Symbol:
Gja4
Name:
gap junction protein, alpha 4
RGD ID:
2691
Description:
Predicted to enable gap junction channel activity. Involved in several processes, including calcium ion transport; endothelium development; and response to pain. Located in gap junction. Part of connexin complex. Biomarker of ureteral obstruction. Human ortholog(s) of this gene implicated in coronary artery disease and myocardial infarction. Orthologous to human GJA4 (gap junction protein alpha 4); PARTICIPATES IN connexin signaling pathway; INTERACTS WITH (S)-nicotine; 1,2,4-trimethylbenzene; 1-naphthyl isothiocyanate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
connexin h1; connexin-37; cx37; CXN37; Cxnh1; gap junction alpha-4 protein; gap junction membrane channel protein alpha 4; Gap junction membrane channel protein alpha 4 (connexin 37); Gap junction membrane channel, protein alpha 4 (connexin 37)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GJA4 (gap junction protein alpha 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Gja4 (gap junction protein, alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gja4 (gap junction protein alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GJA4 (gap junction protein alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GJA4 (gap junction protein alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gja4 (gap junction protein alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GJA4 (gap junction protein alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GJA4 (gap junction protein alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gja4 (gap junction protein alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
GJA4 (gap junction protein alpha 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Gja4 (gap junction protein, alpha 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cx39.4 (connexin 39.4)
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Xenopus tropicalis (tropical clawed frog):
gja4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 144,917,791 - 144,920,324 (-) NCBI GRCr8 mRatBN7.2 5 139,633,324 - 139,635,857 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 139,633,287 - 139,635,925 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 142,328,532 - 142,331,068 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 144,098,526 - 144,101,062 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 144,099,313 - 144,101,849 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 145,374,688 - 145,377,221 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 145,374,690 - 145,377,221 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 149,142,702 - 149,145,235 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 146,755,061 - 146,757,594 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 146,765,101 - 146,767,633 (-) NCBI Celera 5 138,127,254 - 138,129,787 (-) NCBI Celera RH 3.4 Map 5 934.8 RGD Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gja4 Rat (-)-epigallocatechin 3-gallate decreases expression ISO GJA4 (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of GJA4 mRNA CTD PMID:16084531 Gja4 Rat (R)-carnitine increases expression ISO Gja4 (Mus musculus) 6480464 Carnitine results in increased expression of GJA4 mRNA CTD PMID:37863343 Gja4 Rat (R)-carnitine multiple interactions ISO Gja4 (Mus musculus) 6480464 Carnitine inhibits the reaction [Cyclophosphamide results in decreased expression of GJA4 mRNA] CTD PMID:37863343 Gja4 Rat (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of GJA4 mRNA CTD PMID:28087314 Gja4 Rat 1,2,4-trimethylbenzene increases expression EXP 6480464 pseudocumene results in increased expression of GJA4 protein CTD PMID:17337753 Gja4 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of GJA4 mRNA CTD PMID:25380136 Gja4 Rat 17beta-estradiol multiple interactions ISO GJA4 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of GJA4 mRNA and [Progesterone co-treated with Estradiol] results in decreased expression of GJA4 mRNA CTD PMID:17404688 and PMID:20660070 Gja4 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Gja4 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Gja4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GJA4 mRNA CTD PMID:21215274 and PMID:34747641 Gja4 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Gja4 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Gja4 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Gja4 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Gja4 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of GJA4 mRNA CTD PMID:20188158 Gja4 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of GJA4 mRNA CTD PMID:25380136 Gja4 Rat 4,4'-diaminodiphenylmethane increases