Advanced Search (OLGA)

Gene: Kcnh4 (potassium voltage-gated channel subfamily H member 4) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Kcnh4

Name:

potassium voltage-gated channel subfamily H member 4

RGD ID:

621415

Description:

Predicted to enable voltage-gated potassium channel activity. Predicted to be involved in potassium ion transmembrane transport and regulation of membrane potential. Predicted to be part of monoatomic ion channel complex. Predicted to be active in plasma membrane. Orthologous to human KCNH4 (potassium voltage-gated channel subfamily H member 4); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Bec2; brain-specific eag-like channel 2; ELK channel 1; ether-a-go-go-like potassium channel 1; potassium channel, voltage gated eag related subfamily H, member 4; potassium voltage-gated channel, subfamily H (eag-related), member 4; rElk1; voltage-gated delayed rectifier potassium channel KCNH4; voltage-gated potassium channel subunit Kv12.3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	86,168,644 - 86,188,476 (-)	NCBI		GRCr8
mRatBN7.2	10	85,668,332 - 85,688,166 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	85,668,337 - 85,688,158 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	90,704,832 - 90,724,673 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	90,183,647 - 90,203,518 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	85,576,570 - 85,596,400 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	88,645,341 - 88,667,447 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	88,647,575 - 88,667,345 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	88,441,734 - 88,461,598 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	89,677,981 - 89,697,799 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	89,692,350 - 89,712,169 (-)	NCBI
Celera	10	84,383,783 - 84,403,601 (-)	NCBI		Celera
Cytogenetic Map	10	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnh4	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Kcnh4 (Mus musculus)	6480464	bisphenol S results in decreased expression of KCNH4 mRNA	CTD	PMID:30951980
Kcnh4	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	Kcnh4 (Mus musculus)	6480464	bisphenol S results in increased methylation of KCNH4 exon	CTD	PMID:33297965
Kcnh4	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of KCNH4 mRNA	CTD	PMID:24780913
Kcnh4	Rat	acrylamide	affects expression	EXP		6480464	Acrylamide affects the expression of KCNH4 mRNA	CTD	PMID:28959563
Kcnh4	Rat	all-trans-retinoic acid	increases expression	ISO	KCNH4 (Homo sapiens)	6480464	Tretinoin results in increased expression of KCNH4 mRNA	CTD	PMID:33167477
Kcnh4	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of KCNH4 mRNA	CTD	PMID:16483693
Kcnh4	Rat	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of KCNH4 mRNA	CTD	PMID:21839799
Kcnh4	Rat	benzo[a]pyrene	affects methylation	ISO	KCNH4 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of KCNH4 promoter	CTD	PMID:27901495
Kcnh4	Rat	benzo[a]pyrene	increases methylation	ISO	KCNH4 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of KCNH4 exon	CTD	PMID:27901495
Kcnh4	Rat	benzo[e]pyrene	increases methylation	ISO	KCNH4 (Homo sapiens)	6480464	benzo(e)pyrene results in increased methylation of KCNH4 intron	CTD	PMID:30157460
Kcnh4	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of KCNH4 mRNA	CTD	PMID:25181051 and PMID:30816183
Kcnh4	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of KCNH4 mRNA	CTD	PMID:34947998
Kcnh4	Rat	bisphenol A	decreases expression	ISO	Kcnh4 (Mus musculus)	6480464	bisphenol A results in decreased expression of KCNH4 mRNA	CTD	PMID:30951980
Kcnh4	Rat	bisphenol F	decreases expression	ISO	Kcnh4 (Mus musculus)	6480464	bisphenol F results in decreased expression of KCNH4 mRNA	CTD	PMID:30951980
Kcnh4	Rat	CGP 52608	multiple interactions	ISO	KCNH4 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to KCNH4 gene]	CTD	PMID:28238834
Kcnh4	Rat	chlorpyrifos	increases expression	ISO	Kcnh4 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of KCNH4 mRNA	CTD	PMID:32715474
Kcnh4	Rat	disodium selenite	decreases expression	ISO	KCNH4 (Homo sapiens)	6480464	Sodium Selenite results in decreased expression of KCNH4 mRNA	CTD	PMID:18175754
Kcnh4	Rat	ethanol	decreases expression	EXP		6480464	Ethanol results in decreased expression of KCNH4 mRNA	CTD	PMID:15353170
