,532,138 (-)	Ensembl
Rnor_6.0 Ensembl	12	30,024,081 - 30,033,357 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104418 ⟹ ENSRNOP00000083749

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,523,142 - 26,529,695 (-)	Ensembl

RefSeq Acc Id:

NM_001128194 ⟹ NP_001121666

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	32,159,296 - 32,168,292 (-)	NCBI
mRatBN7.2	12	26,523,141 - 26,532,138 (-)	NCBI
Rnor_6.0	12	30,024,080 - 30,033,357 (-)	NCBI
Rnor_5.0	12	31,961,818 - 31,970,830 (-)	NCBI
RGSC_v3.4	12	27,564,093 - 27,573,372 (-)	RGD
Celera	12	28,237,507 - 28,246,407 (-)	RGD

Sequence:

show sequence

CACGACATCCTAACTGTCCGCAGGCCCTCGGCGTCTAGCGCCCGCCGGCGGCTCCTCTCGTCAT
GTCAGGCACTGCTTGACTTTAGTTCTTCAGGCCTCCGCCCACCCGCCTACCCGAAGCCGCGCCC
ACCGCCCAGAGCCAGAGGGATGGTGGTAGTCAACGGGCGGGAGCCAGACAGCCGTCACTCGGAC
GGTGCCATGTCCAGCTCCGAAGCCGAAGACGACTTCCTGGAGCCGGCTACTCCTACGGCCACGC
AAGCGGGGCACGGGCTGCCCCTGCTGCCCCAGGAGTTTCCTGAGGTCGTCCCCCTTAACATCGG
AGGGGCTCACTTTACCACTCGCCTGTCTACTCTGCGGCGCTATGAAGACACCATGCTGGCAGCC
ATGTTCAGCGGGCGGCATTACATCCCTACAGACTCGGAGGGTCGGTACTTCATCGACCGAGATG
GCACACACTTTGGAGATGTGCTGAATTTCCTGCGATCAGGGGACCTGCCACCCCGGGAGCACGT
GCGAGCTGTGCACAAAGAGGCCCAGTACTACGCCATTGGGCCCCTCCTGGAGCAGCTGGAGAAC
ATGCAGCCACTGAAGGGCGAGAAGGTGCGCCAGGCCTTCCTGGGGCTCATGCCCTATTACAAAG
ACCATTTGGAGCGGATCGTGGAGATTGCCCGGCTTCGCGCAGTACAGCGGAAGGCCCGCTTTGC
CAAGCTCAAAGTCTGCGTCTTCAAGGAAGAGATGCCCATCACCCCCTATGAGTGTCCACTCCTT
AACTCCCTCCGCTTTGAGCGGAGTGAGAGTGACGGACAGCTCTTTGAGCACCACTGTGAAGTGG
ACGTGTCTTTTGGGCCCTGGGAGGCAGTGGCTGACGTGTACGACCTCTTGCACTGCCTGGTCAC
GGACCTCTCAGCCCAGGGCCTCACGGTGGACCACCAGTGTATCGGAGTGTGTGACAAGCACCTT
GTCAACCACTACTACTGCAAACGCCCCATCTATGAGTTCAAAATCACATGGTGGTGAATTGTCC
TGGGAAACAAGAATCCCACAAAGGAGGATGTCCATCCTCTTGGGTGACTCTGGGAGTCTGATCC
CCACAGGGGCTGCTGACTGTCCCAGAAGCTGCTGAGGTGAGGACAGAGCGCTGAGGCGCAGATG
TGGAAAGAGGCCTGGGTGCTGCTGTAGTCTCCTGTTCGTGTACCTTGGGGACTTGGTCTGCTCT
CATCTGGTCTTCTCAAGGCCTGGCCGTCTTCACTGGAAGCCACAAGATGTAGCAAGATTGGCAC
TGGGAGTCCAGAGAGCTTTTGATAACCTTTTTTTGATGCACTGCAGGAGAGCTCGTGCCCGCCC
CTGACAGAGGGAGATATCACTGCCTCGAACCTTCCTGTGCTCAGTGTGTCAGGTGGGATAAGGA
GTGAGGTGGGGGATTTCCCCGAGCATCTGCCCTATAACCCTGGCCAAAGAAGAAAGCATACTTC
TCCTCAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XR_005491672