expression ISO Gja4 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of GJA4 mRNA CTD PMID:18648102 Gja4 Rat 4,4'-sulfonyldiphenol increases expression ISO Gja4 (Mus musculus) 6480464 bisphenol S results in increased expression of GJA4 mRNA CTD PMID:30951980 and PMID:39298647 Gja4 Rat 4,4'-sulfonyldiphenol affects methylation ISO Gja4 (Mus musculus) 6480464 bisphenol S affects the methylation of GJA4 gene CTD PMID:31683443 Gja4 Rat 4,4'-sulfonyldiphenol increases methylation ISO Gja4 (Mus musculus) 6480464 bisphenol S results in increased methylation of GJA4 exon CTD PMID:33297965 Gja4 Rat 4-hydroxyphenyl retinamide increases expression ISO Gja4 (Mus musculus) 6480464 Fenretinide results in increased expression of GJA4 mRNA CTD PMID:28973697 Gja4 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:24269759 Gja4 Rat 7,12-dimethyltetraphene multiple interactions ISO Gja4 (Mus musculus) 6480464 9 more ... CTD PMID:25447408 Gja4 Rat 7,12-dimethyltetraphene decreases expression EXP 6480464 9 more ... CTD PMID:24269759 Gja4 Rat aldrin decreases expression ISO Gja4 (Mus musculus) 6480464 Aldrin results in decreased expression of GJA4 mRNA CTD PMID:18579281 Gja4 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of GJA4 mRNA CTD PMID:20488242 Gja4 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of GJA4 mRNA CTD PMID:35163327 Gja4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GJA4 mRNA CTD PMID:16483693 Gja4 Rat arsane affects methylation ISO GJA4 (Homo sapiens) 6480464 Arsenic affects the methylation of GJA4 gene CTD PMID:25304211 Gja4 Rat arsenic atom affects methylation ISO GJA4 (Homo sapiens) 6480464 Arsenic affects the methylation of GJA4 gene CTD PMID:25304211 Gja4 Rat arsenite(3-) increases methylation ISO GJA4 (Homo sapiens) 6480464 arsenite results in increased methylation of GJA4 promoter CTD PMID:23974009 Gja4 Rat arsenous acid decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of GJA4 protein CTD PMID:17559834 Gja4 Rat astragaloside IV multiple interactions ISO GJA4 (Homo sapiens) 6480464 astragaloside A inhibits the reaction [malondialdehyde-low density lipoprotein and human results in decreased expression of GJA4 protein] CTD PMID:36322813 Gja4 Rat atenolol increases expression EXP 6480464 Atenolol results in increased expression of GJA4 protein CTD PMID:16448880 Gja4 Rat benzo[a]pyrene decreases expression ISO Gja4 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GJA4 mRNA CTD PMID:21569818 Gja4 Rat benzo[a]pyrene increases methylation ISO GJA4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GJA4 3' UTR more ... CTD PMID:27901495 Gja4 Rat benzo[a]pyrene increases expression ISO Gja4 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of GJA4 mRNA CTD PMID:22228805 and PMID:32417428 Gja4 Rat benzo[b]fluoranthene increases expression ISO Gja4 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of GJA4 mRNA CTD PMID:26377693 Gja4 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Gja4 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of GJA4 mRNA and Diethylhexyl Phthalate results in decreased expression of GJA4 protein CTD PMID:19850644 and PMID:33234378 Gja4 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Gja4 (Mus musculus) 6480464 PDE3A mRNA promotes the reaction [Diethylhexyl Phthalate results in decreased expression of GJA4 protein] and PPARA protein promotes the reaction [Diethylhexyl Phthalate results in decreased expression of GJA4 mRNA] CTD PMID:19850644 and PMID:33234378 Gja4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GJA4 mRNA CTD PMID:25181051 Gja4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GJA4 mRNA CTD PMID:34947998 Gja4 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of GJA4 gene CTD PMID:28505145 Gja4 Rat bisphenol F increases expression ISO GJA4 (Homo sapiens) 6480464 bisphenol F results in increased expression of GJA4 mRNA CTD PMID:33476716 Gja4 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of GJA4 mRNA CTD PMID:32479839 Gja4 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of GJA4 mRNA CTD PMID:19167457 Gja4 Rat cadmium atom multiple interactions ISO GJA4 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GJA4 mRNA CTD PMID:35301059 Gja4 Rat cadmium atom multiple interactions ISO Gja4 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of GJA4 mRNA CTD PMID:37325564 Gja4 Rat cadmium dichloride multiple interactions ISO GJA4 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GJA4 mRNA CTD PMID:35301059 Gja4 Rat cadmium dichloride multiple interactions ISO Gja4 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of GJA4 mRNA CTD PMID:37325564 Gja4 Rat calcitriol increases expression ISO GJA4 (Homo sapiens) 6480464 Calcitriol results in increased