Kcnh4	Rat	ethanol	affects expression	ISO	Kcnh4 (Mus musculus)	6480464	Ethanol affects the expression of KCNH4 mRNA	CTD	PMID:30319688
Kcnh4	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of KCNH4 mRNA	CTD	PMID:33387578
Kcnh4	Rat	ivermectin	increases expression	ISO	KCNH4 (Homo sapiens)	6480464	Ivermectin results in increased expression of KCNH4 protein	CTD	PMID:32959892
Kcnh4	Rat	manganese(II) chloride	decreases expression	EXP		6480464	manganese chloride results in decreased expression of KCNH4 mRNA	CTD	PMID:28801915
Kcnh4	Rat	methapyrilene	increases methylation	ISO	KCNH4 (Homo sapiens)	6480464	Methapyrilene results in increased methylation of KCNH4 intron	CTD	PMID:30157460
Kcnh4	Rat	ozone	decreases expression	ISO	Kcnh4 (Mus musculus)	6480464	Ozone results in decreased expression of KCNH4 mRNA	CTD	PMID:33026818
Kcnh4	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of KCNH4 mRNA	CTD	PMID:33387578
Kcnh4	Rat	resveratrol	multiple interactions	ISO	KCNH4 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of KCNH4 mRNA	CTD	PMID:23557933
Kcnh4	Rat	sodium arsenite	increases expression	ISO	KCNH4 (Homo sapiens)	6480464	sodium arsenite results in increased expression of KCNH4 mRNA	CTD	PMID:29301061 and PMID:34032870
Kcnh4	Rat	titanium dioxide	increases methylation	ISO	Kcnh4 (Mus musculus)	6480464	titanium dioxide results in increased methylation of KCNH4 promoter	CTD	PMID:35295148
Kcnh4	Rat	titanium dioxide	decreases methylation	ISO	Kcnh4 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of KCNH4 gene	CTD	PMID:35295148
Kcnh4	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of KCNH4 mRNA	CTD	PMID:33387578
Kcnh4	Rat	triptonide	increases expression	ISO	Kcnh4 (Mus musculus)	6480464	triptonide results in increased expression of KCNH4 mRNA	CTD	PMID:33045310
Kcnh4	Rat	valproic acid	increases methylation	ISO	KCNH4 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of KCNH4 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnh4	Rat	monoatomic ion transmembrane transport	involved_in	IEA	UniProtKB-KW:KW-0407 and UniProtKB-KW:KW-0851	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnh4	Rat	monoatomic ion transport	involved_in	IEA	InterPro:IPR005821	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnh4	Rat	monoatomic ion transport	involved_in	IEA	UniProtKB-KW:KW-0406	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnh4	Rat	potassium ion transmembrane transport	involved_in	IEA	UniProtKB-KW:KW-0631	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnh4	Rat	potassium ion transmembrane transport	involved_in	IBA	MGI:1341721 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnh4	Rat	potassium ion transport	involved_in	IEA	InterPro:IPR003938 and InterPro:IPR003950	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnh4	Rat	potassium ion transport	involved_in	IEA	UniProtKB-KW:KW-0633	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnh4	Rat	regulation of membrane potential	involved_in	IBA	MGI:1341722 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnh4	Rat	transmembrane transport	involved_in	IEA	InterPro:IPR005821	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnh4	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnh4	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Kcnh4	Rat	membrane	located_in	IEA	InterPro:IPR003938 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnh4	Rat	monoatomic ion channel complex	part_of	IEA	UniProtKB-KW:KW-0851	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnh4	Rat	plasma membrane	is_active_in	IBA	FB:FBgn0000535 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnh4	Rat	monoatomic ion channel activity	enables	IEA	InterPro:IPR005821	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnh4	Rat	potassium channel activity	enables	IEA	UniProtKB-KW:KW-0631	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnh4	Rat	voltage-gated potassium channel activity	enables	IEA	ARBA:ARBA00026458	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Kcnh4	Rat	voltage-gated potassium channel activity	enables	IBA	FB:FBgn0000535 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnh4	Rat	voltage-gated potassium channel activity	enables	IEA	InterPro:IPR003938 and InterPro:IPR003950	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	New ether-a-go-go K(+) channel family members localized in human telencephalon.	Miyake A, etal., J Biol Chem 1999 Aug 27;274(35):25018-25.
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:9824707	PMID:11425889

