Symbol:
Nfyb
Name:
nuclear transcription factor Y subunit beta
RGD ID:
3172
Description:
Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; DNA-binding transcription factor binding activity; and sequence-specific DNA binding activity. Predicted to contribute to RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within cellular response to leukemia inhibitory factor and positive regulation of DNA-templated transcription. Part of CCAAT-binding activity factor complex. Orthologous to human NFYB (nuclear transcription factor Y subunit beta); PARTICIPATES IN altered p53 signaling pathway; antigen processing and presentation pathway; tuberculosis pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CAAT box DNA-binding protein subunit B; CAAT-box DNA-binding protein subunit B; CBF-A; CBF-B; CBFB; CCAAT binding transcription factor of CBF-B/NFY-B; CCAAT-binding transcription factor subunit A; CCAAT-binding transcription factor subunit B; MGC108654; NF-YB; Nfya; nuclear transcription factor - Y beta; nuclear transcription factor Y subunit B; nuclear transcription factor-Y beta
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NFYB (nuclear transcription factor Y subunit beta)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Nfyb (nuclear transcription factor-Y beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nfyb (nuclear transcription factor Y subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NFYB (nuclear transcription factor Y subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NFYB (nuclear transcription factor Y subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nfyb (nuclear transcription factor Y subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NFYB (nuclear transcription factor Y subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NFYB (nuclear transcription factor Y subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nfyb (nuclear transcription factor Y subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DMBT1 (deleted in malignant brain tumors 1)
HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Nfyb (nuclear transcription factor-Y beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NFYB (nuclear transcription factor Y subunit beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nfyba (nuclear transcription factor Y, beta a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nfybb (nuclear transcription factor Y, beta b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
HAP3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Nf-YB
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
nfyb-1
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nfyb
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 22,852,543 - 22,868,116 (+) NCBI GRCr8 mRatBN7.2 7 20,964,988 - 20,980,569 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 20,964,993 - 20,980,565 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 22,939,228 - 22,954,797 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 25,101,932 - 25,117,500 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 24,879,005 - 24,894,574 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 27,081,667 - 27,097,481 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 27,081,667 - 27,097,479 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 27,200,204 - 27,216,018 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 23,190,295 - 23,205,611 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 23,210,565 - 23,225,880 (+) NCBI Celera 7 18,145,883 - 18,161,286 (+) NCBI Celera Cytogenetic Map 7 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nfyb Rat (-)-epigallocatechin 3-gallate multiple interactions ISO NFYB (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of NFYB mRNA CTD PMID:22079256 Nfyb Rat (S)-nicotine decreases expression ISO NFYB (Homo sapiens) 6480464 Nicotine results in decreased expression of NFYB mRNA CTD PMID:18247414 Nfyb Rat 1,2-dichloroethane decreases expression ISO Nfyb (Mus musculus) 6480464 ethylene dichloride results in decreased expression of NFYB mRNA CTD PMID:28189721 and PMID:28960355 Nfyb Rat 1,2-dimethylhydrazine decreases expression ISO Nfyb (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NFYB mRNA CTD PMID:22206623 Nfyb Rat 17alpha-ethynylestradiol multiple interactions ISO Nfyb (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NFYB mRNA CTD PMID:17942748 Nfyb Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Nfyb (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Nfyb Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Nfyb (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Nfyb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nfyb (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NFYB mRNA CTD PMID:21570461 and PMID:24058054 Nfyb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NFYB mRNA CTD PMID:34747641 Nfyb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Nfyb (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NFYB mRNA CTD PMID:16214954 more ... Nfyb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NFYB mRNA CTD PMID:22298810 Nfyb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NFYB mRNA CTD PMID:21215274 and PMID:33387578 Nfyb Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Nfyb (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NFYB mRNA more ... CTD PMID:16214954 more ... Nfyb Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of NFYB mRNA CTD PMID:21346803 Nfyb Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of NFYB mRNA CTD PMID:21346803 Nfyb Rat 2-naphthylamine decreases expression ISO NFYB (Homo sapiens) 6480464 2-Naphthylamine results in decreased expression of NFYB mRNA CTD PMID:18247414 Nfyb Rat 3,4-methylenedioxymethamphetamine increases methylation ISO Nfyb (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of NFYB promoter CTD PMID:26251327 Nfyb Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Nfyb (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of NFYB mRNA CTD PMID:26251327 Nfyb Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO NFYB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NFYB mRNA CTD PMID:28628672 Nfyb Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of NFYB mRNA CTD PMID:19162173 Nfyb Rat 4-hydroxyphenyl retinamide increases expression ISO Nfyb (Mus musculus) 6480464 Fenretinide results in increased expression of NFYB mRNA CTD PMID:28973697 Nfyb Rat 5-fluorouracil affects expression ISO Nfyb (Mus musculus) 6480464 Fluorouracil affects the expression of NFYB mRNA CTD PMID:20421339 Nfyb Rat 5-fluorouracil multiple interactions ISO NFYB (Homo sapiens) 6480464 Fluorouracil promotes the reaction [NFYB protein binds to UBE2C promoter] and TP53 protein mutant form affects the reaction [Fluorouracil promotes the reaction [NFYB protein binds to UBE2C promoter]] CTD PMID:27129209 Nfyb Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of NFYB mRNA CTD PMID:28959563 Nfyb Rat aflatoxin B1 increases expression ISO Nfyb (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of NFYB mRNA CTD PMID:19770486 Nfyb Rat aflatoxin M1 decreases expression ISO NFYB (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of NFYB mRNA CTD PMID:30928695 Nfyb Rat all-trans-retinoic acid affects expression ISO Nfyb (Mus musculus) 6480464 Tretinoin affects the expression of NFYB mRNA CTD PMID:20421339 Nfyb Rat all-trans-retinoic acid decreases expression ISO NFYB (Homo sapiens) 6480464 Tretinoin results in decreased expression of NFYB mRNA CTD PMID:15498508 more ... Nfyb Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of NFYB mRNA CTD PMID:38685447 Nfyb Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NFYB mRNA CTD PMID:16483693 Nfyb Rat antirheumatic drug increases expression ISO NFYB (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of NFYB mRNA CTD PMID:24449571 Nfyb Rat aristolochic acid A decreases expression ISO NFYB (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of NFYB mRNA CTD PMID:33212167 Nfyb Rat Aroclor 1254 decreases expression ISO Nfyb (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of NFYB mRNA CTD PMID:23650126 Nfyb Rat arsenite(3-) multiple interactions ISO NFYB (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to NFYB mRNA] CTD PMID:32406909 Nfyb Rat benzo[a]pyrene decreases expression ISO NFYB (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of NFYB mRNA CTD PMID:18247414 Nfyb Rat benzo[a]pyrene increases methylation ISO NFYB (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NFYB promoter CTD PMID:27901495 Nfyb Rat benzo[a]pyrene increases expression ISO Nfyb (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NFYB mRNA CTD PMID:19770486 Nfyb Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NFYB mRNA CTD PMID:25181051 Nfyb Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NFYB mRNA CTD PMID:34947998 Nfyb Rat bisphenol A decreases expression ISO NFYB (Homo sapiens) 