expression of GJA4 mRNA CTD PMID:26485663 Gja4 Rat carbon nanotube decreases expression ISO Gja4 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of GJA4 mRNA CTD PMID:25554681 Gja4 Rat carvedilol increases expression EXP 6480464 carvedilol results in increased expression of GJA4 protein CTD PMID:16448880 Gja4 Rat chloroprene decreases expression ISO Gja4 (Mus musculus) 6480464 Chloroprene results in decreased expression of GJA4 mRNA CTD PMID:23125180 Gja4 Rat chlorpyrifos increases expression ISO Gja4 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of GJA4 mRNA CTD PMID:37019170 Gja4 Rat cyclophosphamide multiple interactions ISO Gja4 (Mus musculus) 6480464 Carnitine inhibits the reaction [Cyclophosphamide results in decreased expression of GJA4 mRNA] CTD PMID:37863343 Gja4 Rat cyclophosphamide decreases expression ISO Gja4 (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of GJA4 mRNA CTD PMID:37863343 Gja4 Rat diarsenic trioxide decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of GJA4 protein CTD PMID:17559834 Gja4 Rat dioxygen decreases expression ISO GJA4 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of GJA4 mRNA CTD PMID:26516004 Gja4 Rat doxorubicin decreases expression ISO GJA4 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of GJA4 mRNA CTD PMID:29803840 Gja4 Rat entinostat decreases expression ISO GJA4 (Homo sapiens) 6480464 entinostat results in decreased expression of GJA4 mRNA CTD PMID:27188386 Gja4 Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of GJA4 mRNA CTD PMID:30307764 Gja4 Rat fonofos increases methylation ISO GJA4 (Homo sapiens) 6480464 Fonofos results in increased methylation of GJA4 promoter CTD PMID:22847954 Gja4 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of GJA4 mRNA CTD PMID:33387578 Gja4 Rat lycopene decreases expression ISO GJA4 (Homo sapiens) 6480464 lycopene results in decreased expression of GJA4 mRNA CTD PMID:16886892 Gja4 Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of GJA4 mRNA CTD PMID:19564919 Gja4 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of GJA4 mRNA CTD PMID:19564919 Gja4 Rat methotrexate decreases expression ISO GJA4 (Homo sapiens) 6480464 Methotrexate results in decreased expression of GJA4 mRNA CTD PMID:17400583 Gja4 Rat methylparaben increases expression ISO GJA4 (Homo sapiens) 6480464 methylparaben results in increased expression of GJA4 mRNA CTD PMID:17121429 Gja4 Rat mono(2-ethylhexyl) phthalate decreases expression ISO GJA4 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of GJA4 mRNA CTD PMID:36314267 Gja4 Rat N-acetyl-L-cysteine decreases expression ISO GJA4 (Homo sapiens) 6480464 Acetylcysteine results in decreased expression of GJA4 mRNA CTD PMID:16084531 Gja4 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of GJA4 mRNA and [Diethylnitrosamine co-treated with Phenobarbital] results in decreased methylation of GJA4 promoter CTD PMID:25374375 Gja4 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of GJA4 mRNA CTD PMID:25380136 Gja4 Rat nickel atom increases expression ISO GJA4 (Homo sapiens) 6480464 Nickel results in increased expression of GJA4 mRNA CTD PMID:24768652 Gja4 Rat nicotine increases expression EXP 6480464 Nicotine results in increased expression of GJA4 mRNA CTD PMID:28087314 Gja4 Rat oxybenzone decreases expression ISO Gja4 (Mus musculus) 6480464 oxybenzone results in decreased expression of GJA4 mRNA CTD PMID:39343157 Gja4 Rat paracetamol affects expression ISO Gja4 (Mus musculus) 6480464 Acetaminophen affects the expression of GJA4 mRNA CTD PMID:17562736 Gja4 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of GJA4 mRNA CTD PMID:33387578 Gja4 Rat parathion increases methylation ISO GJA4 (Homo sapiens) 6480464 Parathion results in increased methylation of GJA4 promoter CTD PMID:22847954 Gja4 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of GJA4 mRNA CTD PMID:35163327 Gja4 Rat perfluorooctanoic acid decreases expression ISO GJA4 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of GJA4 mRNA CTD PMID:32971237 Gja4 Rat phenobarbital multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of GJA4 mRNA and [Diethylnitrosamine co-treated with Phenobarbital] results in decreased methylation of GJA4 promoter CTD PMID:25374375 Gja4 Rat pirinixic acid multiple interactions ISO GJA4 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of GJA4 mRNA CTD PMID:19710929 Gja4 Rat pirinixic acid increases expression ISO Gja4 (Mus musculus) 6480464 pirinixic acid results in increased expression of GJA4 mRNA CTD PMID:18445702 Gja4 Rat pirinixic acid multiple interactions ISO Gja4 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of GJA4 mRNA CTD PMID:19710929 Gja4 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Gja4 