Kcnh4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	86,168,644 - 86,188,476 (-)	NCBI		GRCr8
mRatBN7.2	10	85,668,332 - 85,688,166 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	85,668,337 - 85,688,158 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	90,704,832 - 90,724,673 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	90,183,647 - 90,203,518 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	85,576,570 - 85,596,400 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	88,645,341 - 88,667,447 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	88,647,575 - 88,667,345 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	88,441,734 - 88,461,598 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	89,677,981 - 89,697,799 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	89,692,350 - 89,712,169 (-)	NCBI
Celera	10	84,383,783 - 84,403,601 (-)	NCBI		Celera
Cytogenetic Map	10	q31	NCBI

KCNH4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	42,156,891 - 42,181,142 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	42,156,891 - 42,181,142 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	40,308,909 - 40,333,160 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	37,562,439 - 37,586,822 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	37,562,438 - 37,586,822	NCBI
Celera	17	36,964,227 - 36,987,523 (-)	NCBI		Celera
Cytogenetic Map	17	q21.2	NCBI
HuRef	17	36,074,129 - 36,098,412 (-)	NCBI		HuRef
CHM1_1	17	40,544,659 - 40,569,024 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	43,013,376 - 43,037,630 (-)	NCBI		T2T-CHM13v2.0

Kcnh4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	100,631,204 - 100,650,941 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	100,631,202 - 100,650,768 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	100,740,378 - 100,760,115 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	100,740,376 - 100,759,942 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	100,601,692 - 100,621,092 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	100,557,693 - 100,575,695 (-)	NCBI		MGSCv36	mm8
Celera	11	111,356,922 - 111,376,327 (-)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	63.57	NCBI

Kcnh4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	16,217,021 - 16,233,800 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955451	16,217,021 - 16,233,789 (-)	NCBI	ChiLan1.0	ChiLan1.0

KCNH4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	22,802,808 - 22,827,185 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	24,692,975 - 24,717,299 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	15,134,728 - 15,159,108 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	15,357,446 - 15,380,835 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	15,357,446 - 15,378,419 (+)	Ensembl	panpan1.1		panPan2

KCNH4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	20,734,519 - 20,752,571 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	20,734,450 - 20,751,274 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	20,195,546 - 20,213,631 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	21,453,317 - 21,471,395 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	21,453,504 - 21,471,395 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	20,238,622 - 20,256,699 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	20,505,729 - 20,523,821 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	20,608,782 - 20,626,863 (+)	NCBI		UU_Cfam_GSD_1.0

Kcnh4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	20,070,345 - 20,088,495 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	16,987,832 - 17,004,644 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	16,988,137 - 17,004,461 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KCNH4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	64,088,084 - 64,112,963 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	64,088,290 - 64,110,096 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	34,902,748 - 34,925,126 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kcnh4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624795	1,748,233 - 1,763,209 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624795	1,748,211 - 1,763,100 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Kcnh4
71 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	176
Count of miRNA genes:	113
Interacting mature miRNAs:	127
Transcripts:	ENSRNOT00000025518
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
631555	Bp134	Blood pressure QTL 134		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	80515287	91230079	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
4889948	Bss91	Bone structure and strength QTL 91	4		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	10	82564856	92369470	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	74372084	94965338	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	78775516	98279596	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
10450495	Bp383	Blood pressure QTL 383		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	94965338	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2292617	Ept18	Estrogen-induced pituitary tumorigenesis QTL 18	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	66743655	98003205	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61345276	98211570	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	80515287	101325465	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
2306793	Ean5	Experimental allergic neuritis QTL 5	4.7		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	72552416	93995749	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	84022321	93995963	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	78899655	87307728	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61345276	99703528	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61345276	99703528	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
12880055	Am11	Aortic mass QTL 11		0.004	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	84007272	95933025	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2301398	Kidm38	Kidney mass QTL 38		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	84007272	95933025	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat
1358188	Ept9	Estrogen-induced pituitary tumorigenesis QTL 9	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	75631887	87055282	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	5	113	48	47	17	25	17	6	85	48	93	13	58	30