6480464 bisphenol A results in decreased expression of NFYB mRNA CTD PMID:29275510 Nfyb Rat bisphenol A multiple interactions ISO NFYB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NFYB mRNA CTD PMID:28628672 Nfyb Rat cadmium dichloride decreases expression ISO NFYB (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of NFYB mRNA CTD PMID:38568856 Nfyb Rat carbon nanotube decreases expression ISO Nfyb (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Nfyb Rat chlorpyrifos decreases expression ISO Nfyb (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of NFYB mRNA CTD PMID:37019170 Nfyb Rat choline multiple interactions ISO Nfyb (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of NFYB mRNA CTD PMID:20938992 Nfyb Rat ciguatoxin CTX1B affects expression ISO Nfyb (Mus musculus) 6480464 Ciguatoxins affects the expression of NFYB mRNA CTD PMID:18353800 Nfyb Rat cisplatin multiple interactions ISO NFYB (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of NFYB mRNA CTD PMID:27392435 Nfyb Rat cobalt dichloride decreases expression ISO NFYB (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of NFYB mRNA CTD PMID:19376846 Nfyb Rat cocaine increases expression ISO NFYB (Homo sapiens) 6480464 Cocaine results in increased expression of NFYB mRNA CTD PMID:18000554 Nfyb Rat copper(II) sulfate increases expression ISO NFYB (Homo sapiens) 6480464 Copper Sulfate results in increased expression of NFYB mRNA CTD PMID:19549813 Nfyb Rat copper(II) sulfate decreases expression ISO NFYB (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of NFYB mRNA CTD PMID:19549813 Nfyb Rat coptisine multiple interactions ISO NFYB (Homo sapiens) 6480464 coptisine inhibits the reaction [NFYB protein binds to E2F7 promoter] CTD PMID:38795876 Nfyb Rat coptisine decreases expression ISO NFYB (Homo sapiens) 6480464 coptisine results in decreased expression of NFYB protein CTD PMID:38795876 Nfyb Rat Cuprizon affects expression EXP 6480464 Cuprizone affects the expression of NFYB mRNA CTD PMID:27523638 Nfyb Rat cyclosporin A decreases expression ISO NFYB (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NFYB mRNA CTD PMID:20106945 more ... Nfyb Rat dexamethasone multiple interactions ISO NFYB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NFYB mRNA CTD PMID:28628672 Nfyb Rat Dibutyl phosphate affects expression ISO NFYB (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NFYB mRNA CTD PMID:37042841 Nfyb Rat dibutyl phthalate decreases expression ISO Nfyb (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of NFYB mRNA CTD PMID:17361019 and PMID:21266533 Nfyb Rat dicrotophos decreases expression ISO NFYB (Homo sapiens) 6480464 dicrotophos results in decreased expression of NFYB mRNA CTD PMID:28302478 Nfyb Rat diquat increases expression ISO Nfyb (Mus musculus) 6480464 Diquat results in increased expression of NFYB protein CTD PMID:36851058 Nfyb Rat dorsomorphin multiple interactions ISO NFYB (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nfyb Rat ethanol affects expression ISO Nfyb (Mus musculus) 6480464 Ethanol affects the expression of NFYB mRNA CTD PMID:30319688 Nfyb Rat fluoranthene decreases expression ISO Nfyb (Mus musculus) 6480464 fluoranthene results in decreased expression of NFYB mRNA CTD PMID:28329830 Nfyb Rat folic acid multiple interactions ISO Nfyb (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of NFYB mRNA CTD PMID:20938992 Nfyb Rat folic acid decreases expression ISO Nfyb (Mus musculus) 6480464 Folic Acid results in decreased expression of NFYB mRNA CTD PMID:25629700 Nfyb Rat geraniol decreases expression ISO NFYB (Homo sapiens) 6480464 geraniol results in decreased expression of NFYB mRNA CTD PMID:27683099 Nfyb Rat indometacin multiple interactions ISO NFYB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NFYB mRNA CTD PMID:28628672 Nfyb Rat inulin multiple interactions ISO Nfyb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of NFYB mRNA CTD PMID:36331819 Nfyb Rat L-methionine multiple interactions ISO Nfyb (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of NFYB mRNA CTD PMID:20938992 Nfyb Rat manganese atom decreases expression ISO NFYB (Homo sapiens) 6480464 Manganese results in decreased expression of NFYB mRNA CTD PMID:17175027 Nfyb Rat manganese(0) decreases expression ISO NFYB (Homo sapiens) 6480464 Manganese results in decreased expression of NFYB mRNA CTD PMID:17175027 Nfyb Rat manganese(II) chloride decreases expression ISO NFYB (Homo sapiens) 6480464 manganese chloride results in decreased expression of NFYB mRNA CTD PMID:17175027 Nfyb Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of NFYB mRNA CTD PMID:38685447 Nfyb Rat methoxyacetic acid affects expression ISO Nfyb (Mus musculus) 6480464 methoxyacetic acid affects the expression of NFYB mRNA CTD PMID:20421339 Nfyb Rat methylmercury chloride decreases expression ISO NFYB (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of NFYB mRNA CTD PMID:28001369 Nfyb Rat methylparaben decreases expression ISO NFYB (Homo sapiens) 6480464 methylparaben results in decreased expression of NFYB mRNA CTD PMID:31745603 Nfyb Rat Monobutylphthalate affects expression ISO Nfyb (Mus musculus) 6480464 monobutyl phthalate affects the expression of NFYB mRNA CTD PMID:20421339 Nfyb Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO NFYB (Homo sapiens) 6480464 Methylnitronitrosoguanidine promotes the reaction [NFYB protein binds to RRM2 promoter] more ... CTD PMID:26921499 Nfyb Rat nicotine decreases expression ISO NFYB (Homo sapiens) 6480464 Nicotine results in decreased expression of NFYB mRNA CTD PMID:18247414 Nfyb Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NFYB mRNA CTD PMID:25729387 Nfyb Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of NFYB mRNA CTD PMID:25729387 Nfyb Rat paracetamol affects expression ISO Nfyb (Mus musculus) 6480464 Acetaminophen affects the expression of NFYB mRNA CTD PMID:17562736 Nfyb Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NFYB mRNA CTD PMID:33387578 Nfyb Rat paracetamol increases expression ISO NFYB (Homo sapiens) 6480464 Acetaminophen results in increased expression of NFYB mRNA CTD PMID:21420995 Nfyb Rat paraquat decreases expression ISO NFYB (Homo sapiens) 6480464 Paraquat results in decreased expression of NFYB mRNA CTD PMID:35182771 Nfyb Rat PCB138 multiple interactions ISO Nfyb (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Nfyb Rat pentachlorophenol increases expression ISO Nfyb (Mus musculus) 6480464 Pentachlorophenol results in increased expression of NFYB mRNA CTD PMID:23892564 Nfyb Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of NFYB mRNA CTD PMID:19162173 Nfyb Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Nfyb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of NFYB mRNA CTD PMID:36331819 Nfyb Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of NFYB mRNA CTD PMID:19162173 Nfyb Rat phenobarbital affects expression ISO Nfyb (Mus musculus) 6480464 Phenobarbital affects the expression of NFYB mRNA CTD PMID:23091169 Nfyb Rat phenobarbital affects expression ISO NFYB (Homo sapiens) 6480464 Phenobarbital affects the expression of NFYB mRNA CTD PMID:19159669 Nfyb Rat phenylmercury acetate decreases expression ISO NFYB (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of NFYB mRNA CTD PMID:26272509 Nfyb Rat phenylmercury acetate multiple interactions ISO NFYB (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NFYB mRNA CTD PMID:27188386 Nfyb Rat pirinixic acid multiple interactions ISO Nfyb (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of NFYB mRNA CTD PMID:19710929 Nfyb Rat pirinixic acid decreases expression ISO Nfyb (Mus musculus) 6480464 pirinixic acid results in decreased expression of NFYB mRNA CTD PMID:18445702 and PMID:20813756 Nfyb Rat potassium chromate decreases expression ISO NFYB (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of NFYB mRNA CTD PMID:22079256 Nfyb Rat potassium chromate multiple interactions ISO NFYB (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of NFYB mRNA CTD PMID:22079256 Nfyb Rat propiconazole decreases expression ISO Nfyb (Mus musculus) 6480464 propiconazole results in decreased expression of NFYB mRNA CTD PMID:21278054 Nfyb Rat rotenone increases expression ISO NFYB (Homo sapiens) 6480464 Rotenone results in increased expression of NFYB mRNA CTD PMID:33512557 Nfyb Rat SB 431542 multiple interactions ISO NFYB (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nfyb Rat Soman increases expression EXP 6480464 Soman results in increased expression of NFYB mRNA CTD PMID:19281266 Nfyb Rat sunitinib increases expression ISO NFYB (Homo sapiens) 6480464 Sunitinib results in increased expression of NFYB mRNA CTD PMID:31533062 Nfyb Rat tamibarotene decreases expression ISO NFYB (Homo sapiens) 6480464 tamibarotene results in decreased expression of NFYB mRNA CTD PMID:15498508 Nfyb Rat tert-butyl hydroperoxide decreases expression