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of GJA4 mRNA CTD PMID:28903501 Gja4 Rat progesterone multiple interactions ISO GJA4 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of GJA4 mRNA and [Progesterone co-treated with Estradiol] results in decreased expression of GJA4 mRNA CTD PMID:17404688 and PMID:20660070 Gja4 Rat progesterone increases expression ISO GJA4 (Homo sapiens) 6480464 Progesterone results in increased expression of GJA4 mRNA CTD PMID:18692832 Gja4 Rat progesterone decreases expression ISO GJA4 (Homo sapiens) 6480464 Progesterone results in decreased expression of GJA4 mRNA CTD PMID:17404688 Gja4 Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of GJA4 mRNA CTD PMID:25905778 Gja4 Rat resveratrol multiple interactions ISO GJA4 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of GJA4 mRNA CTD PMID:23557933 Gja4 Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of GJA4 mRNA CTD PMID:19564919 Gja4 Rat sevoflurane affects expression EXP 6480464 sevoflurane affects the expression of GJA4 mRNA CTD PMID:15967596 Gja4 Rat silicon dioxide increases expression ISO GJA4 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of GJA4 mRNA CTD PMID:23806026 Gja4 Rat sodium arsenite increases expression ISO GJA4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of GJA4 mRNA CTD PMID:38568856 Gja4 Rat terbufos increases methylation ISO GJA4 (Homo sapiens) 6480464 terbufos results in increased methylation of GJA4 promoter CTD PMID:22847954 Gja4 Rat tetrachloromethane affects expression ISO Gja4 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of GJA4 mRNA CTD PMID:17484886 Gja4 Rat tetrachloromethane increases expression ISO Gja4 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of GJA4 mRNA CTD PMID:31919559 Gja4 Rat thimerosal decreases expression ISO GJA4 (Homo sapiens) 6480464 Thimerosal results in decreased expression of GJA4 mRNA CTD PMID:27188386 Gja4 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of GJA4 mRNA CTD PMID:34492290 Gja4 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of GJA4 mRNA CTD PMID:33387578 Gja4 Rat triclosan decreases expression ISO GJA4 (Homo sapiens) 6480464 Triclosan results in decreased expression of GJA4 mRNA CTD PMID:30510588 Gja4 Rat troglitazone increases expression ISO Gja4 (Mus musculus) 6480464 troglitazone results in increased expression of GJA4 mRNA CTD PMID:17569031 Gja4 Rat undecane increases expression EXP 6480464 undecane results in increased expression of GJA4 protein CTD PMID:17337753 Gja4 Rat valproic acid affects expression ISO Gja4 (Mus musculus) 6480464 Valproic Acid affects the expression of GJA4 mRNA CTD PMID:17292431 Gja4 Rat valproic acid decreases expression ISO GJA4 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GJA4 mRNA CTD PMID:23179753 and PMID:27188386 Gja4 Rat valproic acid increases methylation ISO GJA4 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of GJA4 gene CTD PMID:29154799 Gja4 Rat valproic acid affects expression ISO GJA4 (Homo sapiens) 6480464 Valproic Acid affects the expression of GJA4 mRNA CTD PMID:25979313 Gja4 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of GJA4 mRNA CTD PMID:19015723 Gja4 Rat vorinostat decreases expression ISO GJA4 (Homo sapiens) 6480464 vorinostat results in decreased expression of GJA4 mRNA CTD PMID:27188386
(-)-epigallocatechin 3-gallate (ISO) (R)-carnitine (ISO) (S)-nicotine (EXP) 1,2,4-trimethylbenzene (EXP) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 7,12-dimethyltetraphene (EXP,ISO) aldrin (ISO) all-trans-retinoic acid (EXP) alpha-Zearalanol (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (EXP) astragaloside IV (ISO) atenolol (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) bisphenol F (ISO) bromobenzene (EXP) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) carvedilol (EXP) chloroprene (ISO) chlorpyrifos (ISO) cyclophosphamide (ISO) diarsenic trioxide (EXP) dioxygen (ISO) doxorubicin (ISO) entinostat (ISO) fenvalerate (EXP) fonofos (ISO) gentamycin (EXP) lycopene (ISO) methamphetamine (EXP) methotrexate (ISO) methylparaben (ISO) mono(2-ethylhexyl) phthalate (ISO) N-acetyl-L-cysteine (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nickel atom (ISO) nicotine (EXP) oxybenzone (ISO) paracetamol (EXP,ISO) parathion (ISO) perfluorooctanoic acid (EXP,ISO) phenobarbital (EXP) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (ISO) resveratrol (EXP,ISO) SCH 23390 (EXP) sevoflurane (EXP) silicon dioxide (ISO) sodium arsenite (ISO) terbufos (ISO) tetrachloromethane (ISO) thimerosal (ISO) thioacetamide (EXP) trichloroethene (EXP) triclosan (ISO) troglitazone (ISO) undecane (EXP) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO)
1.
