Symbol:
Acads
Name:
acyl-CoA dehydrogenase short chain
RGD ID:
620514
Description:
Enables FAD binding activity; acyl-CoA dehydrogenase activity; and protein homodimerization activity. Involved in fatty acid catabolic process; response to glucocorticoid; and response to starvation. Located in mitochondrial matrix and mitochondrial membrane. Human ortholog(s) of this gene implicated in alcohol use disorder and short chain acyl-CoA dehydrogenase deficiency. Orthologous to human ACADS (acyl-CoA dehydrogenase short chain); PARTICIPATES IN fatty acid beta degradation pathway; 3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway; 3-hydroxyacyl-CoA dehydrogenase deficiency pathway; INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
acetyl-Coenzyme A dehydrogenase, short chain; acyl-CoA dehydrogenase, C-2 to C-3 short chain; acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain; acyl-Coenzyme A dehydrogenase, short chain; butyryl-CoA dehydrogenase; Scad; short chain acyl-coenzyme A dehydrogenase; short-chain acyl-CoA dehydrogenase; short-chain specific acyl-CoA dehydrogenase, mitochondrial
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ACADS (acyl-CoA dehydrogenase short chain) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Acads (acyl-Coenzyme A dehydrogenase, short chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Acads (acyl-CoA dehydrogenase short chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ACADS (acyl-CoA dehydrogenase short chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ACADS (acyl-CoA dehydrogenase short chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Acads (acyl-CoA dehydrogenase short chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ACADS (acyl-CoA dehydrogenase short chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ACADS (acyl-CoA dehydrogenase short chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Acads (acyl-CoA dehydrogenase short chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ACADS (acyl-CoA dehydrogenase short chain)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Acads (acyl-Coenzyme A dehydrogenase, short chain)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
acads (acyl-CoA dehydrogenase short chain)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Arc42
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG4860
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
acads
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Candidate Gene For:
Bw128 Foco6 Foco10
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 47,154,259 - 47,163,580 (+) NCBI GRCr8 mRatBN7.2 12 41,493,650 - 41,502,897 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 41,493,626 - 41,502,898 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 42,661,140 - 42,670,447 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 43,274,797 - 43,284,104 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 42,335,363 - 42,344,671 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 47,254,503 - 47,263,747 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 47,254,484 - 47,263,747 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 49,049,549 - 49,059,164 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 42,765,284 - 42,774,528 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 42,628,671 - 42,637,916 (+) NCBI Celera 12 43,112,383 - 43,121,613 (+) NCBI Celera Cytogenetic Map 12 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Acads Rat genetic disease ISO RGD:732202 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:11134486|PMID:12736383|PMID:14506246|PMID:16546179|PMID:1692038|PMID:16926354|PMID:18054510|PMID:18523805|PMID:18676165|PMID:19800078|PMID:19952864|PMID:21170680|PMID:21483766|PMID:21938826|PMID:22241096|PMID:22424739|PMID:23798014|PMID:24033266|PMID:24485985|PMID:25741868|PMID:26055667|PMID:27051597|PMID:2808706|PMID:28454995|PMID:28492532|PMID:31813752|PMID:32793418|PMID:9499414|PMID:9582344 Acads Rat maturity-onset diabetes of the young type 1 ISO RGD:732202 8554872 ClinVar Annotator: match by term: Type 2 diabetes mellitus ClinVar PMID:18523805|PMID:25741868|PMID:28492532 Acads Rat short chain acyl-CoA dehydrogenase deficiency ISO RGD:732202 8554872 ClinVar Annotator: match by term: ACADS-related condition | ClinVar Annotator: match by term: Deficiency of more ... ClinVar PMID:11134486|PMID:12736383|PMID:12872838|PMID:14506246|PMID:14568186|PMID:14595061|PMID:16199547|PMID:16546179|PMID:16906473|PMID:1692038|PMID:16926354|PMID:17576681|PMID:18054510|PMID:185223805|PMID:18523805|PMID:18676165|PMID:18836889|PMID:18951053|PMID:19800078|PMID:19952864|PMID:20376488|PMID:20389114|PMID:21170680|PMID:21325261|PMID:21483766|PMID:21500142|PMID:21938826|PMID:22241096|PMID:22424739|PMID:23155713|PMID:23798014|PMID:24033266|PMID:24485985|PMID:25741868|PMID:26055667|PMID:26274329|PMID:27051597|PMID:27466294|PMID:27938594|PMID:28018444|PMID:2808706|PMID:28263315|PMID:28374236|PMID:28454995|PMID:28492532|PMID:28516284|PMID:28532786|PMID:29519241|PMID:29678161|PMID:30035407|PMID:30612563|PMID:30626930|PMID:31813752|PMID:31847883|PMID:31980526|PMID:32447334|PMID:32710939|PMID:32778825|PMID:32793418|PMID:32802992|PMID:33391346|PMID:33895855|PMID:34394177|PMID:34426522|PMID:34869113|PMID:35095998|PMID:35193651|PMID:36207829|PMID:9499414|PMID:9536098|PMID:9582344 Acads Rat type 2 diabetes mellitus ISO RGD:732202 8554872 ClinVar Annotator: match by term: Type 2 diabetes mellitus ClinVar PMID:18523805|PMID:25741868|PMID:28492532