ISO NFYB (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of NFYB mRNA CTD PMID:15336504 Nfyb Rat thimerosal increases expression ISO NFYB (Homo sapiens) 6480464 Thimerosal results in increased expression of NFYB mRNA CTD PMID:27188386 Nfyb Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NFYB mRNA CTD PMID:34492290 Nfyb Rat titanium dioxide decreases methylation ISO Nfyb (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NFYB gene CTD PMID:35295148 Nfyb Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NFYB mRNA CTD PMID:25729387 Nfyb Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of NFYB mRNA CTD PMID:25729387 Nfyb Rat trabectedin multiple interactions ISO Nfyb (Mus musculus) 6480464 trabectedin affects the activity of [NFYA protein binds to NFYB protein binds to NFYC protein] CTD PMID:15961672 Nfyb Rat trichostatin A decreases expression ISO NFYB (Homo sapiens) 6480464 trichostatin A results in decreased expression of NFYB mRNA CTD PMID:26272509 Nfyb Rat trichostatin A multiple interactions ISO NFYB (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NFYB mRNA CTD PMID:27188386 Nfyb Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of NFYB mRNA CTD PMID:30589522 Nfyb Rat valproic acid affects expression ISO Nfyb (Mus musculus) 6480464 Valproic Acid affects the expression of NFYB mRNA CTD PMID:20421339 Nfyb Rat valproic acid affects expression ISO NFYB (Homo sapiens) 6480464 Valproic Acid affects the expression of NFYB mRNA CTD PMID:25979313 Nfyb Rat valproic acid decreases expression ISO NFYB (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NFYB mRNA CTD PMID:23179753 more ... Nfyb Rat valproic acid multiple interactions ISO NFYB (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NFYB mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-naphthylamine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) acrylamide (EXP) aflatoxin B1 (ISO) aflatoxin M1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) choline (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) cobalt dichloride (ISO) cocaine (ISO) copper(II) sulfate (ISO) coptisine (ISO) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diquat (ISO) dorsomorphin (ISO) ethanol (ISO) fluoranthene (ISO) folic acid (ISO) geraniol (ISO) indometacin (ISO) inulin (ISO) L-methionine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methimazole (EXP) methoxyacetic acid (ISO) methylmercury chloride (ISO) methylparaben (ISO) Monobutylphthalate (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) nicotine (ISO) oxaliplatin (EXP) paracetamol (EXP,ISO) paraquat (ISO) PCB138 (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) phenobarbital (EXP,ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) potassium chromate (ISO) propiconazole (ISO) rotenone (ISO) SB 431542 (ISO) Soman (EXP) sunitinib (ISO) tamibarotene (ISO) tert-butyl hydroperoxide (ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trabectedin (ISO) trichostatin A (ISO) triphenyl phosphate (EXP) valproic acid (ISO)
Molecular Function
DNA binding (IEA,ISO) DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO) DNA-binding transcription factor activity (IEA,ISO) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA) DNA-binding transcription factor binding (IEA,ISO) protein binding (ISO) protein heterodimerization activity (IEA) protein-containing complex binding (IDA) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO) sequence-specific DNA binding (IEA,ISO) transcription cis-regulatory region binding (IEA,ISO)
1.
Mutant p53: one name, many proteins.
Freed-Pastor WA and Prives C, Genes Dev. 2012 Jun 15;26(12):1268-86. doi: 10.1101/gad.190678.112.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
p53 mutations in cancer.
Muller PA and Vousden KH, Nat Cell Biol. 2013 Jan;15(1):2-8. doi: 10.1038/ncb2641.
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
GOA pipeline
RGD automated data pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Recombinant rat CBF-C, the third subunit of CBF/NFY, allows formation of a protein-DNA complex with CBF-A and CBF-B and with yeast HAP2 and HAP3.
Sinha S, etal., Proc Natl Acad Sci U S A 1995 Feb 28;92(5):1624-8.
10.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
11.
Purification and molecular cloning of the "A" chain of a rat heteromeric CCAAT-binding protein. Sequence identity with the yeast HAP3 transcription factor.
Vuorio T, etal., J Biol Chem 1990 Dec 25;265(36):22480-6.