RefSeq Transcripts	NM_053630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017596947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017596948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB022699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ007628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025518 ⟹ ENSRNOP00000025518

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	85,668,337 - 85,688,158 (-)	Ensembl
Rnor_6.0 Ensembl	10	88,647,575 - 88,667,345 (-)	Ensembl

RefSeq Acc Id:

NM_053630 ⟹ NP_446082

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	86,168,644 - 86,188,476 (-)	NCBI
mRatBN7.2	10	85,668,332 - 85,688,166 (-)	NCBI
Rnor_6.0	10	88,647,564 - 88,667,382 (-)	NCBI
Rnor_5.0	10	88,441,734 - 88,461,598 (-)	NCBI
RGSC_v3.4	10	89,677,981 - 89,697,799 (-)	RGD
Celera	10	84,383,783 - 84,403,601 (-)	RGD

Sequence:

show sequence

CAGGCAGCGGCGGCGAGAGGAGGGGAGGAGGCAGGCCGGCGCATGGGGCGCCCCGGCCCCGCCGGTAGCGCGCCCCCTCCGGCCAGGCCGCGCTGAACGCAGCCCGCGCAACGCCTCGAATTCGTACC
CGGGGCCATGCCGGTCATGAAGGGGTTGCTGGCCCCGCAAAACACCTTTCTGGACACCATCGCCACTCGCTTTGACGGCACGCACAGCAACTTTCTTCTGGCCAATGCCCAGGGCCCACGGGGTTTTC
CCATCGTCTACTGCTCTGACGGCTTCTGTGAGCTCACAGGCTACGGCCGCACCGAGGTCATGCAGAAAACCTGTAGCTGCCGGTTCCTCTATGGCCCAGAGACCAGTGAGCCGGCCTTGCAACGGTTA
CAAAAAGCCCTGGAGGGCCACCAAGAACACAGAGCTGAAATCTGCTTTTACCGAAAGGATGGCTCGGCCTTTTGGTGTCTTCTGGACATGATGCCCATCAAAAATGAGCTGGGGGAGGTGGTGCTTTT
CCTATTTTCCTTTAAGGACATCTCTCAGAGTGGAGGCCCAGGACTTGGCTCACCAGGGATCCATGGGGACAATAATAATCATGAAAACTCCCTTGGGAGGAGAGGAGCTAGCTCAAGACTTAGGTCCA
CGAGGAGGCAGAACCGGACAGTTCTACACCGGTTGACTGGCCACTTTGGTCGCCGGGACCAGGGAAGCGTGAAAGCCAATAGTAACGTGTTTGAGCCAAAGCCATCAGTGCCTGAGTACAAAGTGGCC
TCCGTGGGGGGCTCCCGCTGCCTGCTCCTCCACTACAGCATCCCCAAGGCTGTCTGGGACGGTCTCATCCTTCTCGCTACGTTCTACGTCGCGGTCACCGTCCCTTACAACGTCTGCTTCGCTGGTGA
TGACGACACCCCCATCACGTCCCGACACACCCTTGTCAGTGACATCGCTGTGGAGATGCTCTTCATCCTGGACATCATCTTGAACTTCCGCACCACCTACGTGTCCCAGTCGGGCCAGGTGGTTTCTG
CTCCTCGGTCCATTGGCCTCCACTACCTGGCCACCTGGTTCTTCGTGGACCTCATTGCTGCTTTGCCCTTTGACCTGCTGTATGTCTTCAACATCACTGTGACCTCGCTGGTACATCTGCTGAAAACC
GTGCGGCTCCTGCGGTTGCTGAGGCTGCTGCAGAAGCTAGAGCGGTACTCTCAGTGCAGCGCGGTGGTGCTCACGCTGCTCATGTCCGTCTTTGCACTCCTTGCCCACTGGATGGCCTGCGTCTGGTA
TGTCATCGGGCGCCGGGAGATGGAGGCCAATGACCCGCTGCTCTGGGACATTGGTTGGTTGCATGAGCTGGGTAAGCGGCTGGAGGAGCCTTATGTCAATGGCTCGGCCGGTGGACCATCTCGGCGCA