Only show annotations with direct experimental evidence (0 objects hidden)
Acads Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ACADS mRNA] CTD PMID:31150632 Acads Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:732203 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ACADS mRNA CTD PMID:36331819 Acads Rat 1,2-dimethylhydrazine increases expression ISO RGD:732203 6480464 1,2-Dimethylhydrazine results in increased expression of ACADS mRNA CTD PMID:22206623 Acads Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:732203 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of ACADS mRNA] CTD PMID:22206623 Acads Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of ACADS mRNA CTD PMID:29097150 Acads Rat 17beta-estradiol increases expression ISO RGD:732203 6480464 Estradiol results in increased expression of ACADS mRNA CTD PMID:19693291 Acads Rat 2,2',5,5'-tetrachlorobiphenyl affects expression ISO RGD:732202 6480464 2,5,2',5'-tetrachlorobiphenyl affects the expression of ACADS mRNA CTD PMID:21703328 Acads Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO RGD:732202 6480464 2,5,2',5'-tetrachlorobiphenyl results in increased expression of ACADS mRNA CTD PMID:21703328 Acads Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ACADS mRNA CTD PMID:21215274 Acads Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:732203 6480464 Tetrachlorodibenzodioxin affects the expression of ACADS mRNA CTD PMID:21570461 Acads Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of ACADS mRNA CTD PMID:21346803 Acads Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:732203 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of ACADS mRNA CTD PMID:38648751 Acads Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:732203 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of ACADS mRNA CTD PMID:20188158 Acads Rat 3,5-diethoxycarbonyl-1,4-dihydrocollidine decreases expression ISO RGD:732203 6480464 3,5-diethoxycarbonyl-1,4-dihydrocollidine results in decreased expression of ACADS mRNA CTD PMID:20512997 Acads Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin analog results in decreased expression of ACADS protein; alpha-Chlorohydrin results in decreased expression of more ... CTD PMID:26597043 Acads Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:732203 6480464 bisphenol S results in increased expression of ACADS mRNA CTD PMID:39298647 Acads Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:732202 6480464 bisphenol S results in increased expression of ACADS protein CTD PMID:34186270 Acads Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:732203 6480464 Fenretinide results in decreased expression of ACADS mRNA CTD PMID:28973697 Acads Rat 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime increases expression ISO RGD:732202 6480464 6-(4-chlorophenyl)imidazo(2,1-b)(1,3)thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime results in increased expression of ACADS mRNA CTD PMID:30611723 Acads Rat 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime multiple interactions ISO RGD:732202 6480464 [6-(4-chlorophenyl)imidazo(2,1-b)(1,3)thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime co-treated with Oleic Acid] results in increased expression of ACADS mRNA CTD PMID:30611723 Acads Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ACADS mRNA CTD PMID:24780913 Acads Rat acadesine multiple interactions EXP 6480464 acadesine inhibits the reaction [tert-Butylhydroperoxide results in decreased expression of ACADS mRNA]; acadesine inhibits the more ... CTD PMID:26989860 Acads Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of ACADS mRNA CTD PMID:31881176 Acads Rat aflatoxin B1 decreases expression ISO RGD:732202 6480464 Aflatoxin B1 results in decreased expression of ACADS mRNA CTD PMID:27153756 Acads Rat aflatoxin B1 increases methylation ISO RGD:732202 6480464 Aflatoxin B1 results in increased methylation of ACADS gene CTD PMID:27153756 Acads Rat Aflatoxin B2 alpha increases methylation ISO RGD:732202 6480464 aflatoxin B2 results in increased methylation of ACADS polyA tail CTD PMID:30157460 Acads Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ACADS mRNA CTD PMID:16483693 Acads Rat arsane affects methylation ISO RGD:732202 6480464 Arsenic affects the methylation of ACADS gene CTD PMID:25304211 Acads Rat arsenic atom affects methylation ISO RGD:732202 6480464 Arsenic affects the methylation of ACADS gene CTD PMID:25304211 Acads Rat aspartame multiple interactions ISO RGD:732203 6480464 [Fats, Unsaturated co-treated with Aspartame] affects the expression of ACADS mRNA; [Fats, Unsaturated co-treated with more ... CTD PMID:23783067 Acads Rat atrazine increases expression