Nfyb (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 22,852,543 - 22,868,116 (+) NCBI GRCr8 mRatBN7.2 7 20,964,988 - 20,980,569 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 20,964,993 - 20,980,565 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 22,939,228 - 22,954,797 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 25,101,932 - 25,117,500 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 24,879,005 - 24,894,574 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 27,081,667 - 27,097,481 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 27,081,667 - 27,097,479 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 27,200,204 - 27,216,018 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 23,190,295 - 23,205,611 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 23,210,565 - 23,225,880 (+) NCBI Celera 7 18,145,883 - 18,161,286 (+) NCBI Celera Cytogenetic Map 7 q13 NCBI
NFYB (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 104,117,086 - 104,138,210 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 104,117,086 - 104,138,241 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 104,510,864 - 104,531,988 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 103,034,988 - 103,056,170 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 103,013,324 - 103,034,507 NCBI Celera 12 104,174,600 - 104,195,782 (-) NCBI Celera Cytogenetic Map 12 q23.3 NCBI HuRef 12 101,570,544 - 101,591,726 (-) NCBI HuRef CHM1_1 12 104,476,772 - 104,497,954 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 104,078,781 - 104,099,908 (-) NCBI T2T-CHM13v2.0
Nfyb (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 82,584,534 - 82,599,985 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 82,584,535 - 82,599,978 (-) Ensembl GRCm39 Ensembl GRCm38 10 82,748,700 - 82,764,151 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 82,748,701 - 82,764,144 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 82,211,445 - 82,226,886 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 82,178,499 - 82,193,940 (-) NCBI MGSCv36 mm8 Celera 10 84,733,247 - 84,748,605 (-) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 40.25 NCBI
Nfyb (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 38,771,837 - 38,789,536 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 38,773,690 - 38,789,534 (-) NCBI ChiLan1.0 ChiLan1.0
NFYB (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 112,179,923 - 112,200,452 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 112,176,320 - 112,196,849 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 101,693,559 - 101,714,057 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 105,089,028 - 105,108,825 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 105,089,028 - 105,108,825 (-) Ensembl panpan1.1 panPan2
NFYB (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 42,608,067 - 42,628,816 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 42,609,606 - 42,629,158 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 42,977,178 - 42,998,767 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 43,265,789 - 43,287,387 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 43,264,430 - 43,286,300 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 42,531,537 - 42,553,082 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 42,630,397 - 42,651,973 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 42,901,800 - 42,923,377 (-) NCBI UU_Cfam_GSD_1.0
Nfyb (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
NFYB (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 80,334,748 - 80,353,768 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 80,333,762 - 80,353,466 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 83,903,195 - 83,922,952 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 5 q2.3 NCBI