Disruption of smooth muscle gap junctions attenuates myogenic vasoconstriction of mesenteric resistance arteries.
Earley S, etal., Am J Physiol Heart Circ Physiol. 2004 Dec;287(6):H2677-86. Epub 2004 Aug 19.
2.
Connexins: gaps in our knowledge of vascular function.
Figueroa XF, etal., Physiology (Bethesda). 2004 Oct;19:277-84.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Four novel members of the connexin family of gap junction proteins. Molecular cloning, expression, and chromosome mapping.
Haefliger JA, etal., J Biol Chem 1992 Jan 25;267(3):2057-64.
6.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
7.
Induction of connexin 37 expression in a rat model of neuropathic pain.
Lin SH, etal., Brain Res Mol Brain Res 2002 Mar 28;99(2):134-40.
8.
Association between C1019T polymorphism of connexin37 and acute myocardial infarction: a study in patients from Sicily.
Listi F, etal., Int J Cardiol. 2005 Jul 10;102(2):269-71.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Connexin37 is the major connexin expressed in the media of caudal artery.
Rummery NM, etal., Arterioscler Thromb Vasc Biol 2002 Sep 1;22(9):1427-32.
15.
Expression of connexins in the normal and obstructed developing kidney.
Silverstein DM, etal., Pediatr Nephrol. 2003 Mar;18(3):216-24. Epub 2003 Feb 7.
16.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
17.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
18.
The bystander effect exerted by tumor cells expressing the herpes simplex virus thymidine kinase (HSVtk) gene is dependent on connexin expression and cell communication via gap junctions.
Vrionis FD, etal., Gene Ther. 1997 Jun;4(6):577-85.
19.
Genetic risk for coronary artery disease in individuals with or without type 2 diabetes.
Yamada Y, etal., Mol Genet Metab. 2004 Apr;81(4):282-90.
20.
Multiple connexin expression in regenerating arterial endothelial gap junctions.
Yeh HI, etal., Arterioscler Thromb Vasc Biol. 2000 Jul;20(7):1753-62.
21.
Individual gap junction plaques contain multiple connexins in arterial endothelium.
Yeh HI, etal., Circ Res. 1998 Dec 14-28;83(12):1248-63.
22.
Age-related alteration of gap junction distribution and connexin expression in rat aortic endothelium.
Yeh HI, etal., J Histochem Cytochem. 2000 Oct;48(10):1377-89.
Gja4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 144,917,791 - 144,920,324 (-) NCBI GRCr8 mRatBN7.2 5 139,633,324 - 139,635,857 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 139,633,287 - 139,635,925 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 142,328,532 - 142,331,068 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 144,098,526 - 144,101,062 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 144,099,313 - 144,101,849 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 145,374,688 - 145,377,221 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 145,374,690 - 145,377,221 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 149,142,702 - 149,145,235 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 146,755,061 - 146,757,594 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 146,765,101 - 146,767,633 (-) NCBI Celera 5 138,127,254 - 138,129,787 (-) NCBI Celera RH 3.4 Map 5 934.8 RGD Cytogenetic Map 5 q36 NCBI
GJA4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 34,792,999 - 34,795,747 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 34,792,999 - 34,795,747 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 35,258,600 - 35,261,348 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 35,031,186 - 35,033,935 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 34,927,714 - 34,930,439 NCBI Celera 1 33,532,323 - 33,535,072 (+) NCBI Celera Cytogenetic Map 1 p34.3 NCBI HuRef 1 33,376,201 - 33,378,950 (+) NCBI HuRef CHM1_1 1 35,374,168 - 35,376,917 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 34,655,628 - 34,658,374 (+) NCBI T2T-CHM13v2.0
Gja4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 127,205,213 - 127,207,832 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 127,205,214 - 127,207,832 (-) Ensembl GRCm39 Ensembl GRCm38 4 127,311,420 - 127,314,039 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 127,311,421 - 127,314,039 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 126,988,665 - 126,991,222 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 126,813,725 - 126,816,282 (-) NCBI MGSCv36 mm8 Celera 4 125,645,767 - 125,648,324 (-) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 61.47 NCBI
Gja4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 12,902,773 - 12,905,337 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 12,902,764 - 12,905,337 (+) NCBI ChiLan1.0 ChiLan1.0
GJA4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 192,050,029 - 192,052,939 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 191,171,197 - 191,174,108 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 34,059,901 - 34,063,181 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 35,241,402 - 35,244,191 (+) NCBI panpan1.1 PanPan1.1 panPan2
GJA4
Gja4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 51,613,628 - 51,616,047 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 17,439,327 - 17,440,331 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 17,439,250 - 17,440,829 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GJA4
GJA4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 98,092,282 - 98,095,036 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 98,092,785 - 98,093,786 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 18,746,427 - 18,749,170 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gja4
.