ISO RGD:732202 6480464 Atrazine results in increased expression of ACADS mRNA CTD PMID:22378314 Acads Rat Azoxymethane multiple interactions ISO RGD:732203 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ACADS more ... CTD PMID:29950665 Acads Rat benzo[a]pyrene affects methylation ISO RGD:732202 6480464 Benzo(a)pyrene affects the methylation of ACADS polyA tail CTD PMID:30157460 Acads Rat benzo[a]pyrene increases methylation ISO RGD:732202 6480464 Benzo(a)pyrene results in increased methylation of ACADS 3' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Acads Rat beta-hexachlorocyclohexane decreases expression ISO RGD:732202 6480464 beta-hexachlorocyclohexane results in decreased expression of ACADS mRNA; beta-hexachlorocyclohexane results in decreased expression of ACADS more ... CTD PMID:28397872 Acads Rat beta-hexachlorocyclohexane decreases expression ISO RGD:732203 6480464 beta-hexachlorocyclohexane results in decreased expression of ACADS mRNA; beta-hexachlorocyclohexane results in decreased expression of ACADS more ... CTD PMID:28397872 Acads Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:732203 6480464 Diethylhexyl Phthalate results in decreased expression of ACADS mRNA CTD PMID:34319233|PMID:35550907 Acads Rat bisphenol A multiple interactions EXP 6480464 [Fructose co-treated with bisphenol A] results in decreased expression of ACADS protein CTD PMID:26930160 Acads Rat bisphenol A increases expression ISO RGD:732202 6480464 bisphenol A results in increased expression of ACADS protein CTD PMID:37567409 Acads Rat bisphenol A multiple interactions ISO RGD:732202 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of ACADS gene CTD PMID:31601247 Acads Rat bisphenol A increases expression ISO RGD:732203 6480464 bisphenol A results in increased expression of ACADS mRNA CTD PMID:32156529|PMID:33221593 Acads Rat bisphenol A decreases expression ISO RGD:732202 6480464 bisphenol A analog results in decreased expression of ACADS mRNA; bisphenol A results in decreased more ... CTD PMID:32763284|PMID:34186270 Acads Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ACADS mRNA CTD PMID:25181051|PMID:32145629|PMID:34947998 Acads Rat bisphenol AF increases expression ISO RGD:732202 6480464 bisphenol AF results in increased expression of ACADS protein CTD PMID:34186270 Acads Rat Bisphenol B increases expression ISO RGD:732202 6480464 bisphenol B results in increased expression of ACADS protein CTD PMID:34186270 Acads Rat bisphenol F increases expression ISO RGD:732203 6480464 bisphenol F results in increased expression of ACADS mRNA CTD PMID:38685157 Acads Rat bisphenol F increases expression ISO RGD:732202 6480464 bisphenol F results in increased expression of ACADS protein CTD PMID:34186270 Acads Rat cadmium atom multiple interactions ISO RGD:732202 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ACADS more ... CTD PMID:35301059 Acads Rat cadmium dichloride decreases expression ISO RGD:732202 6480464 Cadmium Chloride results in decreased expression of ACADS mRNA CTD PMID:38568856 Acads Rat cadmium dichloride multiple interactions ISO RGD:732202 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ACADS more ... CTD PMID:35301059 Acads Rat carbon nanotube increases expression ISO RGD:732203 6480464 Nanotubes, Carbon analog results in increased expression of ACADS mRNA CTD PMID:25554681 Acads Rat chenodeoxycholic acid multiple interactions ISO RGD:732203 6480464 Chenodeoxycholic Acid inhibits the reaction [[Methionine deficiency co-treated with Choline deficiency] results in decreased expression more ... CTD PMID:27773935 Acads Rat choline multiple interactions ISO RGD:732203 6480464 [Methionine deficiency co-treated with Choline deficiency] results in decreased expression of ACADS mRNA; alisol A more ... CTD PMID:27773935 Acads Rat clofibrate decreases expression ISO RGD:732203 6480464 Clofibrate results in decreased expression of ACADS mRNA CTD PMID:17585979 Acads Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of ACADS mRNA; Clofibrate results in increased expression of ACADS more ... CTD PMID:16470657|PMID:18670166|PMID:35720 Acads Rat clofibrate multiple interactions ISO RGD:732203 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ACADS mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Acads Rat copper(II) sulfate decreases expression ISO RGD:732202 6480464 Copper Sulfate results in decreased expression of ACADS mRNA CTD PMID:19549813 Acads Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of ACADS mRNA CTD PMID:27523638 Acads Rat cyproconazole decreases expression ISO RGD:732202 6480464 cyproconazole results in decreased expression of ACADS mRNA CTD PMID:39207506 Acads Rat DDE decreases expression ISO RGD:732202 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of ACADS protein CTD PMID:28397872 Acads Rat dextran sulfate multiple interactions ISO RGD:732203 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ACADS more ... CTD PMID:29950665 Acads Rat Dibutyl phosphate affects expression ISO RGD:732202 6480464 di-n-butylphosphoric acid affects the expression of ACADS mRNA CTD PMID:37042841 Acads Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ACADS mRNA CTD PMID:17379624|PMID:21266533 Acads Rat dioscin multiple interactions EXP 6480464 dioscin inhibits the reaction [Ethanol results in decreased expression of ACADS protein] CTD PMID:24146112 Acads Rat dioscin multiple interactions ISO RGD:732203 6480464 dioscin inhibits the reaction [Ethanol results in decreased expression of ACADS protein] CTD PMID:24146112 Acads Rat doxorubicin decreases expression ISO RGD:732203 6480464 Doxorubicin results in decreased expression of ACADS mRNA CTD PMID:26873546 Acads Rat elemental selenium multiple interactions ISO RGD:732202 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of ACADS mRNA CTD PMID:19244175 Acads Rat elemental selenium increases expression ISO RGD:732202 6480464 Selenium results in increased expression of ACADS mRNA CTD PMID:19244175 Acads Rat ethanol decreases expression ISO RGD:732203 6480464 Ethanol results in decreased expression of ACADS protein CTD PMID:24146112 Acads Rat ethanol increases expression ISO RGD:732203 6480464 Ethanol results in increased expression of ACADS mRNA CTD PMID:30319688 Acads Rat ethanol multiple interactions EXP 6480464 dioscin inhibits the reaction [Ethanol results in decreased expression of ACADS protein] CTD PMID:24146112 Acads Rat ethanol multiple interactions ISO RGD:732203 6480464 dioscin inhibits the reaction [Ethanol results in decreased expression of ACADS protein] CTD PMID:24146112 Acads Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of ACADS protein CTD PMID:24146112 Acads Rat farnesol multiple interactions ISO RGD:732202 6480464 [Farnesol analog co-treated with Oleic Acid] results in increased expression of ACADS mRNA CTD PMID:30611723 Acads Rat farnesol increases expression ISO RGD:732202 6480464 Farnesol analog results in increased expression of ACADS mRNA CTD PMID:30611723 Acads Rat fenamidone increases expression ISO RGD:732203 6480464 fenamidone results in increased expression of ACADS mRNA CTD PMID:27029645 Acads Rat fenofibrate multiple interactions EXP 6480464 Fenofibrate inhibits the reaction [ACADS protein affects the cleavage of CASP3 protein]; Fenofibrate inhibits the more ... CTD PMID:26989860 Acads Rat flutamide affects expression EXP 6480464 Flutamide affects the expression of ACADS mRNA CTD PMID:21525395 Acads Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ACADS protein CTD PMID:17311803 Acads Rat folic acid multiple interactions ISO RGD:732203 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of ACADS mRNA] CTD PMID:22206623 Acads Rat fructose multiple interactions EXP 6480464 [Fructose co-treated with bisphenol A] results in decreased expression of ACADS protein CTD PMID:26930160 Acads Rat fulvestrant multiple interactions ISO RGD:732202 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of ACADS gene CTD PMID:31601247 Acads Rat furan affects binding EXP 6480464 furan binds to ACADS protein CTD PMID:22240984 Acads Rat furan decreases expression EXP 6480464 furan results in decreased expression of ACADS mRNA CTD PMID:26194646 Acads Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of ACADS mRNA CTD PMID:24136188 Acads Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of ACADS mRNA CTD PMID:24915197 Acads Rat gold atom multiple interactions ISO RGD:732202 6480464 [Polyethyleneimine binds to Gold] which results in decreased expression of ACADS mRNA CTD PMID:28433809 Acads Rat gold(0) multiple interactions ISO RGD:732202 6480464 [Polyethyleneimine binds to Gold] which results in decreased expression of ACADS mRNA CTD PMID:28433809 Acads Rat guggulsterone multiple interactions ISO RGD:732203 6480464 pregna-4,17-diene-3,16-dione inhibits the reaction [alisol A 24-acetate inhibits the reaction [[Methionine deficiency co-treated with Choline more ... CTD PMID:27773935 Acads Rat GW 4064 increases expression ISO RGD:732202 6480464 GW 4064 results in increased expression of ACADS mRNA CTD PMID:30611723 Acads Rat GW 4064 multiple interactions ISO RGD:732202 6480464 [GW 4064 co-treated with Oleic Acid] results in decreased expression of ACADS mRNA CTD PMID:30611723 Acads Rat GW 7647 increases expression ISO RGD:732202 6480464 GW 7647 results in increased expression of ACADS mRNA CTD PMID:30611723 Acads Rat GW 7647 multiple interactions ISO RGD:732202 6480464 [GW 7647 co-treated with Oleic Acid] results in increased expression of ACADS mRNA CTD PMID:30611723 Acads Rat hypochlorous acid decreases expression ISO RGD:732203 6480464 Hypochlorous Acid results in decreased expression of ACADS mRNA CTD PMID:19376150 Acads Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of ACADS mRNA CTD PMID:36868495 Acads Rat isoprenaline decreases expression EXP 6480464 Isoproterenol results in decreased expression of ACADS mRNA CTD PMID:30303030 Acads Rat isoprenaline multiple interactions EXP 6480464 [Isoproterenol co-treated with POSTN protein] results in decreased expression of ACADS mRNA CTD PMID:30303030 Acads Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of ACADS mRNA CTD PMID:37077353 Acads Rat