NFYB (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 99,320,263 - 99,341,289 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 99,319,390 - 99,329,726 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 145,655,097 - 145,678,182 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nfyb (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 230 Count of miRNA genes: 149 Interacting mature miRNAs: 185 Transcripts: ENSRNOT00000066143 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1354644 Spl4 Serum phospholipid level QTL 4 4.9 blood phospholipid amount (VT:0006084) blood phospholipid level (CMO:0001169) 7 19654317 49753746 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 1354637 Scl30 Serum cholesterol level QTL 30 3.7 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 7 19654317 49753746 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 2290372 Gluco33 Glucose level QTL 33 2.71 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 20555705 29891047 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 1582260 Bw72 Body weight QTL 72 3.2 0.0043 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582261 Bw69 Body weight QTL 69 3.2 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582262 Bw75 Body weight QTL 75 3 0.0038 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 61369 Mcs2 Mammary carcinoma susceptibility QTL 2 3.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 19032807 35526300 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat 70207 Niddm31 Non-insulin dependent diabetes mellitus QTL 31 3.9 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 18169505 26029351 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066143 ⟹ ENSRNOP00000061405
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 20,964,993 - 20,980,565 (+) Ensembl Rnor_6.0 Ensembl 7 27,081,667 - 27,097,479 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000082398 ⟹ ENSRNOP00000071810
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 20,972,271 - 20,979,287 (+) Ensembl Rnor_6.0 Ensembl 7 27,089,278 - 27,095,777 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102116 ⟹ ENSRNOP00000095617
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 20,972,366 - 20,979,287 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117282 ⟹ ENSRNOP00000091093
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 20,972,160 - 20,980,565 (+) Ensembl
RefSeq Acc Id:
NM_031553 ⟹ NP_113741
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 22,852,546 - 22,868,116 (+) NCBI mRatBN7.2 7 20,964,999 - 20,980,569 (+) NCBI Rnor_6.0 7 27,081,667 - 27,097,481 (+) NCBI Rnor_5.0 7 27,200,204 - 27,216,018 (+) NCBI RGSC_v3.4 7 23,190,295 - 23,205,611 (+) RGD Celera 7 18,145,883 - 18,161,286 (+) RGD
Sequence:
CGGCCCGCGGCGGAGGGAGGGGAGGCCGAGTCCTGGAAGTGGAGCTCCGCGCTGGGACTGGTTCCTTCGCAGCCATTTTCTGTCCAACCAAACAGCCGATTGGAGACGGGAGCCAACCAGGGCTGCAT TGGAGGTTAAAATTGGACAAAGATCCACCACCTTTAGGACAGGTGTTCAAGAACCCTGCAGATAACACAATTCTGACAGTATTTCATGACAATGGATGGCGACAGCTCTACAACAGATGCTTCTCAAC TAGGGATTTCTGCAGACTACATCGGAGGAAGTCATTATGTGATCCAGCCCCACGATGATACTGAGGACAGCATGAATGATCATGAAGATACAAATGGTTCAAAAGAAAGTTTCAGAGAACAAGATATT TATCTTCCCATTGCAAATGTGGCTAGGATAATGAAAAATGCCATACCTCAAACAGGAAAGATTGCAAAGGATGCCAAAGAATGCGTTCAGGAGTGTGTGAGTGAGTTTATAAGCTTCATAACATCTGA AGCAAGTGAGCGCTGTCACCAGGAGAAGCGGAAGACCATCAACGGGGAGGACATTCTGTTCGCCATGTCCACTCTCGGCTTCGACAGCTACGTGGAGCCTCTGAAACTGTACCTCCAGAAGTTCAGAG AGGCCATGAAGGGAGAGAAGGGCATTGGTGGGGCCGTGTCTGCTACAGATGGACTCAGCGAGGAGCTCACGGAAGAGGCATTCACTAACCAGTTACCGGCTGGGTTAATAACTGCAGATGGCCAACAA CAAAACGTTATGGTTTACACGACGTCCTATCAACAGATTTCTGGTGTCCAGCAGATTCAGTTTTCATGATATGAAGGAAGGATGGAGCCGGGCTGTGTGGAGAGCGCGAGCGAGAGTCTGACGGAGTC