GTGCCTACATCGCCGCGCTGTACTTCACGCTGAGCAGCCTCACCAGTGTAGGCTTCGGCAACGTTTGTGCCAACACTGACGCTGAGAAGATCTTCTCCATCTGCACGATGCTCATAGGCGCGCTGATG
CACGCGGTGGTGTTTGGGAATGTCACAGCCATCATCCAGCGCATGTACTCCCGACGCTCGCTCTACCACAGCCGCATGAAGGATCTCAAGGACTTCATCCGAGTGCATCGTCTGCCCCGCCCACTCAA
GCAGCGCATGCTCGAGTACTTCCAGACTACATGGGCCGTCAACAGCGGCATCGATGCCAACGAGTTACTGCGTGACTTCCCGGATGAGCTGCGAGCTGACATCGCCATGCACCTGAATCGGGAGATCC
TGCAGCTGCCTTTGTTTGGAGCAGCAAGCAGGGGCTGCCTTCGTGCCCTCTCCCTGCACATCAAGACCTCATTTTGTGCTCCTGGGGAGTTCCTGCTACGCCGTGGGGATGCCCTGCAGGCACACTAC
TATGTCTGCTCTGGCTCTCTTGAGGTGCTCCGAGACAACACGGTGCTGGCCATCCTTGGAAAGGGGGACTTGATTGGGGCAGACATCCCTGAGTTGGGGCAGGAGCCTGGGGCAGGGGCAGGCTGCGT
GCTGAAGACCAGCGCTGATGTGAAAGCACTGACTTACTGCGGCCTGCAGCAGCTGAGCAGCCGAGGGCTGGCCGAGGTCCTTCGGTTGTATCCGGAATATGTGGCTGCCTTCAGGGCTGGCCTACCCC
GGGACCTAACCTTCAACCTGCGCCAAGGCTCTGAAAACAATGGCCTCGGCCGCTTCTCACGTTCTCCTCGACTCTCCCAGGCACGCTCCGACACTCTTGGTTCCTCCTCAGACAAGACTCTGCCATCC
ATCACAGAAACCGAGGGTGGCATGGAGCCTGGGGCTGGTTCCAAGCCCCGTCGGCCCCTCCTGCTGCCCAACCTCAGTCCAGCACGACCTCGGGGGTCCCTGGTCAGCCTTTTGGGCGAAGAGCTGCC
CCCATTCTCAGCCCTTGTCTCCTCTCCTTCCCTGTCCCCAACTCCTTCCCCTGCCCTGGCTGGCCGGGGTTCAAGTCCCTCCCTGCACGGGCCCCCCAGGGGCTCTGCTGCCTGGAAGCCCCCCCAGC
TCCTCACCCCCCCACTGGGAACATTTGGACCTCCGGACCTCAGTCCCCGGATCGTGGATGGCATTGAGGACTCCAGTAACACAGCTGAGGCTCCTACATTCCGGTTCAGCAAGAGGCCGGAGCCCACC
AGAACCCGTTCACAGGCTCCCCTTTCAGGCCCTAGGCTCAGCCGGGAACTGGCCACAGAGGCAGCAGAGGAGGTGAAGGAAAAGGTCTGCAGGCTGAACCAAGAGATTTCCAGACTCAACCAGGAAGT
GTCTCAGCTGAGCCGGGAGCTTCGCCAAGTGATGGGCCTCTTACAGGCCAGGCTGGGTCCCCCAAGTCACCCACCTGACTCCACTTGGCTCCCAGACCTTCCTTGTCCCCATCAGAGACCGCCATGCA
TCTCTCCTCATATGTCTGGACCTCCACCTGGTCTCCAGAATACTACACTTGCTGTAGTCCACTGTCCAGCCAGTGTTGGGACAGTGGAGATAGGGGCCACCCCCTCAGAGCTGAGGTCTTCCATGGTG
CCACCCTTTCCCTCAGAACCTGATCCTCTTGGACCCTCTCCAGTGCCAGAGGCTTCTCCTCTGACCCCAAGCCTCCTGAAGCACAGCTTCCAGTCTGGGTCAGACACATTCCACTGACCCTGGCCTTG
GGCCCAGGCCTGTCTGGGGTGGGCTTAATTACCTGCCATCCAGGGAGGAGCTGGGCTCCTTGGCCTCTTGCCTTGGGGTCAGCAGCTGCCAGCTGGTCTGGTTGGCTCTGGATTCTCTGGACTTTTTA
ACAATGAGTGGCCACATCTAACCCCGTTCCATTTTCTAAACCATCCCCCCCACCCGTCCTACTCTTGTGGGAGGGGAGTCACCTGAAGCCGTGGAATCCAGCAGGCATGAAATGGACCATGGTGCCCT
GTTGGGCTACGCAGAGGAGATGTCTTACTTTCTCCCCACGACTTGGAGGCTGTCATGCAAGGTGGTCCCTTCTGCTGCCAGCAGCTCAAAGCATTCTAGCTTTACCCTTCTGCAGTTCCCACCTCCAA
ACATCAGTCATATCTGCCCCCCTCCCTCCCAACATGGTCTCGACCTCAATGAGGATCTGGGCAACTCACAAACCCTCTCTGGTTTCCAGCTCCCCTTTCTCACTAAACACCCCAGGCTCACTTTTGGA
TAGAAAATAAATCCATATATTTTT

hide sequence


Protein RefSeqs	NP_446082	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA83593	(Get FASTA)	NCBI Sequence Viewer
	CAA07587	(Get FASTA)	NCBI Sequence Viewer
	EDM06063	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025518
GenBank Protein	Q9R1T9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446082 ⟸ NM_053630

- UniProtKB:

A6HJ58 (UniProtKB/TrEMBL), F1LRG4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEVMQKTCSCRFLYGPETSEPALQRLQKALEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNELGEVVLFLF
SFKDISQSGGPGLGSPGIHGDNNNHENSLGRRGASSRLRSTRRQNRTVLHRLTGHFGRRDQGSVKANSNVFEPKPSVPEYKVASVGGSRCLLLHYSIPKAVWDGLILLATFYVAVTVPYNVCFAGDDD
TPITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVVSAPRSIGLHYLATWFFVDLIAALPFDLLYVFNITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAVVLTLLMSVFALLAHWMACVWYVI
GRREMEANDPLLWDIGWLHELGKRLEEPYVNGSAGGPSRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHSRMKDLKDFIRVHRLPRPLKQR
MLEYFQTTWAVNSGIDANELLRDFPDELRADIAMHLNREILQLPLFGAASRGCLRALSLHIKTSFCAPGEFLLRRGDALQAHYYVCSGSLEVLRDNTVLAILGKGDLIGADIPELGQEPGAGAGCVLK
TSADVKALTYCGLQQLSSRGLAEVLRLYPEYVAAFRAGLPRDLTFNLRQGSENNGLGRFSRSPRLSQARSDTLGSSSDKTLPSITETEGGMEPGAGSKPRRPLLLPNLSPARPRGSLVSLLGEELPPF
SALVSSPSLSPTPSPALAGRGSSPSLHGPPRGSAAWKPPQLLTPPLGTFGPPDLSPRIVDGIEDSSNTAEAPTFRFSKRPEPTRTRSQAPLSGPRLSRELATEAAEEVKEKVCRLNQEISRLNQEVSQ
LSRELRQVMGLLQARLGPPSHPPDSTWLPDLPCPHQRPPCISPHMSGPPPGLQNTTLAVVHCPASVGTVEIGATPSELRSSMVPPFPSEPDPLGPSPVPEASPLTPSLLKHSFQSGSDTFH

hide sequence

Ensembl Acc Id:

ENSRNOP00000025518 ⟸ ENSRNOT00000025518

Protein Domains

Cyclic nucleotide-binding PAC PAS

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9R1T9-F1-model_v2	AlphaFold	Q9R1T9	1-1017	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-23217	BioCyc
Ensembl Genes	ENSRNOG00000018790	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000025518	ENTREZGENE
Gene3D-CATH	1.10.1200.260	UniProtKB/Swiss-Prot
	1.10.287.70	UniProtKB/Swiss-Prot
	2.60.120.10	UniProtKB/Swiss-Prot
	PAS domain	UniProtKB/Swiss-Prot
InterPro	cNMP-bd-like	UniProtKB/Swiss-Prot
	cNMP-bd_dom	UniProtKB/Swiss-Prot
	Ion_trans_dom	UniProtKB/Swiss-Prot
	K_chnl_volt-dep_EAG/ELK/ERG	UniProtKB/Swiss-Prot
	K_chnl_volt-dep_ELK	UniProtKB/Swiss-Prot
	KCNH_channel	UniProtKB/Swiss-Prot
	PAC	UniProtKB/Swiss-Prot
	PAS	UniProtKB/Swiss-Prot
	PAS-assoc_C	UniProtKB/Swiss-Prot
	PAS-like_dom_sf	UniProtKB/Swiss-Prot
	RmlC-like_jellyroll	UniProtKB/Swiss-Prot
KEGG Report	rno:114032	UniProtKB/Swiss-Prot
NCBI Gene	114032	ENTREZGENE
PANTHER	POTASSIUM VOLTAGE-GATED CHANNEL SUBFAMILY H MEMBER 4	UniProtKB/Swiss-Prot
	VOLTAGE AND LIGAND GATED POTASSIUM CHANNEL	UniProtKB/Swiss-Prot
Pfam	Ion_trans	UniProtKB/Swiss-Prot
	PAS_9	UniProtKB/Swiss-Prot
PhenoGen	Kcnh4	PhenoGen
PRINTS	EAGCHANLFMLY	UniProtKB/Swiss-Prot
	ELKCHANNEL	UniProtKB/Swiss-Prot
PROSITE	CNMP_BINDING_3	UniProtKB/Swiss-Prot
	PAC	UniProtKB/Swiss-Prot
	PAS	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018790	RatGTEx
SMART	cNMP	UniProtKB/Swiss-Prot
	PAC	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF51206	UniProtKB/Swiss-Prot
	SSF55785	UniProtKB/Swiss-Prot
	Voltage-gated potassium channels	UniProtKB/Swiss-Prot
UniProt	A6HJ58	ENTREZGENE, UniProtKB/TrEMBL
	F1LRG4	ENTREZGENE, UniProtKB/TrEMBL
	KCNH4_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	O89048	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Kcnh4	potassium voltage-gated channel subfamily H member 4	Kcnh4	potassium channel, voltage gated eag related subfamily H, member 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-01-26	Kcnh4	potassium channel, voltage gated eag related subfamily H, member 4	Kcnh4	potassium voltage-gated channel, subfamily H (eag-related), member 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Kcnh4	potassium voltage-gated channel, subfamily H (eag-related), member 4			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Kcnh4	potassium voltage-gated channel, subfamily H (eag-related), member 4			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_function	human homologue functions as a channel gene	70783

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message