L-methionine multiple interactions ISO RGD:732203 6480464 [Methionine deficiency co-treated with Choline deficiency] results in decreased expression of ACADS mRNA; alisol A more ... CTD PMID:27773935 Acads Rat maneb multiple interactions ISO RGD:732203 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ACADS mRNA; Melatonin inhibits the reaction more ... CTD PMID:23963992 Acads Rat melatonin multiple interactions ISO RGD:732203 6480464 Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of ACADS mRNA] CTD PMID:23963992 Acads Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of ACADS mRNA CTD PMID:16393664 Acads Rat methidathion decreases expression ISO RGD:732203 6480464 methidathion results in decreased expression of ACADS mRNA CTD PMID:34813904 Acads Rat mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of ACADS mRNA CTD PMID:22087261 Acads Rat monosodium L-glutamate multiple interactions ISO RGD:732203 6480464 [Fats, Unsaturated co-treated with Sodium Glutamate co-treated with Aspartame] affects the expression of ACADS mRNA; more ... CTD PMID:19001666|PMID:23783067 Acads Rat N-nitrosomorpholine decreases expression EXP 6480464 N-nitrosomorpholine results in decreased expression of ACADS protein CTD PMID:19716841 Acads Rat okadaic acid decreases expression ISO RGD:732202 6480464 Okadaic Acid results in decreased expression of ACADS mRNA CTD PMID:38832940 Acads Rat oleic acid multiple interactions ISO RGD:732202 6480464 [6-(4-chlorophenyl)imidazo(2,1-b)(1,3)thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime co-treated with Oleic Acid] results in increased expression of ACADS mRNA; [Farnesol analog more ... CTD PMID:30611723 Acads Rat oleic acid increases expression ISO RGD:732202 6480464 Oleic Acid results in increased expression of ACADS mRNA CTD PMID:30611723 Acads Rat paracetamol multiple interactions ISO RGD:732203 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ACADS mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Acads Rat paracetamol decreases expression ISO RGD:732202 6480464 Acetaminophen results in decreased expression of ACADS mRNA CTD PMID:29067470 Acads Rat paraquat multiple interactions ISO RGD:732203 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ACADS mRNA; Melatonin inhibits the reaction more ... CTD PMID:23963992 Acads Rat perfluorooctane-1-sulfonic acid affects expression ISO RGD:732203 6480464 perfluorooctane sulfonic acid affects the expression of ACADS mRNA CTD PMID:19429403 Acads Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:732203 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ACADS mRNA CTD PMID:36331819 Acads Rat perfluorooctane-1-sulfonic acid increases expression ISO RGD:732202 6480464 perfluorooctane sulfonic acid results in increased expression of ACADS mRNA CTD PMID:27153767 Acads Rat perfluorooctanoic acid affects expression ISO RGD:732203 6480464 perfluorooctanoic acid affects the expression of ACADS mRNA CTD PMID:19429403 Acads Rat phenobarbital increases expression ISO RGD:732203 6480464 Phenobarbital results in increased expression of ACADS mRNA CTD PMID:19270015 Acads Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in decreased expression of ACADS mRNA CTD PMID:33945839 Acads Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of ACADS mRNA CTD PMID:19162173 Acads Rat pirinixic acid increases expression ISO RGD:732203 6480464 pirinixic acid results in increased expression of ACADS mRNA CTD PMID:16357043|PMID:17426115|PMID:18301758|PMID:23811191 Acads Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in increased expression of ACADS mRNA CTD PMID:26923065 Acads Rat propiconazole decreases expression ISO RGD:732203 6480464 propiconazole results in decreased expression of ACADS mRNA CTD PMID:21278054 Acads Rat resveratrol increases expression ISO RGD:732203 6480464 resveratrol results in increased expression of ACADS mRNA; resveratrol results in increased expression of ACADS more ... CTD PMID:22610192|PMID:25505154 Acads Rat selenium atom multiple interactions ISO RGD:732202 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of ACADS mRNA CTD PMID:19244175 Acads Rat selenium atom increases expression ISO RGD:732202 6480464 Selenium results in increased expression of ACADS mRNA CTD PMID:19244175 Acads Rat silicon dioxide decreases expression ISO RGD:732202 6480464 Silicon Dioxide analog results in decreased expression of ACADS mRNA CTD PMID:25895662 Acads Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of ACADS protein CTD PMID:29459688 Acads Rat sunitinib decreases expression ISO RGD:732202 6480464 Sunitinib results in decreased expression of ACADS mRNA CTD PMID:31533062 Acads Rat tert-butyl hydroperoxide increases expression ISO RGD:732203 6480464 tert-Butylhydroperoxide results in increased expression of ACADS mRNA CTD PMID:15003993 Acads Rat tert-butyl hydroperoxide multiple interactions EXP 6480464 acadesine inhibits the reaction [tert-Butylhydroperoxide results in decreased expression of ACADS mRNA]; acadesine inhibits the more ... CTD PMID:26989860 Acads Rat tert-butyl hydroperoxide decreases expression