TGGAGCAGAGGCATTGGGAGGAAGTGAGAGTGAGGCCGCCTCCTTGTATAATAAGTAGCTGTAACGTAGCTTCCTGATGCCTGACTAATTGAGGTGTTAATTCTGACTTGAGAATCTTTTTCATGAAT GATTTTAAAAGAAAAAAATTGGATTTTAAAGGTATTAAAAATATTTTTGTTTTGTACGAGAGTGTGTTGCTCTGTGACGCCTGTATGCATTGTATATTGCGATTTATTACTGTCAGAGATTTGTAGAC AGTTTCTTATTTTCATATTGAATCATGTTATTTTGTAATTCAAGTAAGCAGCTGGGTTAATTCATAATGTTTATTACCCTTTTAATAAAATATAAGGGTAGAGTTCATTTTGAATGAAAGTTGCCTTT ATTACGAATTTGCGTTTGTCTTAGCTATACACTATCCTGCATGGTAACTTAGCCGAATGTTTAGCATTTATTTATTGAAAACATTTTTTTTTTTTTTTTGGTAAACAGTCATAGCTTAAGCAACGTCA TTTTTTTAACTGAATAATTAAGTTGGATGCAGAAGCAAGTGTTGCCTGGCCTGTCAGACCTGGTGCCTGTTGCTGTCTGTGCTGTTGAGGCAGCTTCCGTTACTGCCATGCCTGTGAGAATTCCTTTC CCTTCCATACGGTCCTGCCACCTCTGAAATGGCCCCTTTCTTCTTCAAGTATCACAGTCCCCTTCCTGAAGAGGGAGTTTTCAGTCCACTGATAGTCATTTCCCTTCATGGAAAGGTCAGGTCCCTGT CGGGCTGTGGGAGCCGAGCAGTGGGCGTGGTTCTGTGCAGATGCTGCAGGTGAGAGCAAGTGAGCGGAGGAGCGGTGAGGCAGGGGAGCAGCCAGCACTTGGAATCAGGAGACACGGAGCCTTTTGGT GTGCTGTCACACCATCTGCAGTAAGCTAGCATTAGTTGATGTAGCGTGGTTTCTTTTTTAAAGTGAAGATTTCTATTTTCTCATCTAGTCTTTTTAGTAATACTTCCTTTGAATTTTTGTGTATGTAG TGTGGTAGTTTTAGCCCTATCAAAAATGGCTTATTGTATAGTTTGTCCAGAGGAAATTTTGGGGCTCCAGTGGACAAAAGCAAGCAGTTCCCTAGGTCCAGGCTGATCAGTAATGGCCACTTGCCAAG AGTCTTGTGGAACACAGCTAGCTACTCTGAGATTAAATAATTCCCCCTTCTCCTTCCTCCTTTCCTTTTCAGTAGTCACCTTCTGTGTAGGAGATGCACATAGGGAAGAACGGGAGGTGACGGTCAAG CAGAACCAGCAGTCGTCCTACTGTGCTGAAGTAACAATGTTAATATTTTGATAACTCATTTGTCCTTTTACTTTGCTAAATATGTATATTTTTATAAAGATGGGCTCGTGTTGTGCACACTGTTTTGT AACTCGTTTTTCACTTAATACATTGTGAACATCTTTCCCAGGTCATGCATGATCTTCTGCATCATTTTTACTGGGTTTTTATTCTGTTATATGACTGAATCATGATTAATTTATTTAATTGCCTATTG CACAGTTTGACCTTTTTCCATCTCTTCATAGTTATAAACATAGTTATATAAGTTCACTGAATCTTGTGTACATCGTAACTTTTCTTGAAATAAATTCTTAGAAGTAGAAAAAAAAAAAAAAAAAAAAA AAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_039078461 ⟹ XP_038934389
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 22,852,728 - 22,868,116 (+) NCBI mRatBN7.2 7 20,965,529 - 20,980,569 (+) NCBI
RefSeq Acc Id:
XM_039078462 ⟹ XP_038934390
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 22,852,543 - 22,868,116 (+) NCBI mRatBN7.2 7 20,964,988 - 20,980,569 (+) NCBI
RefSeq Acc Id:
NP_113741 ⟸ NM_031553
- UniProtKB:
Q5FVT0 (UniProtKB/Swiss-Prot), P63140 (UniProtKB/Swiss-Prot), A6IFH9 (UniProtKB/TrEMBL), A0A0G2K1E6 (UniProtKB/TrEMBL), A0A8I6B326 (UniProtKB/TrEMBL)
- Sequence:
MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFD SYVEPLKLYLQKFREAMKGEKGIGGAVSATDGLSEELTEEAFTNQLPAGLITADGQQQNVMVYTTSYQQISGVQQIQFS
hide sequence
Ensembl Acc Id:
ENSRNOP00000071810 ⟸ ENSRNOT00000082398
Ensembl Acc Id:
ENSRNOP00000061405 ⟸ ENSRNOT00000066143
RefSeq Acc Id:
XP_038934390 ⟸ XM_039078462
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038934389 ⟸ XM_039078461
- Peptide Label:
isoform X1
- UniProtKB:
P63140 (UniProtKB/Swiss-Prot), Q5FVT0 (UniProtKB/Swiss-Prot), A6IFH9 (UniProtKB/TrEMBL), A0A0G2K1E6 (UniProtKB/TrEMBL), A0A8I6B326 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000095617 ⟸ ENSRNOT00000102116
Ensembl Acc Id:
ENSRNOP00000091093 ⟸ ENSRNOT00000117282
RGD ID: 13695111
Promoter ID: EPDNEW_R5636
Type: initiation region
Name: Nfyb_1
Description: nuclear transcription factor Y subunit beta
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 27,081,737 - 27,081,797 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-20
Nfyb
nuclear transcription factor Y subunit beta
Nfyb
nuclear transcription factor-Y beta
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2001-07-23
Nfyb
CCAAT binding transcription factor of CBF-B/NFY-B
Name withdrawn
67952
WITHDRAWN
2001-07-23
Nfyb
nuclear transcription factor - Y beta
Name updated to reflect Human and Mouse nomenclature
67952
APPROVED
Note Type
Note
Reference
gene_protein
207 amino acids
728940