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	32,157,141 - 32,168,463 (-)	NCBI
mRatBN7.2	12	26,520,969 - 26,532,327 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001121666	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI62055	(Get FASTA)	NCBI Sequence Viewer
	B1WC97	(Get FASTA)	NCBI Sequence Viewer
	EDM13466	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001198.3
	ENSRNOP00000083749.1
	ENSRNOP00055000330
	ENSRNOP00060014267
	ENSRNOP00065001507

RefSeq Acc Id:

NP_001121666 ⟸ NM_001128194

- UniProtKB:

B1WC97 (UniProtKB/Swiss-Prot), A0A8I6G9F0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVVVNGREPDSRHSDGAMSSSEAEDDFLEPATPTATQAGHGLPLLPQEFPEVVPLNIGGAHFTT
RLSTLRRYEDTMLAAMFSGRHYIPTDSEGRYFIDRDGTHFGDVLNFLRSGDLPPREHVRAVHKE
AQYYAIGPLLEQLENMQPLKGEKVRQAFLGLMPYYKDHLERIVEIARLRAVQRKARFAKLKVCV
FKEEMPITPYECPLLNSLRFERSESDGQLFEHHCEVDVSFGPWEAVADVYDLLHCLVTDLSAQG
LTVDHQCIGVCDKHLVNHYYCKRPIYEFKITWW

hide sequence

Ensembl Acc Id:

ENSRNOP00000001198 ⟸ ENSRNOT00000001198

Ensembl Acc Id:

ENSRNOP00000083749 ⟸ ENSRNOT00000104418

Protein Domains

BTB

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1WC97-F1-model_v2	AlphaFold	B1WC97	1-289	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698577

Promoter ID:

EPDNEW_R9102

Type:

initiation region

Name:

Kctd7_1

Description:

potassium channel tetramerization domain containing 7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	30,033,414 - 30,033,474	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1582914	AgrOrtholog
BioCyc Gene	G2FUF-19525	BioCyc
Ensembl Genes	ENSRNOG00000042384	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055000279	UniProtKB/Swiss-Prot
	ENSRNOG00060010811	UniProtKB/Swiss-Prot
	ENSRNOG00065001608	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000001198.5	UniProtKB/Swiss-Prot
	ENSRNOT00000104418.1	UniProtKB/TrEMBL
	ENSRNOT00055000467	UniProtKB/Swiss-Prot
	ENSRNOT00060018307	UniProtKB/Swiss-Prot
	ENSRNOT00065002158	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7114289	IMAGE-MGC_LOAD
InterPro	BTB/POZ_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SKP1/BTB/POZ_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	T1-type_BTB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:688993	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:188043	IMAGE-MGC_LOAD
NCBI Gene	688993	ENTREZGENE
PANTHER	BTB/POZ DOMAIN-CONTAINING PROTEIN KCTD7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POTASSIUM CHANNEL TETRAMERIZATION DOMAIN-CONTAINING	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	BTB_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Kctd7	PhenoGen
RatGTEx	ENSRNOG00000042384	RatGTEx
	ENSRNOG00055000279	RatGTEx
	ENSRNOG00060010811	RatGTEx
	ENSRNOG00065001608	RatGTEx
SMART	BTB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54695	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6G9F0	ENTREZGENE, UniProtKB/TrEMBL
	B1WC97	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-07-09	Kctd7	potassium channel tetramerization domain containing 7	Kctd7	potassium channel tetramerisation domain containing 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-07-09	Kctd7	potassium channel tetramerisation domain containing 7	LOC687365	similar to potassium channel tetramerisation domain containing 7	Data merged from RGD:1586532	737654	APPROVED
2008-03-06	Kctd7	potassium channel tetramerisation domain containing 7	LOC688993	similar to potassium channel tetramerisation domain containing 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC687365	similar to potassium channel tetramerisation domain containing 7			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC688993	similar to potassium channel tetramerisation domain containing 7			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM