Symbol:
E2f1 (Ensembl: Necab3)
Name:
E2F transcription factor 1 (Ensembl:N-terminal EF-hand calcium binding protein 3)
RGD ID:
728892
Description:
Enables protein kinase binding activity and sequence-specific DNA binding activity. Involved in several processes, including cellular response to hypoxia; cellular response to nerve growth factor stimulus; and positive regulation of glial cell proliferation. Located in nuclear chromosome. Biomarker of Huntington's disease and pancreatic cancer. Human ortholog(s) of this gene implicated in lung carcinoma (multiple); osteosarcoma; and pancreatic adenocarcinoma (multiple). Orthologous to human E2F1 (E2F transcription factor 1); PARTICIPATES IN cell cycle pathway, mitotic; ceramide signaling pathway; chronic myeloid leukemia pathway; INTERACTS WITH (-)-citrinin; (-)-epigallocatechin 3-gallate; 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
E2F-1; transcription factor E2F1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
E2F1 (E2F transcription factor 1)
HGNC
EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
E2f1 (E2F transcription factor 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
E2f1 (E2F transcription factor 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
E2F1 (E2F transcription factor 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
E2F1 (E2F transcription factor 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
E2f1 (E2F transcription factor 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
E2F1 (E2F transcription factor 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
E2F1 (E2F transcription factor 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
E2f1 (E2F transcription factor 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NECAB3 (N-terminal EF-hand calcium binding protein 3)
HGNC
EggNOG, Inparanoid, OrthoDB, Treefam
Homo sapiens (human):
KIF20A (kinesin family member 20A)
HGNC
OMA
Homo sapiens (human):
MAGEA4 (MAGE family member A4)
HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
E2F1 (E2F transcription factor 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
E2f1 (E2F transcription factor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
e2f1 (E2F transcription factor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
E2f1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
e2f1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Is Marker For:
Strains:
SD
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 163,524,739 - 163,535,563 (-) NCBI GRCr8 mRatBN7.2 3 143,064,535 - 143,075,362 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 143,049,478 - 143,075,361 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 146,931,136 - 146,941,990 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 155,549,300 - 155,560,154 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 153,288,668 - 153,299,512 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 150,062,895 - 150,073,721 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 150,047,826 - 150,073,721 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 156,435,530 - 156,446,390 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 145,032,489 - 145,043,729 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 144,943,133 - 144,943,246 (-) NCBI Celera 3 141,799,009 - 141,809,945 (-) NCBI Celera Cytogenetic Map 3 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
E2f1 Rat (-)-citrinin increases expression EXP 6480464 Citrinin results in increased expression of E2F1 mRNA CTD PMID:23856526 E2f1 Rat (-)-epigallocatechin 3-gallate affects methylation EXP 6480464 epigallocatechin gallate affects the methylation of E2F1 gene CTD PMID:29381301 E2f1 Rat (1->4)-beta-D-glucan multiple interactions ISO E2f1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of E2F1 mRNA CTD PMID:36331819 E2f1 Rat (25R)-cholest-5-ene-3beta,26-diol increases expression ISO E2F1 (Homo sapiens) 6480464 27-hydroxycholesterol results in increased expression of E2F1 mRNA CTD PMID:17872378 E2f1 Rat (S)-colchicine decreases expression ISO E2F1 (Homo sapiens) 6480464 Colchicine results in decreased expression of E2F1 mRNA CTD PMID:24211769 E2f1 Rat (S)-naringenin multiple interactions ISO E2F1 (Homo sapiens) 6480464 [naringenin co-treated with bisphenol A] results in increased expression of E2F1 mRNA and [naringenin metabolite co-treated with bisphenol A] results in increased expression of E2F1 mRNA CTD PMID:36235125 E2f1 Rat (S)-nicotine increases expression ISO E2F1 (Homo sapiens) 6480464 Nicotine results in increased expression of E2F1 protein CTD PMID:20061081 E2f1 Rat (S)-nicotine multiple interactions ISO E2F1 (Homo sapiens) 6480464 MK-886 inhibits the reaction [Nicotine results in increased expression of E2F1 protein] more ... CTD PMID:16601104 more ... E2f1 Rat 1,2-dimethylhydrazine increases expression ISO E2f1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of E2F1 mRNA CTD PMID:22206623 E2f1 Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile decreases expression EXP 6480464 Citalopram results in decreased expression of E2F1 mRNA CTD PMID:28467792 E2f1 Rat 1-chloro-2,4-dinitrobenzene affects expression ISO E2f1 (Mus musculus) 6480464 Dinitrochlorobenzene affects the expression of E2F1 mRNA CTD PMID:22302311 E2f1 Rat 1-methyltryptophan multiple interactions ISO E2F1 (Homo sapiens) 6480464 1-methyltryptophan inhibits the reaction [indeno(1 more ... CTD PMID:35687267 E2f1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of E2F1 mRNA CTD PMID:30723492 E2f1 Rat 17alpha-ethynylestradiol multiple interactions ISO E2f1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of E2F1 mRNA CTD PMID:17942748 E2f1 Rat 17alpha-ethynylestradiol increases expression ISO E2f1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of E2F1 mRNA CTD PMID:14976129 and PMID:17942748 E2f1 Rat 17beta-estradiol increases expression ISO E2f1 (Mus musculus) 6480464 Estradiol results in increased expression of E2F1 mRNA and Estradiol results in increased expression of E2F1 protein CTD PMID:23684557 and PMID:25210133 E2f1 Rat 17beta-estradiol decreases expression ISO E2f1 (Mus musculus) 6480464 Estradiol results in decreased expression of E2F1 mRNA CTD PMID:39298647 E2f1 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of E2F1 mRNA CTD PMID:32145629 E2f1 Rat 17beta-estradiol affects expression ISO E2F1 (Homo sapiens) 6480464 Estradiol affects the expression of E2F1 protein CTD PMID:28880708 E2f1 Rat 17beta-estradiol increases activity ISO E2F1 (Homo sapiens) 6480464 Estradiol results in increased activity of E2F1 protein CTD PMID:27592001 E2f1 Rat 17beta-estradiol increases expression ISO E2F1 (Homo sapiens) 6480464 Estradiol results in increased expression of E2F1 mRNA and Estradiol results in increased expression of E2F1 protein CTD PMID:14702633 more ... E2f1 Rat 17beta-estradiol affects expression ISO E2f1 (Mus musculus) 6480464 Estradiol affects the expression of E2F1 mRNA CTD PMID:15598610 E2f1 Rat 17beta-estradiol multiple interactions ISO E2F1 (Homo sapiens) 6480464 1 more ... CTD PMID:14702633 and PMID:28880708 E2f1 Rat 17beta-estradiol multiple interactions ISO E2f1 (Mus musculus) 6480464 ESR1 protein promotes the reaction [Estradiol results in increased expression of E2F1 mRNA] CTD PMID:25210133 E2f1 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO E2F1 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of E2F1 mRNA and Dihydrotestosterone results in increased expression of E2F1 protein CTD PMID:15647840 E2f1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO E2F1 (Homo sapiens) 6480464 2 more ... CTD PMID:26988655 and PMID:30796839 E2f1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO E2f1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of E2F1 mRNA CTD PMID:21570461 and PMID:24058054 E2f1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO E2F1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of E2F1 mRNA and Tetrachlorodibenzodioxin results in decreased expression of E2F1 protein CTD PMID:15056799 and PMID:21802500 E2f1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO E2f1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of E2F1 mRNA CTD PMID:15667827 E2f1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO E2f1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of E2F1 mRNA CTD PMID:17942748 E2f1 Rat 2-acetamidofluorene decreases expression EXP 6480464 2-Acetylaminofluorene results in decreased expression of E2F1 protein CTD PMID:15158336 E2f1 Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of E2F1 mRNA CTD PMID:19167416 and PMID:22213190 E2f1 Rat 26-hydroxycholesterol increases expression ISO E2F1 (Homo sapiens) 6480464 27-hydroxycholesterol results in increased expression of E2F1 mRNA CTD PMID:17872378 E2f1 Rat 3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid multiple interactions ISO E2F1 (Homo sapiens) 6480464 MK-886 inhibits the reaction [Nicotine results in increased expression of E2F1 protein] CTD PMID:20061081 E2f1 Rat 3-aminobenzamide multiple interactions ISO E2F1 (Homo sapiens) 6480464 3-aminobenzamide promotes the reaction [RB1 protein binds to E2F1 protein] CTD PMID:15670817 E2f1 Rat 4,4'-sulfonyldiphenol increases expression ISO E2F1 (Homo sapiens) 6480464 bisphenol S results in increased expression of E2F1 mRNA CTD PMID:30684532 E2f1 Rat 4,4'-sulfonyldiphenol decreases expression ISO E2f1 (Mus musculus) 6480464 bisphenol S results in decreased expression of E2F1 mRNA CTD PMID:39298647 E2f1 Rat 4-hydroperoxycyclophosphamide increases expression ISO E2f1 (Mus musculus) 6480464 perfosfamide results in increased expression of E2F1 mRNA CTD PMID:19429390 E2f1 Rat 4-hydroxynon-2-enal decreases expression ISO E2F1 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of E2F1 mRNA CTD PMID:12419474 E2f1 Rat 4-hydroxyphenyl retinamide decreases expression ISO E2f1 (Mus musculus) 6480464 Fenretinide results in decreased expression of E2F1 mRNA CTD PMID:28973697 E2f1 Rat 5-aza-2'-deoxycytidine increases expression ISO E2f1 (Mus musculus) 6480464 Decitabine results in increased expression of E2F1 mRNA CTD PMID:27915011 E2f1 Rat 5-azacytidine multiple interactions ISO E2F1 (Homo sapiens) 6480464 E2F1 protein affects the reaction [Azacitidine results in decreased activity of TERT protein] and E2F1 protein affects the reaction [Azacitidine results in decreased expression of TERT mRNA] CTD PMID:19451745 E2f1 Rat 5-fluorouracil decreases expression ISO E2F1 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of E2F1 mRNA CTD PMID:34151400 E2f1 Rat 5-nitroso-8-quinolinol multiple interactions ISO E2F1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [5-nitroso-8-quinolinol results in decreased expression of E2F1 protein] CTD PMID:16497787 E2f1 Rat 5-nitroso-8-quinolinol decreases expression ISO E2F1 (Homo sapiens) 6480464 5-nitroso-8-quinolinol results in decreased expression of E2F1 protein CTD PMID:16497787 E2f1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of E2F1 mRNA CTD PMID:24780913 and PMID:30047161 E2f1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of E2F1 mRNA CTD PMID:25825206 E2f1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of E2F1 mRNA CTD PMID:31881176 E2f1 Rat acetylsalicylic acid multiple interactions ISO E2F1 (Homo sapiens) 6480464 [troglitazone co-treated with Aspirin] results in decreased expression of E2F1 protein and Aspirin inhibits the reaction [E2F1 protein binds to BIRC5 promoter] CTD PMID:17848598 and PMID:19908241 E2f1 Rat acetylsalicylic acid decreases expression ISO E2F1 (Homo sapiens) 6480464 Aspirin results in decreased expression of E2F1 mRNA CTD PMID:20457246 E2f1 Rat acrylamide decreases expression ISO E2F1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of E2F1 mRNA CTD PMID:32763439 E2f1 Rat acteoside multiple interactions ISO E2F1 (Homo sapiens) 6480464 [acteoside results in decreased phosphorylation of RB1 protein] promotes the reaction [RB1 protein binds to E2F1 protein] CTD PMID:17634406 E2f1 Rat adenine decreases expression ISO E2F1 (Homo sapiens) 6480464 Adenine results in decreased expression of E2F1 mRNA CTD PMID:24211769 E2f1 Rat adenosine affects expression EXP 6480464 Adenosine affects the expression of E2F1 protein CTD PMID:19638569 E2f1 Rat aflatoxin B1 increases expression ISO E2F1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of E2F1 mRNA CTD PMID:15120964 E2f1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of E2F1 mRNA CTD PMID:23630614 and PMID:25378103 E2f1 Rat all-trans-4-oxoretinoic acid decreases expression ISO E2F1 (Homo sapiens) 6480464 4-oxoretinoic acid results in decreased expression of E2F1 mRNA CTD PMID:15982314 E2f1 Rat all-trans-retinoic acid multiple interactions ISO E2F1 (Homo sapiens) 6480464 Tretinoin inhibits the reaction [Benzo(a)pyrene results in increased expression of E2F1 protein] CTD PMID:16406622 E2f1 Rat all-trans-retinoic acid increases expression ISO E2F1 (Homo sapiens) 6480464 Tretinoin results in increased expression of E2F1 mRNA CTD PMID:17218384 E2f1 Rat all-trans-retinoic acid decreases expression ISO E2F1 (Homo sapiens) 6480464 Tretinoin metabolite results in decreased expression of E2F1 mRNA more ... CTD PMID:12042460 more ... E2f1 Rat alpha-hexylcinnamaldehyde affects expression ISO E2f1 (Mus musculus) 6480464 hexyl cinnamic aldehyde affects the expression of E2F1 mRNA CTD PMID:22302311 E2f1 Rat alvocidib increases expression ISO E2F1 (Homo sapiens) 6480464 alvocidib results in increased expression of E2F1 protein CTD PMID:12533675 E2f1 Rat alvocidib increases response to substance ISO E2f1 (Mus musculus) 6480464 E2F1 results in increased susceptibility to alvocidib CTD PMID:12533675 E2f1 Rat alvocidib increases response to substance ISO E2F1 (Homo sapiens) 6480464 E2F1 results in increased susceptibility to alvocidib CTD PMID:12533675 E2f1 Rat alvocidib decreases expression ISO E2F1 (Homo sapiens) 6480464 alvocidib results in decreased expression of E2F1 mRNA CTD PMID:21239698 E2f1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of E2F1 mRNA CTD PMID:30047161 E2f1 Rat ammonium chloride increases expression EXP 6480464 Ammonium Chloride results in increased expression of E2F1 protein CTD PMID:16483693 E2f1 Rat amodiaquine affects expression ISO E2F1 (Homo sapiens) 6480464 Amodiaquine affects the expression of E2F1 mRNA and Amodiaquine affects the expression of E2F1 protein CTD PMID:24113242 E2f1 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of E2F1 mRNA CTD PMID:30779732 E2f1 Rat amphibole asbestos decreases expression ISO E2F1 (Homo sapiens) 6480464 Asbestos and Amphibole results in decreased expression of E2F1 protein CTD PMID:20855422 E2f1 Rat androstane multiple interactions ISO E2f1 (Mus musculus) 6480464 Androstanols inhibits the reaction [1 more ... CTD PMID:26171734 E2f1 Rat aristolochic acid A increases expression ISO E2F1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of E2F1 mRNA CTD PMID:33212167 E2f1 Rat arsane decreases expression ISO E2F1 (Homo sapiens) 6480464 Arsenic results in decreased expression of E2F1 mRNA CTD PMID:19945496 E2f1 Rat arsane multiple interactions ISO E2F1 (Homo sapiens) 6480464 E2F1 protein affects the reaction [Arsenic results in increased expression of AURKA protein] CTD PMID:23174854 E2f1 Rat arsane increases expression ISO E2F1 (Homo sapiens) 6480464 Arsenic results in increased expression of E2F1 protein CTD PMID:23174854 E2f1 Rat arsenic atom decreases expression ISO E2F1 (Homo sapiens) 6480464 Arsenic results in decreased expression of E2F1 mRNA CTD PMID:19945496 E2f1 Rat arsenic atom multiple interactions ISO E2F1 (Homo sapiens) 6480464 E2F1 protein affects the reaction [Arsenic results in increased expression of AURKA protein] CTD PMID:23174854 E2f1 Rat arsenic atom increases expression ISO E2F1 (Homo sapiens) 6480464 Arsenic results in increased expression of E2F1 protein CTD PMID:23174854 E2f1 Rat arsenous acid affects methylation ISO E2F1 (Homo sapiens) 6480464 Arsenic Trioxide affects the methylation of E2F1 promoter CTD PMID:26046465 E2f1 Rat arsenous acid multiple interactions ISO E2F1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [TP53 protein binds to E2F1 protein] more ... CTD PMID:34042274 E2f1 Rat arsenous acid increases expression ISO E2F1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of E2F1 mRNA CTD PMID:20016248 E2f1 Rat arsenous acid decreases expression ISO E2F1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of E2F1 protein CTD PMID:24691991 more ... E2f1 Rat aspartame multiple interactions ISO E2f1 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 E2f1 Rat Aspidin increases expression ISO E2F1 (Homo sapiens) 6480464 aspidin BB results in increased expression of E2F1 protein CTD PMID:23628508 E2f1 Rat atrazine decreases expression ISO E2F1 (Homo sapiens) 6480464 Atrazine results in decreased expression of E2F1 mRNA CTD PMID:22378314 E2f1 Rat atrazine multiple interactions ISO E2f1 (Mus musculus) 6480464 Melatonin inhibits the reaction [Atrazine results in increased expression of E2F1 protein] CTD PMID:25259610 E2f1 Rat atrazine increases expression ISO E2f1 (Mus musculus) 6480464 Atrazine results in increased expression of E2F1 protein CTD PMID:25259610 E2f1 Rat auraptene affects expression ISO E2F1 (Homo sapiens) 6480464 aurapten affects the expression of E2F1 mRNA CTD PMID:23320178 E2f1 Rat azoxystrobin decreases expression ISO E2F1 (Homo sapiens) 6480464 azoxystrobin results in decreased expression of E2F1 mRNA CTD PMID:33512557 E2f1 Rat benzo[a]pyrene affects activity ISO E2F1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the activity of E2F1 protein CTD PMID:20624995 E2f1 Rat benzo[a]pyrene increases methylation ISO E2F1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of E2F1 promoter CTD PMID:27901495 E2f1 Rat benzo[a]pyrene decreases expression ISO E2F1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of E2F1 mRNA and Benzo(a)pyrene results in decreased expression of E2F1 protein CTD PMID:20064835 and PMID:21802500 E2f1 Rat benzo[a]pyrene increases expression ISO E2F1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of E2F1 mRNA and Benzo(a)pyrene results in increased expression of E2F1 protein CTD PMID:16406622 and PMID:32234424 E2f1 Rat benzo[a]pyrene multiple interactions ISO E2F1 (Homo sapiens) 6480464 CCND1 protein promotes the reaction [Benzo(a)pyrene results in increased expression of E2F1 protein] more ... CTD PMID:16406622 E2f1 Rat benzo[a]pyrene diol epoxide I increases expression ISO E2F1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 E2f1 Rat benzo[d]isothiazol-3-one multiple interactions ISO E2F1 (Homo sapiens) 6480464 1 more ... CTD PMID:14702633 E2f1 Rat benzophenanthridine decreases expression ISO E2F1 (Homo sapiens) 6480464 Benzophenanthridines analog results in decreased expression of E2F1 mRNA CTD PMID:23117580 E2f1 Rat biotin increases expression ISO E2f1 (Mus musculus) 6480464 Biotin results in increased expression of E2F1 mRNA CTD PMID:34699867 E2f1 Rat bis(2-chloroethyl) sulfide increases expression ISO E2f1 (Mus musculus) 6480464 Mustard Gas results in increased expression of E2F1 mRNA CTD PMID:18955075 E2f1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of E2F1 mRNA CTD PMID:25181051 and PMID:34947998 E2f1 Rat bisphenol A multiple interactions ISO E2F1 (Homo sapiens) 6480464 [naringenin co-treated with bisphenol A] results in increased expression of E2F1 mRNA and [naringenin metabolite co-treated with bisphenol A] results in increased expression of E2F1 mRNA CTD PMID:36235125 E2f1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of E2F1 mRNA CTD PMID:32145629 E2f1 Rat bisphenol A affects expression ISO E2F1 (Homo sapiens) 6480464 bisphenol A affects the expression of E2F1 mRNA CTD PMID:30903817 E2f1 Rat bisphenol A increases expression ISO E2F1 (Homo sapiens) 6480464 bisphenol A results in increased expression of E2F1 mRNA and bisphenol A results in increased expression of E2F1 protein CTD PMID:21277958 more ... E2f1 Rat bortezomib multiple interactions ISO E2F1 (Homo sapiens) 6480464 [BRCA1 mutant form results in increased susceptibility to Bortezomib] which results in increased activity of E2F1 protein CTD PMID:25522274 E2f1 Rat Butylparaben affects expression ISO E2F1 (Homo sapiens) 6480464 butylparaben affects the expression of E2F1 mRNA CTD PMID:24481588 E2f1 Rat cadmium acetate decreases activity ISO E2F1 (Homo sapiens) 6480464 cadmium acetate results in decreased activity of E2F1 protein CTD PMID:20839231 E2f1 Rat cadmium acetate multiple interactions ISO E2F1 (Homo sapiens) 6480464 cadmium acetate promotes the reaction [RB1 protein modified form binds to E2F1 protein] CTD PMID:20839231 E2f1 Rat cadmium acetate decreases expression ISO E2F1 (Homo sapiens) 6480464 cadmium acetate results in decreased expression of E2F1 mRNA CTD PMID:18155341 and PMID:20839231 E2f1 Rat cadmium acetate affects localization ISO E2F1 (Homo sapiens) 6480464 cadmium acetate affects the localization of E2F1 protein CTD PMID:20839231 E2f1 Rat cadmium atom decreases expression ISO E2F1 (Homo sapiens) 6480464 Cadmium results in decreased expression of E2F1 mRNA CTD PMID:20839231 E2f1 Rat cadmium atom affects methylation EXP 6480464 Cadmium affects the methylation of E2F1 gene CTD PMID:29381301 E2f1 Rat cadmium dichloride multiple interactions ISO E2f1 (Mus musculus) 6480464 Cadmium Chloride inhibits the reaction [SP1 protein binds to SP3 protein binds to KLF4 protein binds to E2F1 protein binds to NECTIN2 promoter] CTD PMID:25046863 E2f1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of E2F1 mRNA CTD PMID:35525383 E2f1 Rat cadmium dichloride multiple interactions ISO E2F1 (Homo sapiens) 6480464 MEG3 mRNA inhibits the reaction [Cadmium Chloride results in increased expression of E2F1 protein] CTD PMID:34520792 E2f1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of E2F1 mRNA and Cadmium Chloride results in decreased expression of E2F1 protein CTD PMID:33865896 E2f1 Rat cadmium dichloride increases expression ISO E2F1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of E2F1 mRNA and Cadmium Chloride results in increased expression of E2F1 protein CTD PMID:27510461 more ... E2f1 Rat caffeine multiple interactions ISO E2f1 (Mus musculus) 6480464 Caffeine inhibits the reaction [Camptothecin results in increased expression of E2F1 mRNA] CTD PMID:22403396 E2f1 Rat calcitriol multiple interactions ISO E2F1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of E2F1 mRNA more ... CTD PMID:21592394 E2f1 Rat calcitriol decreases expression ISO E2F1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of E2F1 mRNA CTD PMID:21592394 E2f1 Rat camptothecin multiple interactions ISO E2f1 (Mus musculus) 6480464 7-hydroxystaurosporine inhibits the reaction [Camptothecin results in increased expression of E2F1 mRNA] more ... CTD PMID:22403396 E2f1 Rat camptothecin increases expression ISO E2f1 (Mus musculus) 6480464 Camptothecin results in increased expression of E2F1 mRNA CTD PMID:22403396 E2f1 Rat cannabidiol multiple interactions ISO E2F1 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of E2F1 mRNA CTD PMID:32992648 E2f1 Rat cannabidiol increases expression ISO E2F1 (Homo sapiens) 6480464 Cannabidiol results in increased expression of E2F1 mRNA CTD PMID:27714895 and PMID:27918106 E2f1 Rat cannabidiol decreases expression ISO E2F1 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of E2F1 mRNA CTD PMID:33244087 and PMID:36519830 E2f1 Rat capsaicin increases expression ISO E2F1 (Homo sapiens) 6480464 Capsaicin results in increased expression of E2F1 mRNA CTD PMID:19502594 E2f1 Rat carbamazepine affects expression ISO E2F1 (Homo sapiens) 6480464 Carbamazepine affects the expression of E2F1 mRNA CTD PMID:24752500 E2f1 Rat carbon nanotube affects expression ISO E2f1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 E2f1 Rat carbon nanotube decreases expression ISO E2f1 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of E2F1 mRNA CTD PMID:25620056 E2f1 Rat Cardanol increases expression ISO E2F1 (Homo sapiens) 6480464 cardanol results in increased expression of E2F1 mRNA CTD PMID:26694491 E2f1 Rat carmustine increases expression ISO E2F1 (Homo sapiens) 6480464 Carmustine results in increased expression of E2F1 protein CTD PMID:18632648 E2f1 Rat chlorpromazine decreases expression ISO E2F1 (Homo sapiens) 6480464 Chlorpromazine analog results in decreased expression of E2F1 mRNA CTD PMID:15924885 E2f1 Rat chlorpyrifos decreases expression ISO E2f1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of E2F1 mRNA CTD PMID:32715474 E2f1 Rat choline increases expression ISO E2f1 (Mus musculus) 6480464 Choline results in increased expression of E2F1 mRNA CTD PMID:16014740 E2f1 Rat choline multiple interactions ISO E2f1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of E2F1 gene CTD PMID:20938992 E2f1 Rat choline increases expression EXP 6480464 Choline results in increased expression of E2F1 mRNA CTD PMID:16014740 E2f1 Rat chromium(6+) multiple interactions ISO E2F1 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of E2F1 mRNA more ... CTD PMID:33677506 and PMID:38479592 E2f1 Rat cilostazol decreases expression ISO E2F1 (Homo sapiens) 6480464 cilostazol results in decreased expression of E2F1 protein CTD PMID:15723965 E2f1 Rat cisplatin increases expression ISO E2F1 (Homo sapiens) 6480464 Cisplatin results in increased expression of E2F1 mRNA CTD PMID:21603599 E2f1 Rat cisplatin decreases expression ISO E2F1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of E2F1 mRNA CTD PMID:24211769 E2f1 Rat cisplatin increases acetylation ISO E2F1 (Homo sapiens) 6480464 Cisplatin results in increased acetylation of E2F1 protein CTD PMID:21157427 E2f1 Rat citalopram decreases expression EXP 6480464 Citalopram results in decreased expression of E2F1 mRNA CTD PMID:28467792 E2f1 Rat cobalt atom multiple interactions EXP 6480464 [Nickel co-treated with Cobalt co-treated with Tungsten] results in decreased expression of E2F1 mRNA CTD PMID:22198552 E2f1 Rat copper atom multiple interactions ISO E2F1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of E2F1 mRNA more ... CTD PMID:20971185 more ... E2f1 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of E2F1 mRNA CTD PMID:17418555 E2f1 Rat copper(0) multiple interactions ISO E2F1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of E2F1 mRNA more ... CTD PMID:20971185 more ... E2f1 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of E2F1 mRNA CTD PMID:17418555 E2f1 Rat copper(II) chloride increases expression ISO E2F1 (Homo sapiens) 6480464 cupric chloride results in increased expression of E2F1 mRNA CTD PMID:38568856 E2f1 Rat copper(II) sulfate decreases expression ISO E2F1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of E2F1 mRNA CTD PMID:19549813 E2f1 Rat cordycepin multiple interactions ISO E2f1 (Mus musculus) 6480464 cordycepin inhibits the reaction [FGF9 protein results in increased expression of E2F1 protein] CTD PMID:33172093 E2f1 Rat coumestrol multiple interactions ISO E2F1 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of E2F1 mRNA CTD PMID:19167446 E2f1 Rat CU-O LINKAGE increases expression ISO E2F1 (Homo sapiens) 6480464 cupric oxide results in increased expression of E2F1 mRNA CTD PMID:32285662 E2f1 Rat curcumin decreases expression EXP 6480464 Curcumin results in decreased expression of E2F1 mRNA CTD PMID:18299980 E2f1 Rat DDT increases expression ISO E2f1 (Mus musculus) 6480464 DDT results in increased expression of E2F1 mRNA and DDT results in increased expression of E2F1 protein CTD PMID:23684557 E2f1 Rat DDT multiple interactions ISO E2f1 (Mus musculus) 6480464 fulvestrant inhibits the reaction [DDT results in increased expression of E2F1 mRNA] CTD PMID:23684557 E2f1 Rat deguelin decreases expression ISO E2F1 (Homo sapiens) 6480464 deguelin results in decreased expression of E2F1 mRNA CTD PMID:33512557 E2f1 Rat diarsenic trioxide affects methylation ISO E2F1 (Homo sapiens) 6480464 Arsenic Trioxide affects the methylation of E2F1 promoter CTD PMID:26046465 E2f1 Rat diarsenic trioxide multiple interactions ISO E2F1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [TP53 protein binds to E2F1 protein] more ... CTD PMID:34042274 E2f1 Rat diarsenic trioxide increases expression ISO E2F1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of E2F1 mRNA CTD PMID:20016248 E2f1 Rat diarsenic trioxide decreases expression ISO E2F1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of E2F1 protein CTD PMID:24691991 more ... E2f1 Rat dibenzo[a,l]pyrene increases expression ISO E2F1 (Homo sapiens) 6480464 dibenzo(a and l)pyrene results in increased expression of E2F1 mRNA CTD PMID:16269432 E2f1 Rat Dibutyl phosphate affects expression ISO E2F1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of E2F1 mRNA CTD PMID:37042841 E2f1 Rat diclofenac affects expression ISO E2F1 (Homo sapiens) 6480464 Diclofenac affects the expression of E2F1 mRNA CTD PMID:24752500 E2f1 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of E2F1 mRNA CTD PMID:22546817 E2f1 Rat dieldrin increases expression EXP 6480464 Dieldrin results in increased expression of E2F1 mRNA CTD PMID:23153324 E2f1 Rat diethanolamine increases expression ISO E2f1 (Mus musculus) 6480464 diethanolamine results in increased expression of E2F1 mRNA CTD PMID:16014740 E2f1 Rat diethanolamine increases expression EXP 6480464 diethanolamine results in increased expression of E2F1 mRNA CTD PMID:16014740 E2f1 Rat dihydroxyacetone increases expression ISO E2F1 (Homo sapiens) 6480464 Dihydroxyacetone results in increased expression of E2F1 mRNA CTD PMID:32506039 E2f1 Rat dioxygen decreases expression ISO E2F1 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of E2F1 mRNA CTD PMID:26516004 E2f1 Rat dioxygen multiple interactions ISO E2F1 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of E2F1 mRNA and [Oxygen co-treated with Ozone] results in decreased expression of E2F1 mRNA CTD PMID:32992648 E2f1 Rat doxorubicin affects response to substance ISO E2F1 (Homo sapiens) 6480464 E2F1 protein affects the susceptibility to Doxorubicin CTD PMID:25124555 E2f1 Rat doxorubicin increases expression ISO E2F1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of E2F1 protein CTD PMID:22751436 E2f1 Rat doxorubicin decreases expression ISO E2F1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of E2F1 mRNA and Doxorubicin results in decreased expression of E2F1 protein CTD PMID:24816189 E2f1 Rat doxorubicin multiple interactions ISO E2F1 (Homo sapiens) 6480464 Doxorubicin inhibits the reaction [[RBBP8 protein binds to BRCA1 protein binds to E2F1 protein] which results in increased expression of ATM mRNA] more ... CTD PMID:22751436 more ... E2f1 Rat doxorubicin affects expression ISO E2F1 (Homo sapiens) 6480464 Doxorubicin affects the expression of E2F1 protein CTD PMID:25124555 E2f1 Rat elemental selenium increases expression ISO E2F1 (Homo sapiens) 6480464 Selenium results in increased expression of E2F1 mRNA CTD PMID:19244175 E2f1 Rat endosulfan decreases expression ISO E2F1 (Homo sapiens) 6480464 Endosulfan results in decreased expression of E2F1 mRNA CTD PMID:30090376 E2f1 Rat escitalopram decreases expression EXP 6480464 Escitalopram results in decreased expression of E2F1 mRNA CTD PMID:28467792 E2f1 Rat etoposide multiple interactions ISO E2F1 (Homo sapiens) 6480464 E2F1 protein affects the reaction [Etoposide results in increased expression of HIC1 mRNA] and Etoposide promotes the reaction [E2F1 protein binds to HIC1 promoter] CTD PMID:19491197 E2f1 Rat eugenol decreases expression ISO E2F1 (Homo sapiens) 6480464 Eugenol results in decreased expression of E2F1 mRNA and Eugenol results in decreased expression of E2F1 protein CTD PMID:15574415 E2f1 Rat folic acid multiple interactions ISO E2f1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of E2F1 gene CTD PMID:20938992 E2f1 Rat FR900359 decreases phosphorylation ISO E2F1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of E2F1 protein CTD PMID:37730182 E2f1 Rat fulvestrant decreases expression ISO E2F1 (Homo sapiens) 6480464 fulvestrant results in decreased expression of E2F1 mRNA CTD PMID:20215421 E2f1 Rat fulvestrant multiple interactions ISO E2f1 (Mus musculus) 6480464 fulvestrant inhibits the reaction [DDT results in increased expression of E2F1 mRNA] CTD PMID:23684557 E2f1 Rat furan increases expression EXP 6480464 furan results in increased expression of E2F1 mRNA CTD PMID:20562052 and PMID:22079235 E2f1 Rat gamma-tocopherol increases expression ISO E2F1 (Homo sapiens) 6480464 Tocopherols results in increased expression of E2F1 protein CTD PMID:15883045 E2f1 Rat gefitinib decreases expression ISO E2F1 (Homo sapiens) 6480464 gefitinib results in decreased expression of E2F1 mRNA and gefitinib results in decreased expression of E2F1 protein CTD PMID:17094457 and PMID:18347146 E2f1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of E2F1 mRNA CTD PMID:33387578 E2f1 Rat geraniol decreases expression ISO E2F1 (Homo sapiens) 6480464 geraniol results in decreased expression of E2F1 mRNA CTD PMID:27683099 E2f1 Rat glyphosate decreases expression ISO E2F1 (Homo sapiens) 6480464 Glyphosate results in decreased expression of E2F1 mRNA CTD PMID:31295307 E2f1 Rat GSK-J4 decreases expression ISO E2F1 (Homo sapiens) 6480464 GSK-J4 results in decreased expression of E2F1 mRNA CTD PMID:29301935 E2f1 Rat GW 3965 decreases expression ISO E2F1 (Homo sapiens) 6480464 GW 3965 results in decreased expression of E2F1 mRNA CTD PMID:31437187 E2f1 Rat harmine increases expression ISO E2F1 (Homo sapiens) 6480464 Harmine results in increased expression of E2F1 mRNA and Harmine results in increased expression of E2F1 protein CTD PMID:25751815 E2f1 Rat heparin decreases expression ISO E2F1 (Homo sapiens) 6480464 Heparin analog results in decreased expression of E2F1 protein CTD PMID:20201787 E2f1 Rat hydroquinone multiple interactions ISO E2F1 (Homo sapiens) 6480464 MIR7-2 promotes the reaction [hydroquinone results in increased expression of E2F1 protein] CTD PMID:37951342 E2f1 Rat hydroquinone increases expression ISO E2F1 (Homo sapiens) 6480464 hydroquinone results in increased expression of E2F1 mRNA and hydroquinone results in increased expression of E2F1 protein CTD PMID:33932074 and PMID:37951342 E2f1 Rat hydroxyurea decreases expression ISO E2F1 (Homo sapiens) 6480464 Hydroxyurea results in decreased expression of E2F1 mRNA CTD PMID:24211769 E2f1 Rat Indeno[1,2,3-cd]pyrene multiple interactions ISO E2F1 (Homo sapiens) 6480464 1-methyltryptophan inhibits the reaction [indeno(1 more ... CTD PMID:35687267 E2f1 Rat Indeno[1,2,3-cd]pyrene increases expression ISO E2F1 (Homo sapiens) 6480464 indeno(1 more ... CTD PMID:35687267 E2f1 Rat indirubin decreases expression ISO E2F1 (Homo sapiens) 6480464 indirubin results in decreased expression of E2F1 mRNA CTD PMID:15056799 E2f1 Rat inulin multiple interactions ISO E2f1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of E2F1 mRNA CTD PMID:36331819 E2f1 Rat iron atom multiple interactions EXP 6480464 [Nickel co-treated with Iron co-treated with Tungsten] results in decreased expression of E2F1 mRNA CTD PMID:22198552 E2f1 Rat iron(0) multiple interactions EXP 6480464 [Nickel co-treated with Iron co-treated with Tungsten] results in decreased expression of E2F1 mRNA CTD PMID:22198552 E2f1 Rat L-methionine multiple interactions ISO E2f1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of E2F1 gene CTD PMID:20938992 E2f1 Rat Lasiocarpine multiple interactions ISO E2F1 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of lasiocarpine] which results in decreased expression of E2F1 mRNA CTD PMID:33884520 E2f1 Rat lead nitrate multiple interactions ISO E2F1 (Homo sapiens) 6480464 E2F1 protein inhibits the reaction [lead nitrate results in decreased expression of DNMT3A mRNA] more ... CTD PMID:24639330 E2f1 Rat leptomycin B decreases expression ISO E2F1 (Homo sapiens) 6480464 leptomycin B results in decreased expression of E2F1 mRNA CTD PMID:20803015 E2f1 Rat lidocaine affects expression ISO E2f1 (Mus musculus) 6480464 Lidocaine affects the expression of E2F1 mRNA CTD PMID:18931217 E2f1 Rat lipopolysaccharide multiple interactions ISO E2f1 (Mus musculus) 6480464 E2F1 protein promotes the reaction [Lipopolysaccharides results in increased expression of IL6 protein] more ... CTD PMID:21131441 and PMID:23107598 E2f1 Rat lipopolysaccharide increases response to substance ISO E2f1 (Mus musculus) 6480464 E2F1 protein results in increased susceptibility to Lipopolysaccharides CTD PMID:21131441 E2f1 Rat LY294002 multiple interactions ISO E2f1 (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Vanadates results in increased expression of E2F1 protein] CTD PMID:14971663 E2f1 Rat maneb multiple interactions ISO E2f1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of E2F1 mRNA and Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in increased expression of E2F1 mRNA] CTD PMID:23963992 E2f1 Rat melatonin multiple interactions ISO E2f1 (Mus musculus) 6480464 Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in increased expression of E2F1 mRNA] and Melatonin inhibits the reaction [Atrazine results in increased expression of E2F1 protein] CTD PMID:23963992 and PMID:25259610 E2f1 Rat menadione affects expression ISO E2F1 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of E2F1 mRNA CTD PMID:20044591 E2f1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of E2F1 mRNA CTD PMID:30047161 E2f1 Rat methotrexate multiple interactions ISO E2F1 (Homo sapiens) 6480464 Methotrexate inhibits the reaction [RB1 protein binds to E2F1 protein] more ... CTD PMID:22484375 E2f1 Rat methotrexate multiple interactions ISO E2f1 (Mus musculus) 6480464 Methotrexate promotes the reaction [E2F1 protein binds to CHEK1 promoter] and Methotrexate promotes the reaction [E2F1 protein binds to DHFR promoter] CTD PMID:22484375 E2f1 Rat methylseleninic acid decreases expression ISO E2F1 (Homo sapiens) 6480464 methylselenic acid results in decreased expression of E2F1 mRNA and methylselenic acid results in decreased expression of E2F1 protein CTD PMID:11830524 and PMID:17847021 E2f1 Rat methylseleninic acid affects expression ISO E2F1 (Homo sapiens) 6480464 methylselenic acid affects the expression of E2F1 mRNA CTD PMID:14617803 E2f1 Rat methylseleninic acid multiple interactions ISO E2F1 (Homo sapiens) 6480464 methylselenic acid promotes the reaction [E2F1 protein binds to RB1 protein] CTD PMID:17847021 E2f1 Rat mifepristone decreases expression ISO E2F1 (Homo sapiens) 6480464 Mifepristone results in decreased expression of E2F1 protein CTD PMID:17545545 E2f1 Rat mitomycin C decreases expression ISO E2F1 (Homo sapiens) 6480464 Mitomycin results in decreased expression of E2F1 mRNA CTD PMID:24211769 E2f1 Rat mono(2-ethylhexyl) phthalate decreases expression ISO E2f1 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of E2F1 mRNA CTD PMID:33162236 E2f1 Rat monocrotaline multiple interactions ISO E2f1 (Mus musculus) 6480464 [Monocrotaline co-treated with Rifampin co-treated with Phenytoin co-treated with PRKDC] results in increased expression of E2F1 mRNA CTD PMID:21224054 E2f1 Rat monocrotaline multiple interactions ISO E2F1 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of Monocrotaline] which results in decreased expression of E2F1 mRNA CTD PMID:33884520 E2f1 Rat monosodium L-glutamate multiple interactions ISO E2f1 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 E2f1 Rat motexafin gadolinium increases expression ISO E2F1 (Homo sapiens) 6480464 motexafin gadolinium results in increased expression of E2F1 mRNA CTD PMID:16357179 E2f1 Rat motexafin gadolinium multiple interactions ISO E2F1 (Homo sapiens) 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in increased expression of E2F1 mRNA CTD PMID:16357179 E2f1 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine decreases expression ISO E2F1 (Homo sapiens) 6480464 N more ... CTD PMID:33645215 E2f1 Rat N-acetyl-L-cysteine multiple interactions ISO E2F1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [5-nitroso-8-quinolinol results in decreased expression of E2F1 protein] CTD PMID:16497787 E2f1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO E2F1 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Dronabinol results in decreased expression of E2F1 protein] CTD PMID:17934890 E2f1 Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression ISO E2F1 (Homo sapiens) 6480464 Methylnitronitrosoguanidine results in increased expression of E2F1 protein CTD PMID:26921499 E2f1 Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO E2F1 (Homo sapiens) 6480464 ATR protein promotes the reaction [Methylnitronitrosoguanidine results in increased expression of E2F1 protein] more ... CTD PMID:26921499 E2f1 Rat N-nitrosodiethylamine multiple interactions ISO E2f1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Piperonyl Butoxide] results in increased expression of E2F1 mRNA more ... CTD PMID:17854601 more ... E2f1 Rat N-nitrosodiethylamine increases expression ISO E2f1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of E2F1 mRNA and Diethylnitrosamine results in increased expression of E2F1 protein CTD PMID:17854601 and PMID:19887370 E2f1 Rat nickel atom multiple interactions EXP 6480464 [Nickel co-treated with Cobalt co-treated with Tungsten] results in decreased expression of E2F1 mRNA and [Nickel co-treated with Iron co-treated with Tungsten] results in decreased expression of E2F1 mRNA CTD PMID:22198552 E2f1 Rat nickel dichloride increases expression ISO E2f1 (Mus musculus) 6480464 nickel chloride results in increased expression of E2F1 mRNA CTD PMID:12729255 E2f1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of E2F1 mRNA CTD PMID:22546817 E2f1 Rat nickel dichloride multiple interactions ISO E2f1 (Mus musculus) 6480464 HIF1A affects the reaction [nickel chloride results in increased expression of E2F1 mRNA] CTD PMID:12729255 E2f1 Rat niclosamide decreases expression ISO E2F1 (Homo sapiens) 6480464 Niclosamide results in decreased expression of E2F1 mRNA CTD PMID:29843133 E2f1 Rat nicotine increases expression ISO E2F1 (Homo sapiens) 6480464 Nicotine results in increased expression of E2F1 protein CTD PMID:20061081 E2f1 Rat nicotine multiple interactions ISO E2F1 (Homo sapiens) 6480464 MK-886 inhibits the reaction [Nicotine results in increased expression of E2F1 protein] more ... CTD PMID:16601104 more ... E2f1 Rat Nonylphenol decreases expression EXP 6480464 nonylphenol results in decreased expression of E2F1 protein CTD PMID:39111523 E2f1 Rat Nonylphenol increases expression ISO E2F1 (Homo sapiens) 6480464 nonylphenol results in increased expression of E2F1 mRNA and nonylphenol results in increased expression of E2F1 protein CTD PMID:33516137 E2f1 Rat ochratoxin A increases expression ISO E2F1 (Homo sapiens) 6480464 ochratoxin A results in increased expression of E2F1 mRNA CTD PMID:29098329 E2f1 Rat ochratoxin A increases acetylation ISO E2F1 (Homo sapiens) 6480464 ochratoxin A results in increased acetylation of E2F1 promoter CTD PMID:29098329 E2f1 Rat ochratoxin A multiple interactions ISO E2F1 (Homo sapiens) 6480464 [ochratoxin A results in increased acetylation of E2F1 promoter] which results in increased expression of E2F1 mRNA CTD PMID:29098329 E2f1 Rat okadaic acid increases expression ISO E2F1 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of E2F1 mRNA CTD PMID:38832940 E2f1 Rat oleic acid decreases expression ISO E2F1 (Homo sapiens) 6480464 Oleic Acid results in decreased expression of E2F1 protein CTD PMID:16027227 E2f1 Rat ozone multiple interactions ISO E2F1 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of E2F1 mRNA and [Oxygen co-treated with Ozone] results in decreased expression of E2F1 mRNA CTD PMID:32992648 E2f1 Rat ozone multiple interactions ISO E2f1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of E2F1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of E2F1 mRNA CTD PMID:34911549 E2f1 Rat p-menthan-3-ol increases expression ISO E2F1 (Homo sapiens) 6480464 Menthol results in increased expression of E2F1 mRNA CTD PMID:26760959 E2f1 Rat paclitaxel increases response to substance ISO E2F1 (Homo sapiens) 6480464 E2F1 protein results in increased susceptibility to Paclitaxel CTD PMID:16849574 E2f1 Rat paclitaxel multiple interactions EXP 6480464 royal jelly inhibits the reaction [Paclitaxel results in increased expression of E2F1 mRNA] CTD PMID:27496854 E2f1 Rat paclitaxel increases expression EXP 6480464 Paclitaxel results in increased expression of E2F1 mRNA CTD PMID:27496854 E2f1 Rat palbociclib multiple interactions ISO E2F1 (Homo sapiens) 6480464 palbociclib inhibits the reaction [Doxorubicin results in increased expression of E2F1 protein] and RB1 protein affects the reaction [palbociclib inhibits the reaction [Doxorubicin results in increased expression of E2F1 protein]] CTD PMID:22751436 E2f1 Rat paracetamol increases expression ISO E2F1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of E2F1 mRNA CTD PMID:22230336 and PMID:25704631 E2f1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of E2F1 mRNA CTD PMID:33387578 E2f1 Rat paracetamol affects methylation EXP 6480464 Acetaminophen affects the methylation of E2F1 gene CTD PMID:29381301 E2f1 Rat paraquat multiple interactions ISO E2f1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of E2F1 mRNA and Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in increased expression of E2F1 mRNA] CTD PMID:23963992 E2f1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of E2F1 mRNA CTD PMID:32680482 E2f1 Rat parathion decreases expression ISO E2f1 (Mus musculus) 6480464 Parathion results in decreased expression of E2F1 mRNA CTD PMID:34813904 E2f1 Rat pentachlorophenol increases expression EXP 6480464 Pentachlorophenol results in increased expression of E2F1 protein CTD PMID:19442831 E2f1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO E2f1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of E2F1 mRNA more ... CTD PMID:36331819 E2f1 Rat phenobarbital affects expression ISO E2f1 (Mus musculus) 6480464 Phenobarbital affects the expression of E2F1 mRNA CTD PMID:23091169 E2f1 Rat phenytoin multiple interactions ISO E2f1 (Mus musculus) 6480464 [Monocrotaline co-treated with Rifampin co-treated with Phenytoin co-treated with PRKDC] results in increased expression of E2F1 mRNA CTD PMID:21224054 E2f1 Rat phosphoramide mustard increases expression EXP 6480464 phosphoramide mustard results in increased expression of E2F1 mRNA CTD PMID:26708502 E2f1 Rat phthalaldehyde affects expression ISO E2f1 (Mus musculus) 6480464 o-Phthalaldehyde affects the expression of E2F1 mRNA CTD PMID:22302311 E2f1 Rat piperonyl butoxide multiple interactions ISO E2f1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Piperonyl Butoxide] results in increased expression of E2F1 mRNA CTD PMID:20101389 E2f1 Rat pirinixic acid increases expression ISO E2f1 (Mus musculus) 6480464 pirinixic acid results in increased expression of E2F1 mRNA CTD PMID:23811191 E2f1 Rat plumbagin decreases expression ISO E2F1 (Homo sapiens) 6480464 plumbagin results in decreased expression of E2F1 mRNA CTD PMID:36336213 E2f1 Rat pregnenolone 16alpha-carbonitrile multiple interactions ISO E2f1 (Mus musculus) 6480464 [1 more ... CTD PMID:23626729 E2f1 Rat progesterone decreases expression ISO E2f1 (Mus musculus) 6480464 Progesterone results in decreased expression of E2F1 mRNA CTD PMID:16966611 E2f1 Rat propylparaben increases expression ISO E2F1 (Homo sapiens) 6480464 propylparaben results in increased expression of E2F1 mRNA CTD PMID:24481588 E2f1 Rat PX-866 multiple interactions ISO E2F1 (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with PX-866] results in decreased expression of E2F1 mRNA CTD PMID:26660119 E2f1 Rat quercetin increases expression ISO E2F1 (Homo sapiens) 6480464 Quercetin results in increased expression of E2F1 mRNA CTD PMID:21632981 and PMID:27514524 E2f1 Rat quinoline affects expression ISO E2F1 (Homo sapiens) 6480464 quinoline analog affects the expression of E2F1 protein CTD PMID:15450938 E2f1 Rat raloxifene multiple interactions ISO E2F1 (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with PX-866] results in decreased expression of E2F1 mRNA CTD PMID:26660119 E2f1 Rat resveratrol multiple interactions ISO E2F1 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of E2F1 mRNA CTD PMID:19167446 E2f1 Rat riddelliine multiple interactions ISO E2F1 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of riddelliine] which results in decreased expression of E2F1 mRNA CTD PMID:33884520 E2f1 Rat rifampicin multiple interactions ISO E2f1 (Mus musculus) 6480464 [Monocrotaline co-treated with Rifampin co-treated with Phenytoin co-treated with PRKDC] results in increased expression of E2F1 mRNA CTD PMID:21224054 E2f1 Rat ritonavir decreases expression ISO E2F1 (Homo sapiens) 6480464 Ritonavir results in decreased expression of E2F1 mRNA and Ritonavir results in decreased expression of E2F1 protein CTD PMID:19386116 E2f1 Rat royal jelly multiple interactions EXP 6480464 royal jelly inhibits the reaction [Paclitaxel results in increased expression of E2F1 mRNA] CTD PMID:27496854 E2f1 Rat selenium atom increases expression ISO E2F1 (Homo sapiens) 6480464 Selenium results in increased expression of E2F1 mRNA CTD PMID:19244175 E2f1 Rat silicon dioxide decreases expression ISO E2F1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of E2F1 mRNA CTD PMID:23806026 E2f1 Rat silver(1+) nitrate increases expression ISO E2F1 (Homo sapiens) 6480464 Silver Nitrate analog results in increased expression of E2F1 mRNA CTD PMID:22831968 E2f1 Rat simvastatin decreases expression ISO E2F1 (Homo sapiens) 6480464 Simvastatin results in decreased expression of E2F1 mRNA CTD PMID:17428261 E2f1 Rat sirolimus multiple interactions ISO E2F1 (Homo sapiens) 6480464 [TGFB1 protein co-treated with Sirolimus] results in decreased expression of E2F1 mRNA and [TGFB1 protein co-treated with Sirolimus] results in decreased expression of E2F1 protein CTD PMID:12417722 E2f1 Rat sirolimus multiple interactions ISO E2f1 (Mus musculus) 6480464 [TGFB1 protein co-treated with Sirolimus] results in decreased expression of E2F1 protein CTD PMID:12417722 E2f1 Rat sodium arsenite multiple interactions ISO E2f1 (Mus musculus) 6480464 sodium arsenite inhibits the reaction [E2F1 protein binds to DLGAP5 promoter] more ... CTD PMID:17998272 and PMID:28003426 E2f1 Rat sodium arsenite decreases expression ISO E2F1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of E2F1 mRNA CTD PMID:38568856 E2f1 Rat sodium arsenite multiple interactions ISO E2F1 (Homo sapiens) 6480464 sodium arsenite affects the reaction [Estradiol affects the expression of E2F1 protein] more ... CTD PMID:28880708 E2f1 Rat sodium arsenite increases expression ISO E2F1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of E2F1 mRNA CTD PMID:28595984 more ... E2f1 Rat sodium arsenite increases expression ISO E2f1 (Mus musculus) 6480464 sodium arsenite results in increased expression of E2F1 protein CTD PMID:10764629 E2f1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of E2F1 mRNA CTD PMID:30047161 E2f1 Rat sulforaphane decreases expression ISO E2F1 (Homo sapiens) 6480464 sulforaphane results in decreased expression of E2F1 mRNA CTD PMID:31838189 E2f1 Rat sulindac decreases expression ISO E2F1 (Homo sapiens) 6480464 Sulindac results in decreased expression of E2F1 protein CTD PMID:16488075 E2f1 Rat tamoxifen multiple interactions ISO E2F1 (Homo sapiens) 6480464 Tamoxifen promotes the reaction [[[ESR1 protein binds to SP1 protein] which binds to E2F1 promoter] which results in increased expression of E2F1 mRNA] and Tamoxifen promotes the reaction [[ESR1 protein binds to SP1 protein] which binds to E2F1 promoter] CTD PMID:20215421 E2f1 Rat tamoxifen decreases expression EXP 6480464 Tamoxifen results in decreased expression of E2F1 protein CTD PMID:17343880 E2f1 Rat tamoxifen multiple interactions EXP 6480464 [Tamoxifen results in increased expression of MIR17 mRNA] which results in decreased expression of E2F1 protein and [Tamoxifen results in increased expression of MIR92A1 mRNA] which results in decreased expression of E2F1 protein CTD PMID:17343880 E2f1 Rat tamoxifen increases expression ISO E2F1 (Homo sapiens) 6480464 Tamoxifen results in increased expression of E2F1 mRNA and Tamoxifen results in increased expression of E2F1 protein CTD PMID:20215421 E2f1 Rat tamoxifen decreases expression ISO E2F1 (Homo sapiens) 6480464 Tamoxifen results in decreased expression of E2F1 mRNA CTD PMID:15590111 E2f1 Rat tauroursodeoxycholic acid increases expression EXP 6480464 ursodoxicoltaurine results in increased expression of E2F1 mRNA CTD PMID:15255934 E2f1 Rat tauroursodeoxycholic acid decreases expression EXP 6480464 ursodoxicoltaurine results in decreased expression of E2F1 protein CTD PMID:15255934 E2f1 Rat tert-butyl hydroperoxide decreases expression ISO E2F1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of E2F1 mRNA CTD PMID:12419474 E2f1 Rat testosterone multiple interactions ISO E2F1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of E2F1 mRNA more ... CTD PMID:21592394 E2f1 Rat testosterone multiple interactions ISO E2f1 (Mus musculus) 6480464 1 more ... CTD PMID:33848595 E2f1 Rat testosterone decreases expression ISO E2f1 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of E2F1 mRNA CTD PMID:33848595 E2f1 Rat testosterone decreases expression ISO E2F1 (Homo sapiens) 6480464 Testosterone results in decreased expression of E2F1 mRNA CTD PMID:21592394 E2f1 Rat tetrachloromethane increases expression ISO E2f1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of E2F1 mRNA and Carbon Tetrachloride results in increased expression of E2F1 protein CTD PMID:17484886 and PMID:19887370 E2f1 Rat thapsigargin decreases expression ISO E2F1 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of E2F1 mRNA CTD PMID:22378314 E2f1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of E2F1 mRNA CTD PMID:16297948 E2f1 Rat titanium dioxide decreases methylation ISO E2f1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of E2F1 promoter CTD PMID:35295148 E2f1 Rat tocopherol increases expression ISO E2F1 (Homo sapiens) 6480464 Tocopherols results in increased expression of E2F1 protein CTD PMID:15883045 E2f1 Rat toluene 2,4-diisocyanate increases expression ISO E2f1 (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in increased expression of E2F1 mRNA CTD PMID:21404309 E2f1 Rat trabectedin increases expression ISO E2f1 (Mus musculus) 6480464 trabectedin results in increased expression of E2F1 mRNA CTD PMID:15961672 E2f1 Rat trabectedin increases expression ISO E2F1 (Homo sapiens) 6480464 trabectedin results in increased expression of E2F1 mRNA CTD PMID:15961672 E2f1 Rat trimellitic anhydride increases expression ISO E2f1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of E2F1 mRNA CTD PMID:19042947 E2f1 Rat trimellitic anhydride affects expression ISO E2f1 (Mus musculus) 6480464 trimellitic anhydride affects the expression of E2F1 mRNA CTD PMID:22302311 E2f1 Rat triphenyl phosphate affects expression ISO E2F1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of E2F1 mRNA CTD PMID:37042841 E2f1 Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of E2F1 mRNA CTD PMID:23639586 E2f1 Rat troglitazone multiple interactions ISO E2F1 (Homo sapiens) 6480464 [troglitazone co-treated with Aspirin] results in decreased expression of E2F1 protein CTD PMID:19908241 E2f1 Rat troglitazone decreases expression ISO E2F1 (Homo sapiens) 6480464 troglitazone results in decreased expression of E2F1 mRNA CTD PMID:19140230 and PMID:19631733 E2f1 Rat trovafloxacin decreases expression ISO E2f1 (Mus musculus) 6480464 trovafloxacin results in decreased expression of E2F1 mRNA CTD PMID:35537566 E2f1 Rat tungsten multiple interactions EXP 6480464 [Nickel co-treated with Cobalt co-treated with Tungsten] results in decreased expression of E2F1 mRNA and [Nickel co-treated with Iron co-treated with Tungsten] results in decreased expression of E2F1 mRNA CTD PMID:22198552 E2f1 Rat tunicamycin decreases expression ISO E2F1 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of E2F1 mRNA CTD PMID:22378314 E2f1 Rat urethane increases expression ISO E2f1 (Mus musculus) 6480464 Urethane results in increased expression of E2F1 mRNA CTD PMID:12117781 E2f1 Rat urethane decreases expression ISO E2F1 (Homo sapiens) 6480464 Urethane results in decreased expression of E2F1 mRNA CTD PMID:28818685 E2f1 Rat ursodeoxycholic acid multiple interactions EXP 6480464 NR3C1 mutant form inhibits the reaction [Ursodeoxycholic Acid inhibits the reaction [TGFB1 protein results in increased expression of E2F1 protein]] more ... CTD PMID:14514686 and PMID:15222754 E2f1 Rat ursodeoxycholic acid decreases expression EXP 6480464 Ursodeoxycholic Acid results in decreased expression of E2F1 protein CTD PMID:15222754 E2f1 Rat valproic acid increases expression ISO E2F1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of E2F1 mRNA CTD PMID:20585447 E2f1 Rat valproic acid increases methylation ISO E2F1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of E2F1 gene CTD PMID:29154799 E2f1 Rat valproic acid affects expression ISO E2F1 (Homo sapiens) 6480464 Valproic Acid affects the expression of E2F1 mRNA CTD PMID:25979313 E2f1 Rat vemurafenib multiple interactions ISO E2F1 (Homo sapiens) 6480464 [(+)-JQ1 compound co-treated with vemurafenib] results in decreased expression of E2F1 mRNA CTD PMID:27169980 E2f1 Rat vincaleukoblastine increases response to substance ISO E2F1 (Homo sapiens) 6480464 E2F1 protein results in increased susceptibility to Vinblastine CTD PMID:16849574 E2f1 Rat vinyl carbamate decreases expression ISO E2f1 (Mus musculus) 6480464 vinyl carbamate results in decreased expression of E2F1 mRNA CTD PMID:17849452 E2f1 Rat wortmannin multiple interactions ISO E2f1 (Mus musculus) 6480464 wortmannin inhibits the reaction [Vanadates results in increased expression of E2F1 protein] CTD PMID:14971663 E2f1 Rat zinc acetate increases expression ISO E2F1 (Homo sapiens) 6480464 Zinc Acetate results in increased expression of E2F1 mRNA CTD PMID:16357179 E2f1 Rat zinc acetate multiple interactions ISO E2F1 (Homo sapiens) 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in increased expression of E2F1 mRNA CTD PMID:16357179
Imported Annotations - KEGG (archival)
(-)-citrinin (EXP) (-)-epigallocatechin 3-gallate (EXP) (1->4)-beta-D-glucan (ISO) (25R)-cholest-5-ene-3beta,26-diol (ISO) (S)-colchicine (ISO) (S)-naringenin (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (EXP) 1-chloro-2,4-dinitrobenzene (ISO) 1-methyltryptophan (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-acetamidofluorene (EXP) 26-hydroxycholesterol (ISO) 3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid (ISO) 3-aminobenzamide (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroperoxycyclophosphamide (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (ISO) 5-fluorouracil (ISO) 5-nitroso-8-quinolinol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acetylsalicylic acid (ISO) acrylamide (ISO) acteoside (ISO) adenine (ISO) adenosine (EXP) aflatoxin B1 (EXP,ISO) all-trans-4-oxoretinoic acid (ISO) all-trans-retinoic acid (ISO) alpha-hexylcinnamaldehyde (ISO) alvocidib (ISO) amitrole (EXP) ammonium chloride (EXP) amodiaquine (ISO) amphetamine (EXP) amphibole asbestos (ISO) androstane (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) aspartame (ISO) Aspidin (ISO) atrazine (ISO) auraptene (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[d]isothiazol-3-one (ISO) benzophenanthridine (ISO) biotin (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bortezomib (ISO) Butylparaben (ISO) cadmium acetate (ISO) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calcitriol (ISO) camptothecin (ISO) cannabidiol (ISO) capsaicin (ISO) carbamazepine (ISO) carbon nanotube (ISO) Cardanol (ISO) carmustine (ISO) chlorpromazine (ISO) chlorpyrifos (ISO) choline (EXP,ISO) chromium(6+) (ISO) cilostazol (ISO) cisplatin (ISO) citalopram (EXP) cobalt atom (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) cordycepin (ISO) coumestrol (ISO) CU-O LINKAGE (ISO) curcumin (EXP) DDT (ISO) deguelin (ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) dieldrin (EXP) diethanolamine (EXP,ISO) dihydroxyacetone (ISO) dioxygen (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (ISO) escitalopram (EXP) etoposide (ISO) eugenol (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) furan (EXP) gamma-tocopherol (ISO) gefitinib (ISO) gentamycin (EXP) geraniol (ISO) glyphosate (ISO) GSK-J4 (ISO) GW 3965 (ISO) harmine (ISO) heparin (ISO) hydroquinone (ISO) hydroxyurea (ISO) Indeno[1,2,3-cd]pyrene (ISO) indirubin (ISO) inulin (ISO) iron atom (EXP) iron(0) (EXP) L-methionine (ISO) Lasiocarpine (ISO) lead nitrate (ISO) leptomycin B (ISO) lidocaine (ISO) lipopolysaccharide (ISO) LY294002 (ISO) maneb (ISO) melatonin (ISO) menadione (ISO) methimazole (EXP) methotrexate (ISO) methylseleninic acid (ISO) mifepristone (ISO) mitomycin C (ISO) mono(2-ethylhexyl) phthalate (ISO) monocrotaline (ISO) monosodium L-glutamate (ISO) motexafin gadolinium (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-acetyl-L-cysteine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (ISO) nickel atom (EXP) nickel dichloride (EXP,ISO) niclosamide (ISO) nicotine (ISO) Nonylphenol (EXP,ISO) ochratoxin A (ISO) okadaic acid (ISO) oleic acid (ISO) ozone (ISO) p-menthan-3-ol (ISO) paclitaxel (EXP,ISO) palbociclib (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) parathion (ISO) pentachlorophenol (EXP) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenytoin (ISO) phosphoramide mustard (EXP) phthalaldehyde (ISO) piperonyl butoxide (ISO) pirinixic acid (ISO) plumbagin (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (ISO) propylparaben (ISO) PX-866 (ISO) quercetin (ISO) quinoline (ISO) raloxifene (ISO) resveratrol (ISO) riddelliine (ISO) rifampicin (ISO) ritonavir (ISO) royal jelly (EXP) selenium atom (ISO) silicon dioxide (ISO) silver(1+) nitrate (ISO) simvastatin (ISO) sirolimus (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) sulforaphane (ISO) sulindac (ISO) tamoxifen (EXP,ISO) tauroursodeoxycholic acid (EXP) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) tocopherol (ISO) toluene 2,4-diisocyanate (ISO) trabectedin (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) Triptolide (EXP) troglitazone (ISO) trovafloxacin (ISO) tungsten (EXP) tunicamycin (ISO) urethane (ISO) ursodeoxycholic acid (EXP) valproic acid (ISO) vemurafenib (ISO) vincaleukoblastine (ISO) vinyl carbamate (ISO) wortmannin (ISO) zinc acetate (ISO)
Biological Process
anoikis (IEA,ISO) cellular response to fatty acid (IEP) cellular response to hypoxia (IEP) cellular response to nerve growth factor stimulus (IDA) cellular response to xenobiotic stimulus (IEA,ISO) DNA damage checkpoint signaling (IEA,ISO,ISS) DNA-templated transcription (IEA,ISO,ISS) forebrain development (IEA,ISO) G1/S transition of mitotic cell cycle (TAS) intrinsic apoptotic signaling pathway by p53 class mediator (IEA,ISO) intrinsic apoptotic signaling pathway in response to DNA damage (IEA,ISO,ISS) lens fiber cell apoptotic process (IEA,ISO) mRNA stabilization (IEA,ISO) negative regulation of DNA-templated transcription (IEA,ISO,ISS) negative regulation of fat cell differentiation (IEA,ISO,ISS) negative regulation of fat cell proliferation (IEA,ISO,ISS) negative regulation of transcription by RNA polymerase II (IEA,ISO) positive regulation of apoptotic process (IEA,ISO) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of fibroblast proliferation (IEA,ISO) positive regulation of gene expression (IEA,ISO) positive regulation of glial cell proliferation (IMP) positive regulation of transcription by RNA polymerase II (IEA,ISO,ISS) quinolinate biosynthetic process (ISO) regulation of cell cycle (IEA,ISO) regulation of DNA-templated transcription (IEA,ISO,ISS) regulation of G1/S transition of mitotic cell cycle (IEA,ISO) regulation of transcription by RNA polymerase II (IBA,IEA) response to lipopolysaccharide (IEA,ISO) spermatogenesis (IEP)
Cellular Component
centrosome (IEA,ISO) chromatin (IEA,ISO) cytoplasm (IEA,ISO) nuclear chromosome (IDA) nucleoplasm (IEA,ISO) nucleus (IEA,ISO) protein-containing complex (IEA,ISO) Rb-E2F complex (IBA,IEA,ISO) RNA polymerase II transcription regulator complex (IEA,ISO) transcription regulator complex (IEA,ISO)
Molecular Function
calcium ion binding (IEA) cis-regulatory region sequence-specific DNA binding (IEA,ISO) DNA binding (IEA,ISO) DNA-binding transcription activator activity (IEA,ISO,ISS) DNA-binding transcription factor activity (IEA,ISO,TAS) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA,ISO,ISS) DNA-binding transcription factor binding (IEA,ISO) metal ion binding (IEA) molecular adaptor activity (ISO) protein binding (IPI,ISO) protein dimerization activity (IEA) protein kinase binding (IPI) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA) sequence-specific DNA binding (IDA,IEA,ISO) sequence-specific double-stranded DNA binding (IEA,ISO) transcription cis-regulatory region binding (IEA,ISO)
1.
Expression of transcription factor E2F1 and telomerase in glioblastomas: mechanistic linkage and prognostic significance.
Alonso MM, etal., J Natl Cancer Inst. 2005 Nov 2;97(21):1589-600. doi: 10.1093/jnci/dji340.
2.
Gamma-linolenic acid alters Ku80, E2F1, and bax expression and induces micronucleus formation in C6 glioma cells in vitro.
Benadiba M, etal., IUBMB Life. 2009 Mar;61(3):244-51.
3.
Lysine acetyltransferase GCN5 potentiates the growth of non-small cell lung cancer via promotion of E2F1, cyclin D1, and cyclin E1 expression.
Chen L, etal., J Biol Chem. 2013 May 17;288(20):14510-21. doi: 10.1074/jbc.M113.458737. Epub 2013 Mar 29.
4.
The over expression of long non-coding RNA ANRIL promotes epithelial-mesenchymal transition by activating the ATM-E2F1 signaling pathway in pancreatic cancer: An in vivo and in vitro study.
Chen S, etal., Int J Biol Macromol. 2017 Sep;102:718-728. doi: 10.1016/j.ijbiomac.2017.03.123. Epub 2017 Mar 23.
5.
Gene expression profile of circulating CD34(+) cells and granulocytes in chronic myeloid leukemia.
Cokic VP, etal., Blood Cells Mol Dis. 2015 Dec;55(4):373-81. doi: 10.1016/j.bcmd.2015.08.002. Epub 2015 Aug 7.
6.
Knockdown of E2f1 by RNA interference impairs proliferation of rat cells in vitro.
Dos Reis Vasques L, etal., Genet Mol Biol. 2010 Jan;33(1):17-22. doi: 10.1590/S1415-47572009005000104. Epub 2010 Mar 1.
7.
Differential expression of members of the E2F family of transcription factors in rodent testes.
El-Darwish KS, etal., Reprod Biol Endocrinol. 2006 Dec 5;4:63.
8.
Distinct pattern of E2F1 expression in human lung tumours: E2F1 is upregulated in small cell lung carcinoma.
Eymin B, etal., Oncogene. 2001 Mar 29;20(14):1678-87. doi: 10.1038/sj.onc.1204242.
9.
Impaired pancreatic growth, beta cell mass, and beta cell function in E2F1 (-/- )mice.
Fajas L, etal., J Clin Invest 2004 May;113(9):1288-95.
10.
E2F-1 functions in mice to promote apoptosis and suppress proliferation.
Field SJ, etal., Cell 1996 May 17;85(4):549-61.
11.
Differences in E2F subunit expression in quiescent and proliferating vascular smooth muscle cells.
Fujita N, etal., Am J Physiol Heart Circ Physiol 2002 Jul;283(1):H204-12.
12.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
13.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
14.
Transcription factor E2F-1 acts as a growth-promoting factor and is associated with adverse prognosis in non-small cell lung carcinomas.
Gorgoulis VG, etal., J Pathol. 2002 Oct;198(2):142-56. doi: 10.1002/path.1121.
15.
Diabetes and exocrine pancreatic insufficiency in E2F1/E2F2 double-mutant mice.
Iglesias A, etal., J Clin Invest 2004 May;113(10):1398-407.
16.
The transcriptional co-regulator HCF-1 is required for INS-1 β-cell glucose-stimulated insulin secretion.
Iwata TN, etal., PLoS One. 2013 Nov 8;8(11):e78841. doi: 10.1371/journal.pone.0078841. eCollection 2013.
17.
Altered distribution of cell cycle transcriptional regulators during Alzheimer disease.
Jordan-Sciutto KL, etal., J Neuropathol Exp Neurol. 2002 Apr;61(4):358-67.
18.
Cell cycle proteins exhibit altered expression patterns in lentiviral-associated encephalitis.
Jordan-Sciutto KL, etal., J Neurosci. 2002 Mar 15;22(6):2185-95.
19.
Adenovirus-mediated E2F-1 gene transfer in nonsmall-cell lung cancer induces cell growth arrest and apoptosis.
Kuhn H, etal., Eur Respir J. 2002 Sep;20(3):703-9.
20.
Expression signature of E2F1 and its associated genes predict superficial to invasive progression of bladder tumors.
Lee JS, etal., J Clin Oncol. 2010 Jun 1;28(16):2660-7. doi: 10.1200/JCO.2009.25.0977. Epub 2010 Apr 26.
21.
Ribosomal protein S3, a new substrate of Akt, serves as a signal mediator between neuronal apoptosis and DNA repair.
Lee SB, etal., J Biol Chem. 2010 Sep 17;285(38):29457-68. doi: 10.1074/jbc.M110.131367. Epub 2010 Jul 6.
22.
Tumour growth-suppressive effect of arsenic trioxide in squamous cell lung carcinoma.
Leung LL, etal., Oncol Lett. 2017 Sep;14(3):3748-3754. doi: 10.3892/ol.2017.6646. Epub 2017 Jul 21.
23.
Differential regulation of MMPs by E2F1, Sp1 and NF-kappa B controls the small cell lung cancer invasive phenotype.
Li Z, etal., BMC Cancer. 2014 Apr 22;14:276. doi: 10.1186/1471-2407-14-276.
24.
TRIM28 knockdown increases sensitivity to etoposide by upregulating E2F1 in non-small cell lung cancer.
Liu L, etal., Oncol Rep. 2017 Jun;37(6):3597-3605. doi: 10.3892/or.2017.5638. Epub 2017 May 11.
25.
Genome-wide array-based comparative genomic hybridization analysis of pancreatic adenocarcinoma: identification of genetic indicators that predict patient outcome.
Loukopoulos P, etal., Cancer Sci. 2007 Mar;98(3):392-400. doi: 10.1111/j.1349-7006.2007.00395.x. Epub 2007 Jan 12.
26.
The long noncoding RNA H19 promotes cell proliferation via E2F-1 in pancreatic ductal adenocarcinoma.
Ma L, etal., Cancer Biol Ther. 2016 Oct 2;17(10):1051-1061. doi: 10.1080/15384047.2016.1219814. Epub 2016 Aug 29.
27.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
28.
Up-regulation of E2F-1 in Down's syndrome brain exhibiting neuropathological features of Alzheimer-type dementia.
Motonaga K, etal., Brain Res. 2001 Jun 29;905(1-2):250-3.
29.
Cell cycle activation in striatal neurons from Huntington's disease patients and rats treated with 3-nitropropionic acid.
Pelegri C, etal., Int J Dev Neurosci. 2008 Nov;26(7):665-71. Epub 2008 Aug 12.
30.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
31.
GOA pipeline
RGD automated data pipeline
32.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
33.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
34.
Antagonism of E2F-1 regulated Bnip3 transcription by NF-kappaB is essential for basal cell survival.
Shaw J, etal., Proc Natl Acad Sci U S A. 2008 Dec 30;105(52):20734-9. Epub 2008 Dec 16.
35.
E2F1 silencing inhibits migration and invasion of osteosarcoma cells via regulating DDR1 expression.
Wang Z, etal., Int J Oncol. 2017 Dec;51(6):1639-1650. doi: 10.3892/ijo.2017.4165. Epub 2017 Oct 16.
36.
A retinoblastoma-binding protein that affects cell-cycle control and confers transforming ability.
Woitach JT, etal., Nat Genet 1998 Aug;19(4):371-4.
37.
Gene expression profiling of lung adenocarcinoma in Xuanwei, China.
Wu H, etal., Eur J Cancer Prev. 2016 Nov;25(6):508-17. doi: 10.1097/CEJ.0000000000000214.
38.
Gambogic acid sensitizes gemcitabine efficacy in pancreatic cancer by reducing the expression of ribonucleotide reductase subunit-M2 (RRM2).
Xia G, etal., J Exp Clin Cancer Res. 2017 Aug 10;36(1):107. doi: 10.1186/s13046-017-0579-0.
39.
Chromatin Remodeling Factor LSH is Upregulated by the LRP6-GSK3ß-E2F1 Axis Linking Reversely with Survival in Gliomas.
Xiao D, etal., Theranostics. 2017 Jan 1;7(1):132-143. doi: 10.7150/thno.17032. eCollection 2017.
40.
Antitumor and modeling studies of a penetratin-peptide that targets E2F-1 in small cell lung cancer.
Xie X, etal., Cancer Biol Ther. 2013 Aug;14(8):742-51. doi: 10.4161/cbt.25184. Epub 2013 Jun 3.
41.
Tumor induction and tissue atrophy in mice lacking E2F-1.
Yamasaki L, etal., Cell 1996 May 17;85(4):537-48.
42.
Expression of transcription factor E2F-1 in pancreatic ductal carcinoma: an immunohistochemical study.
Yamazaki K, etal., Pathol Res Pract. 2003;199(1):23-8. doi: 10.1078/0344-0338-00348.
43.
The cell cycle factor E2F-1 activates Bnip3 and the intrinsic death pathway in ventricular myocytes.
Yurkova N, etal., Circ Res. 2008 Feb 29;102(4):472-9. Epub 2007 Dec 20.
44.
The association of GSK3 beta with E2F1 facilitates nerve growth factor-induced neural cell differentiation.
Zhou F, et al., J Biol Chem. 2008 May 23;283(21):14506-15. doi: 10.1074/jbc.M706136200. Epub 2008 Mar 26.
E2f1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 163,524,739 - 163,535,563 (-) NCBI GRCr8 mRatBN7.2 3 143,064,535 - 143,075,362 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 143,049,478 - 143,075,361 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 146,931,136 - 146,941,990 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 155,549,300 - 155,560,154 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 153,288,668 - 153,299,512 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 150,062,895 - 150,073,721 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 150,047,826 - 150,073,721 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 156,435,530 - 156,446,390 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 145,032,489 - 145,043,729 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 144,943,133 - 144,943,246 (-) NCBI Celera 3 141,799,009 - 141,809,945 (-) NCBI Celera Cytogenetic Map 3 q41 NCBI
E2F1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 33,675,477 - 33,686,385 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 33,675,477 - 33,686,385 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 32,263,283 - 32,274,191 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 31,727,150 - 31,737,854 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 31,727,149 - 31,737,854 NCBI Celera 20 29,016,324 - 29,027,242 (-) NCBI Celera Cytogenetic Map 20 q11.22 NCBI HuRef 20 29,049,266 - 29,060,184 (-) NCBI HuRef CHM1_1 20 32,164,384 - 32,175,302 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 35,402,008 - 35,412,916 (-) NCBI T2T-CHM13v2.0
E2f1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 154,401,320 - 154,411,812 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 154,401,327 - 154,411,812 (-) Ensembl GRCm39 Ensembl GRCm38 2 154,559,400 - 154,569,892 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 154,559,407 - 154,569,892 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 154,385,375 - 154,395,588 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 154,251,080 - 154,261,293 (-) NCBI MGSCv36 mm8 Celera 2 160,474,227 - 160,486,251 (-) NCBI Celera Cytogenetic Map 2 H1 NCBI cM Map 2 76.79 NCBI
E2f1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 27,633,827 - 27,642,241 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 27,638,625 - 27,643,261 (+) NCBI ChiLan1.0 ChiLan1.0
E2F1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 39,366,654 - 39,382,253 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 39,359,755 - 39,370,541 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 29,963,083 - 29,973,860 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 31,103,764 - 31,115,211 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 31,103,764 - 31,110,604 (-) Ensembl panpan1.1 panPan2
E2F1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 22,895,149 - 22,904,689 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 22,878,402 - 22,904,656 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 22,540,395 - 22,549,906 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 23,581,877 - 23,591,392 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 23,581,862 - 23,616,878 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 22,874,367 - 22,883,878 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 22,967,923 - 22,977,434 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 23,399,012 - 23,408,523 (-) NCBI UU_Cfam_GSD_1.0
E2f1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 171,848,495 - 171,859,005 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936561 6,896,063 - 6,900,026 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936561 6,894,827 - 6,901,058 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
E2F1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 37,178,599 - 37,189,883 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 37,178,587 - 37,190,118 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 42,116,195 - 42,125,518 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
E2F1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 37,968,541 - 37,980,461 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 37,968,556 - 37,980,326 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 88,901,404 - 88,913,369 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
E2f1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 216 Count of miRNA genes: 137 Interacting mature miRNAs: 168 Transcripts: ENSRNOT00000022428 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 61335 Bp20 Blood pressure QTL 20 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141339236 155617360 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1331726 Bp208 Blood pressure QTL 208 3.129 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 141339013 162184794 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 5686842 Rf59 Renal function QTL 59 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 3 140069424 146976080 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
D3Mgh29
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 143,087,759 - 143,087,884 (+) MAPPER mRatBN7.2 Rnor_6.0 3 150,086,036 - 150,086,160 NCBI Rnor6.0 Rnor_5.0 3 156,458,570 - 156,458,694 UniSTS Rnor5.0 RGSC_v3.4 3 145,055,522 - 145,055,647 RGD RGSC3.4 RGSC_v3.4 3 145,055,523 - 145,055,647 UniSTS RGSC3.4 RGSC_v3.1 5 151,483,686 - 151,484,060 RGD Celera 3 141,820,568 - 141,820,692 UniSTS SHRSP x BN Map 3 67.6099 RGD SHRSP x BN Map 3 67.6099 UniSTS FHH x ACI Map 3 84.7199 RGD Cytogenetic Map 3 q41 UniSTS
UniSTS:234576
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 143,068,189 - 143,068,402 (+) MAPPER mRatBN7.2 Rnor_6.0 3 150,066,550 - 150,066,762 NCBI Rnor6.0 Rnor_5.0 3 156,439,185 - 156,439,397 UniSTS Rnor5.0 RGSC_v3.4 3 145,036,144 - 145,036,356 UniSTS RGSC3.4 Celera 3 141,802,800 - 141,803,012 UniSTS Cytogenetic Map 3 q41 UniSTS
PMC152357P4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 143,075,010 - 143,075,096 (+) MAPPER mRatBN7.2 Rnor_6.0 3 150,073,371 - 150,073,456 NCBI Rnor6.0 Rnor_5.0 3 156,446,040 - 156,446,125 UniSTS Rnor5.0 RGSC_v3.4 3 145,043,379 - 145,043,464 UniSTS RGSC3.4 Celera 3 141,809,595 - 141,809,680 UniSTS Cytogenetic Map 3 q41 UniSTS
PMC152357P3
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 163,535,408 - 163,535,488 (+) Marker Load Pipeline mRatBN7.2 3 143,075,205 - 143,075,286 (+) MAPPER mRatBN7.2 Rnor_6.0 3 150,073,566 - 150,073,646 NCBI Rnor6.0 Rnor_5.0 3 156,446,235 - 156,446,315 UniSTS Rnor5.0 RGSC_v3.4 3 145,043,574 - 145,043,654 UniSTS RGSC3.4 Celera 3 141,809,790 - 141,809,870 UniSTS Cytogenetic Map 3 q41 UniSTS
E2f1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 143,065,743 - 143,066,412 (+) MAPPER mRatBN7.2 Rnor_6.0 3 150,064,104 - 150,064,772 NCBI Rnor6.0 Rnor_5.0 3 156,436,739 - 156,437,407 UniSTS Rnor5.0 RGSC_v3.4 3 145,033,698 - 145,034,366 UniSTS RGSC3.4 Celera 3 141,800,218 - 141,800,886 UniSTS Cytogenetic Map 3 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022115 ⟹ ENSRNOP00000022115
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 143,049,478 - 143,063,951 (-) Ensembl Rnor_6.0 Ensembl 3 150,047,826 - 150,062,311 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000022428 ⟹ ENSRNOP00000022428
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 143,049,478 - 143,075,361 (-) Ensembl Rnor_6.0 Ensembl 3 150,062,895 - 150,073,721 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000086933 ⟹ ENSRNOP00000070039
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 143,049,478 - 143,063,951 (-) Ensembl Rnor_6.0 Ensembl 3 150,048,341 - 150,064,438 (-) Ensembl
RefSeq Acc Id:
NM_001100778 ⟹ NP_001094248
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 163,524,739 - 163,535,563 (-) NCBI mRatBN7.2 3 143,064,535 - 143,075,361 (-) NCBI Rnor_6.0 3 150,062,895 - 150,073,721 (-) NCBI Rnor_5.0 3 156,435,530 - 156,446,390 (-) NCBI RGSC_v3.4 3 145,032,489 - 145,043,729 (-) RGD Celera 3 141,799,009 - 141,809,945 (-) RGD
Sequence:
GCGGCAAAAAGGATTTGGCGCGTAAAAGTGGCCCGGACTTTGCAGGCAGCGGCGGCCGGGGCGGAGCGGGATCGAGCCCTCGCCGCGGCCTGCCGTCATGGGCCCGCGCCGCCGCCGCCGCCTGCCTC CCGGGCCACGCGGGCCGTGAGTGCCATGGCCGTAGCCCCCGCGGGCGGCCAGCACGCGCCGGCGCTGGAGGCCCTGCTCGGGGCGGGCGCGCTGCGGCTGCTCGACTCCTCGCAGATCGTCATCATCT CCACCGCGCCCGATGTCGGCGCCCCGCAGGTCCCCACCGGCCCCGCCGCGCCGCCCGCTGGCCCTCGAGATCCTGACGTGCTGCTCTTCGCAACGCCGCAGGCGCCCCGACCCGCGCCTAGTGCACCG CGCCCGGCTCTCGGCCGCCCGCCGGTGAAACGGAGGCTGGATCTGGAAACTGACCATCAGTACCTTGCTGGTAGCAGCGGGCCATTCCGGGGCAGAGGCCGCCACCCAGGGAAAGGTGTGAAATCTCC AGGGGAGAAGTCACGCTATGAGACCTCACTAAATCTGACCACCAAACGCTTCTTGGAGCTGCTGAGCCACTCAGCTGATGGTGTTGTTGATCTGAACTGGGCAGCCGAGGTGCTGAAGGTGCAGAAAC GACGCATCTATGACATCACCAATGTCCTGGAGGGCATCCAACTCATTGCCAAGAAGTCCAAGAATCATATCCAGTGGCTAGGCAGCCGCACCATGGTGGGGATCGGTCAGCGGCTTGAAGGCCTGACC CAGGACCTGCAACAACTGCAGGAGAGTGAGCAGCAGCTGGATCACCTGATGCACATCTGTACCACTCAGCTGCAACTGCTTTCTGAGGACTCAGACATCCAGCGCCTGGCCTATGTGACCTGCCAAGA TCTCCGCAGCATTGCAGACCCTGCAGAACAAATGGTCATAGTGATCAAGGCCCCTCCTGAGACCCAACTACAAGCTGTGGATTCTGCAGAGACATTTCAGATCTCCCTTAAGAGCAAACAAGGCCCCA TCGATGTTTTCCTGTGCCCTGAGGAAAGTGCAGAGGGGATTAGCCCTGGGAGGACCTCATACCAGGAGACATCTGGGGAGGACAGGAATGCTGACTCTGGCACAGCAGGGCCTCCACCATCACCTCCC TCCACATCCCCAACCTTGGATCCCAGCCAGTCCCTGTTAGGCCTGGAGCAAGAAGCTGTATTGCCTCGAATAGGCAACCTGAGGGCCCCCATGGAAGAAGACCGGTTGTCACCACTGGTGGCTGCTGA CTCACTCCTGGAGCATGTTAAAGAAGACTTCTCTGGGCTCCTCCCTGGGGAGTTCATCAGCCTTTCCCCACCCCATGAGGCTGTTGACTATCACTTTGGTCTCGAGGAGGGTGAGGGCATTAGAGATC TCTTTGACTGTGACTTTGGGGACTTGACCCCTCTGGATTTCTGACAGAAGCCTAGGGACTCGGTGTCTGGAGATGCCCACCTTGTCTGCTGCAGCTTTGGAGCGTCCTGCCCTGGGCCATCCTTCCTG CCTCGTTGGAATAGCATGATTCATACTCTCTTCTCTGTCCAGTAGCTTCTAGCTCTGGGGTTTGGTTGCTGCCACATTGAGCAGACCAAAGGGGGAGGATGTTGTACAGTGTATGTGCATGCACCCCA TACTGCGCACTGTGTACCTGGGGTGTGTGTGTGTTTATGTGTGTGTATGTGTGTGTGCCGGGGAATGAAGGTGAACACATCTGTATGTGTGCTGCAGACACATCCTGGTGTGTCCACATGTGTGCATG AGTCCATGTGTGCGCATTGGGGTGGGGTGGGCTCTAACAGCACTTTTGGTGTCCTTGCTGCAGGGGCCCTGTGAGGCCCAGGGTGGCTGCCTGCTTCCAGAATCCTGTGTCAGCCAGGCCGGGTGGTG CAGCTTGGCTGACTGGGTTTGCAGGGCAGCAAGAGCACTGCTTAAAGGTTTTCCGATCGAAGCTTTAATGGAACGTTTATTTATTTATCGAGGCCTCTGGCAAACCTGGGGAATAAGCAAAGAGTGGG GAGATGTGGGGGCCGATACCCCAAATCCCTGTTCTCTGAAGCAAGGGCAGGGTCCCCTACTCAAGGAGCTGAGGCCCAAGCAGTTTATTTATTGGGAGAGAGGGAGACAGACTGACAGCCATGGATGG GCTGGAGAAAGTCCCTTTTTAGAAGGTAGTACCAGCACCCTGGCCACATGCATGCATGTGGATCTGAGATGGAGAGGGTGAGTGAGGGCCTTGGCTGATAGGGTGGGCAGGAGGGGTAGATGTGGGTC CCTCCTGTGGTTGGAGCGCTCCACTGCCCTTCCCACTGGCCAGTCTGCACTTTGGTTTATTTTCTAACAGTTCTGTTCCCTCCTGCTTTGATTTTTAATAAATATTTTGATGGTGTTAGGCTGGGTTG GGGACTCTGTGAGGCTAGTGTTGGGGGGAATGTTCATTCCCTGTACCTGACTTAATTTCCTTTCAATTTGTAACCCCTTGAGAAGAGGAAAACTGACCAAGTGATGGGTAGGAGATTATGTGTGTTAC CTAAGTACAGAAAAGTGTCAGTCTGCTTGTTGCGCACCTTCTGGTCATTTCTGAGCATTAGTAAAGATGCAACACACAGTGAA
hide sequence
RefSeq Acc Id:
XM_039105617 ⟹ XP_038961545
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 163,526,006 - 163,535,560 (-) NCBI mRatBN7.2 3 143,065,806 - 143,075,362 (-) NCBI
RefSeq Acc Id:
NP_001094248 ⟸ NM_001100778
- UniProtKB:
O09139 (UniProtKB/Swiss-Prot), A6KHZ9 (UniProtKB/TrEMBL), A0A8L2QBV4 (UniProtKB/TrEMBL)
- Sequence:
MAVAPAGGQHAPALEALLGAGALRLLDSSQIVIISTAPDVGAPQVPTGPAAPPAGPRDPDVLLFATPQAPRPAPSAPRPALGRPPVKRRLDLETDHQYLAGSSGPFRGRGRHPGKGVKSPGEKSRYET SLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSRTMVGIGQRLEGLTQDLQQLQESEQQLDHLMHICTTQLQLLSEDSDIQRLAYVTCQDLRSIADPA EQMVIVIKAPPETQLQAVDSAETFQISLKSKQGPIDVFLCPEESAEGISPGRTSYQETSGEDRNADSGTAGPPPSPPSTSPTLDPSQSLLGLEQEAVLPRIGNLRAPMEEDRLSPLVAADSLLEHVKE DFSGLLPGEFISLSPPHEAVDYHFGLEEGEGIRDLFDCDFGDLTPLDF
hide sequence
Ensembl Acc Id:
ENSRNOP00000022428 ⟸ ENSRNOT00000022428
Ensembl Acc Id:
ENSRNOP00000022115 ⟸ ENSRNOT00000022115
Ensembl Acc Id:
ENSRNOP00000070039 ⟸ ENSRNOT00000086933
RefSeq Acc Id:
XP_038961545 ⟸ XM_039105617
- Peptide Label:
isoform X1
RGD ID: 13692575
Promoter ID: EPDNEW_R3100
Type: single initiation site
Name: E2f1_1
Description: E2F transcription factor 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 150,073,687 - 150,073,747 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-12-14
E2f1
E2F transcription factor 1
Symbol and Name status set to approved
1299863
APPROVED
Note Type
Note
Reference
gene_disease
associated with atherosclerosis, hypertension, and restenosis after injury
625751
gene_expression
expressed in vascular smooth muscle cells, fibroblasts and Saos-2 cell line
625751
gene_function
transcription factor
625751
gene_process
controls G1/S transition of eukaryotic cells by monitoring the regulation of transcription of growth-related genes
625751
gene_process
involved in induction of S phase progression in quiescent cells
625751
gene_product
member of transcriptional factor family
625751
gene_regulation
RNA expression levels were downregulated in quiescent cells
625751
gene_regulation
fetal bovine serum [FBS] induced upregulation of E2f1 mRNA and protein levels by inducing free E2f1 binding onto its promoter
625751