EXP 6480464 tert-Butylhydroperoxide results in decreased expression of ACADS mRNA CTD PMID:26989860 Acads Rat testosterone increases expression ISO RGD:732203 6480464 Testosterone results in increased expression of ACADS mRNA CTD PMID:19693291 Acads Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of ACADS mRNA CTD PMID:12734012 Acads Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ACADS mRNA] CTD PMID:31150632 Acads Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ACADS mRNA CTD PMID:31150632 Acads Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ACADS mRNA CTD PMID:23411599|PMID:34492290 Acads Rat titanium dioxide decreases expression ISO RGD:732203 6480464 titanium dioxide results in decreased expression of ACADS mRNA CTD PMID:23557971 Acads Rat titanium dioxide decreases methylation ISO RGD:732203 6480464 titanium dioxide results in decreased methylation of ACADS gene CTD PMID:35295148 Acads Rat titanium dioxide multiple interactions ISO RGD:732203 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ACADS more ... CTD PMID:29950665 Acads Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ACADS mRNA CTD PMID:19448997 Acads Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of ACADS protein CTD PMID:21315101 Acads Rat urethane decreases expression ISO RGD:732202 6480464 Urethane results in decreased expression of ACADS mRNA CTD PMID:28818685 Acads Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of ACADS mRNA CTD PMID:23034163 Acads Rat vitamin E multiple interactions ISO RGD:732202 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of ACADS mRNA CTD PMID:19244175 Acads Rat vitamin E increases expression ISO RGD:732202 6480464 Vitamin E results in increased expression of ACADS mRNA CTD PMID:19244175 Acads Rat zinc atom increases expression ISO RGD:732202 6480464 Zinc results in increased expression of ACADS mRNA CTD PMID:15226459 Acads Rat zinc sulfate increases expression ISO RGD:732202 6480464 Zinc Sulfate results in increased expression of ACADS mRNA CTD PMID:15226459 Acads Rat zinc(0) increases expression ISO RGD:732202 6480464 Zinc results in increased expression of ACADS mRNA CTD PMID:15226459
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO) 6-propyl-2-thiouracil (EXP) acadesine (EXP) acetamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) aspartame (ISO) atrazine (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) beta-hexachlorocyclohexane (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) chenodeoxycholic acid (ISO) choline (ISO) clofibrate (EXP,ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyproconazole (ISO) DDE (ISO) dextran sulfate (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dioscin (EXP,ISO) doxorubicin (ISO) elemental selenium (ISO) ethanol (EXP,ISO) farnesol (ISO) fenamidone (ISO) fenofibrate (EXP) flutamide (EXP) folic acid (ISO) fructose (EXP) fulvestrant (ISO) furan (EXP) glafenine (EXP) glycidol (EXP) gold atom (ISO) gold(0) (ISO) guggulsterone (ISO) GW 4064 (ISO) GW 7647 (ISO) hypochlorous acid (ISO) indometacin (EXP) isoprenaline (EXP) ketoconazole (EXP) L-methionine (ISO) maneb (ISO) melatonin (ISO) methapyrilene (EXP) methidathion (ISO) mono(2-ethylhexyl) phthalate (EXP) monosodium L-glutamate (ISO) N-nitrosomorpholine (EXP) okadaic acid (ISO) oleic acid (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) PhIP (EXP) pirinixic acid (EXP,ISO) poly(I:C) (EXP) propiconazole (ISO) resveratrol (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (EXP) sunitinib (ISO) tert-butyl hydroperoxide (EXP,ISO) testosterone (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) troglitazone (EXP) urethane (ISO) vinclozolin (EXP) vitamin E (ISO) zinc atom (ISO) zinc sulfate (ISO) zinc(0) (ISO)
1.
Functional role of the active site glutamate-368 in rat short chain acyl-CoA dehydrogenase.
Battaile KP, etal., Biochemistry. 1996 Dec 3;35(48):15356-63.
2.
Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
Battaile KP, etal., J Biol Chem 2002 Apr 5;277(14):12200-7.
3.
The influence of chylomicron remnants on cholesteryl ester metabolism in cultured rat hepatocytes: comparison of the effects of particles enriched in n-3 or n-6 polyunsaturated fatty acids.
Botham KM, etal., Biochim Biophys Acta. 2001 Dec 30;1534(2-3):96-109.
4.
Treatment of metritis in cattle with prostaglandin F2 alpha.
Coulson A Vet Rec 1978 Oct 14;103(16):359.
5.
[Effect of truncal vagotomy on the exocrine function of the pancreas in the dog]
Dabrowski Z, etal., Pol Tyg Lek 1978 Jul 10;33(28):1093-5.
6.
Redesigning the active-site of an acyl-CoA dehydrogenase: new evidence supporting a one-base mechanism.
Dakoji S, etal., Bioorg Med Chem. 1997 Dec;5(12):2157-64.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Acyl-CoA dehydrogenases. A mechanistic overview.
Ghisla S and Thorpe C, Eur J Biochem. 2004 Feb;271(3):494-508.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
Biosynthesis of four rat liver mitochondrial acyl-CoA dehydrogenases: in vitro synthesis, import into mitochondria, and processing of their precursors in a cell-free system and in cultured cells.
Ikeda Y, etal., Arch Biochem Biophys. 1987 Feb 1;252(2):662-74.
11.
Purification and characterization of short-chain, medium-chain, and long-chain acyl-CoA dehydrogenases from rat liver mitochondria. Isolation of the holo- and apoenzymes and conversion of the apoenzyme to the holoenzyme.
Ikeda Y, etal., J Biol Chem. 1985 Jan 25;260(2):1311-25.
12.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
13.
Importance of acyl-coenzyme A:cholesterol acyltransferase 1/2 dual inhibition for anti-atherosclerotic potency of pactimibe.
Kitayama K, etal., Eur J Pharmacol. 2006 Jul 1;540(1-3):121-30. Epub 2006 Apr 29.
14.
Circadian clock gene polymorphisms in alcohol use disorders and alcohol consumption.
Kovanen L, etal., Alcohol Alcohol. 2010 Jul-Aug;45(4):303-11. doi: 10.1093/alcalc/agq035. Epub 2010 Jun 16.
15.
Molecular cloning and nucleotide sequence of cDNAs encoding the precursors of rat long chain acyl-coenzyme A, short chain acyl-coenzyme A, and isovaleryl-coenzyme A dehydrogenases. Sequence homology of four enzymes of the acyl-CoA dehydrogenase family.
Matsubara Y, etal., J Biol Chem 1989 Sep 25;264(27):16321-31.
16.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
17.
Developmental, nutritional, and hormonal regulation of tissue-specific expression of the genes encoding various acyl-CoA dehydrogenases and alpha-subunit of electron transfer flavoprotein in rat.
Nagao M, etal., J Biol Chem. 1993 Nov 15;268(32):24114-24.
18.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
19.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
20.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
21.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
22.
A novel short-chain alcohol dehydrogenase from rats with retinol dehydrogenase activity, cyclically expressed in uterine epithelium.
Rexer BN and Ong DE, Biol Reprod 2002 Nov;67(5):1555-64.
23.
GOA pipeline
RGD automated data pipeline
24.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
25.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
26.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Acads Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 47,154,259 - 47,163,580 (+) NCBI GRCr8 mRatBN7.2 12 41,493,650 - 41,502,897 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 41,493,626 - 41,502,898 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 42,661,140 - 42,670,447 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 43,274,797 - 43,284,104 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 42,335,363 - 42,344,671 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 47,254,503 - 47,263,747 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 47,254,484 - 47,263,747 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 49,049,549 - 49,059,164 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 42,765,284 - 42,774,528 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 42,628,671 - 42,637,916 (+) NCBI Celera 12 43,112,383 - 43,121,613 (+) NCBI Celera Cytogenetic Map 12 q16 NCBI
ACADS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 120,725,826 - 120,740,008 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 120,725,774 - 120,740,008 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 121,163,629 - 121,177,811 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 119,648,050 - 119,662,193 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 119,626,385 - 119,640,530 NCBI Celera 12 120,797,834 - 120,812,046 (+) NCBI Celera Cytogenetic Map 12 q24.31 NCBI HuRef 12 118,172,924 - 118,187,098 (+) NCBI HuRef CHM1_1 12 121,132,346 - 121,146,588 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 120,714,964 - 120,729,131 (+) NCBI T2T-CHM13v2.0
Acads Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 115,248,358 - 115,257,405 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 115,248,358 - 115,257,405 (-) Ensembl GRCm39 Ensembl GRCm38 5 115,110,299 - 115,119,346 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 115,110,299 - 115,119,346 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 115,560,308 - 115,569,322 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 115,371,298 - 115,380,312 (-) NCBI MGSCv36 mm8 Celera 5 112,206,409 - 112,215,487 (-) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 55.99 NCBI
Acads Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955455 10,928,560 - 10,942,926 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955455 10,928,560 - 10,942,748 (-) NCBI ChiLan1.0 ChiLan1.0
ACADS Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 128,794,025 - 128,810,226 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 128,790,398 - 128,806,613 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 118,309,303 - 118,323,489 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 121,682,113 - 121,696,376 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 121,682,113 - 121,696,376 (+) Ensembl panpan1.1 panPan2
ACADS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 16,572,936 - 16,584,760 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 16,572,947 - 16,584,194 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 16,574,053 - 16,587,252 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 16,837,490 - 16,850,715 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 16,837,499 - 16,850,713 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 16,798,031 - 16,811,155 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 16,873,738 - 16,886,985 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 16,916,088 - 16,929,300 (+) NCBI UU_Cfam_GSD_1.0
Acads
ACADS Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 40,642,881 - 40,659,081 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 40,642,810 - 40,656,922 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 43,110,578 - 43,124,662 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 14 q16.2-q23.2 NCBI
ACADS Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 116,083,156 - 116,096,554 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 116,083,276 - 116,096,607 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 129,000,614 - 129,013,678 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Acads
.
Predicted Target Of
Count of predictions: 186 Count of miRNA genes: 128 Interacting mature miRNAs: 139 Transcripts: ENSRNOT00000001556 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 8693635 Alc28 Alcohol consumption QTL 28 2.7 0.439 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 44726024 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 1300162 Bp188 Blood pressure QTL 188 3.19 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 32103174 45899022 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 1600386 Calcic2 Intracellular calcium level QTL 2 0.001 platelet physiology trait (VT:0005464) platelet intracellular calcium level (CMO:0000922) 12 28064433 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1300175 Cm5 Cardiac mass QTL 5 3.78 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 12 28064433 45899022 Rat 8693658 Alc33 Alcohol consumption QTL 33 2.1 0.68 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 43551788 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat
RH134326
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 41,502,526 - 41,502,724 (+) MAPPER mRatBN7.2 Rnor_6.0 12 47,263,377 - 47,263,574 NCBI Rnor6.0 Rnor_5.0 12 49,058,793 - 49,058,990 UniSTS Rnor5.0 RGSC_v3.4 12 42,774,158 - 42,774,355 UniSTS RGSC3.4 Celera 12 43,121,243 - 43,121,440 UniSTS RH 3.4 Map 12 777.83 UniSTS Cytogenetic Map 12 q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001556 ⟹ ENSRNOP00000001556
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 41,493,626 - 41,502,898 (+) Ensembl Rnor_6.0 Ensembl 12 47,254,484 - 47,263,747 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000098620 ⟹ ENSRNOP00000093188
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 41,494,674 - 41,502,898 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102388 ⟹ ENSRNOP00000084893
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 41,493,631 - 41,502,897 (+) Ensembl
RefSeq Acc Id:
NM_022512 ⟹ NP_071957
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 47,154,333 - 47,163,579 (+) NCBI mRatBN7.2 12 41,493,650 - 41,502,897 (+) NCBI Rnor_6.0 12 47,254,503 - 47,263,747 (+) NCBI Rnor_5.0 12 49,049,549 - 49,059,164 (+) NCBI RGSC_v3.4 12 42,765,284 - 42,774,528 (+) RGD Celera 12 43,112,383 - 43,121,613 (+) RGD
Sequence:
TCAGGAGGTCCCGGAGGTCTGTGCCCATGGCCATGGCCGCTGCGTTGCTCGCCCGGGCCGGTGGCTCTCTCGGCAGAGCTCTCCGCGCTCGAGATTGGCGAAGATTACATACTGTTTACCAGTCTGTG
hide sequence
RefSeq Acc Id:
XM_063271614 ⟹ XP_063127684
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 47,154,259 - 47,163,580 (+) NCBI
RefSeq Acc Id:
NP_071957 ⟸ NM_022512
- Peptide Label:
precursor
- UniProtKB:
P15651 (UniProtKB/Swiss-Prot), Q6IMX3 (UniProtKB/TrEMBL)
- Sequence:
MAMAAALLARAGGSLGRALRARDWRRLHTVYQSVELPETHQMLRQTCRDFAEKELVPIAAQLDKEHLFPTSQVKKMGELGLLAMDVPEELSGAGLDYLAYSIALEEISRGCASTGVIMSVNNSLYLGP
hide sequence
Ensembl Acc Id:
ENSRNOP00000001556 ⟸ ENSRNOT00000001556
Ensembl Acc Id:
ENSRNOP00000093188 ⟸ ENSRNOT00000098620
Ensembl Acc Id:
ENSRNOP00000084893 ⟸ ENSRNOT00000102388
RefSeq Acc Id:
XP_063127684 ⟸ XM_063271614
- Peptide Label:
isoform X1
- UniProtKB:
P15651 (UniProtKB/Swiss-Prot), F7F6Q6 (UniProtKB/TrEMBL)
RGD ID: 13698702 Promoter ID: EPDNEW_R9226 Type: initiation region Name: Acads_1 Description: acyl-CoA dehydrogenase short chain SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 47,254,466 - 47,254,526 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-10-09
Acads
acyl-CoA dehydrogenase short chain
Acads
acyl-CoA dehydrogenase, C-2 to C-3 short chain
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-07-28
Acads
acyl-CoA dehydrogenase, C-2 to C-3 short chain
Acads
acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-08-29
Acads
acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain
Acads
acyl-Coenzyme A dehydrogenase, short chain
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-22
Acads
acyl-Coenzyme A dehydrogenase, short chain
Acads
acetyl-Coenzyme A dehydrogenase, short chain
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-11-17
Acads
acetyl-Coenzyme A dehydrogenase, short chain
acyl-coenzyme A dehydrogenase, short chain
Name updated
1299863 APPROVED
2005-01-20
Acads
acyl-coenzyme A dehydrogenase, short chain
short chain acyl-coenzyme A dehydrogenase
Name updated
1299863 APPROVED
2002-08-07
Acads
short chain acyl-coenzyme A dehydrogenase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_product
member of the acyl CoA dehydrogenase family
631718