Predicted Target Of
Count of predictions: 318 Count of miRNA genes: 189 Interacting mature miRNAs: 221 Transcripts: ENSRNOT00000019246 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH94392
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 139,633,329 - 139,633,503 (+) MAPPER mRatBN7.2 Rnor_6.0 5 145,374,694 - 145,374,867 NCBI Rnor6.0 Rnor_5.0 5 149,142,708 - 149,142,881 UniSTS Rnor5.0 RGSC_v3.4 5 146,755,067 - 146,755,240 UniSTS RGSC3.4 Celera 5 138,127,260 - 138,127,433 UniSTS RH 3.4 Map 5 934.8 UniSTS Cytogenetic Map 5 q36 UniSTS
UniSTS:226049
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 139,633,824 - 139,634,191 (+) MAPPER mRatBN7.2 Rnor_6.0 5 145,375,189 - 145,375,555 NCBI Rnor6.0 Rnor_5.0 5 149,143,203 - 149,143,569 UniSTS Rnor5.0 RGSC_v3.4 5 146,755,562 - 146,755,928 UniSTS RGSC3.4 Celera 5 138,127,755 - 138,128,121 UniSTS Cytogenetic Map 5 q36 UniSTS
RH134065
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 139,633,369 - 139,634,557 (+) MAPPER mRatBN7.2 Rnor_6.0 5 145,374,734 - 145,375,921 NCBI Rnor6.0 Rnor_5.0 5 149,142,748 - 149,143,935 UniSTS Rnor5.0 RGSC_v3.4 5 146,755,107 - 146,756,294 UniSTS RGSC3.4 Celera 5 138,127,300 - 138,128,487 UniSTS Cytogenetic Map 5 q36 UniSTS
PMC197251P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 139,634,422 - 139,634,748 (+) MAPPER mRatBN7.2 Rnor_6.0 5 145,375,787 - 145,376,112 NCBI Rnor6.0 Rnor_5.0 5 149,143,801 - 149,144,126 UniSTS Rnor5.0 RGSC_v3.4 5 146,756,160 - 146,756,485 UniSTS RGSC3.4 Celera 5 138,128,353 - 138,128,678 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019246 ⟹ ENSRNOP00000019246
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 139,633,287 - 139,635,925 (-) Ensembl Rnor_6.0 Ensembl 5 145,374,690 - 145,377,221 (-) Ensembl
RefSeq Acc Id:
NM_021654 ⟹ NP_067686
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 144,917,791 - 144,920,324 (-) NCBI mRatBN7.2 5 139,633,324 - 139,635,857 (-) NCBI Rnor_6.0 5 145,374,688 - 145,377,221 (-) NCBI Rnor_5.0 5 149,142,702 - 149,145,235 (-) NCBI RGSC_v3.4 5 146,755,061 - 146,757,594 (-) RGD Celera 5 138,127,254 - 138,129,787 (-) RGD
Sequence:
CGCAGGCGCAGCTTCGGCCACGGTCGTCCCCTCTACCTGGGCCAGCCGGGCAAGCAGGCGAGAGAGGCCCCGGAAACATGGGTGACTGGGGCTTCCTGGAGAAGCTGCTAGACCAGGTCCAGGAGCAC
hide sequence
RefSeq Acc Id:
NP_067686 ⟸ NM_021654
- UniProtKB:
Q03190 (UniProtKB/Swiss-Prot), A0A654IEV1 (UniProtKB/TrEMBL)
- Sequence:
MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLIYLGHVIYLSRREERLRQKEGELRALPSKDPHVERALA
hide sequence
Ensembl Acc Id:
ENSRNOP00000019246 ⟸ ENSRNOT00000019246
RGD ID: 13694049 Promoter ID: EPDNEW_R4574 Type: single initiation site Name: Gja4_1 Description: gap junction protein, alpha 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 145,377,231 - 145,377,291 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-05-20
Gja4
gap junction protein, alpha 4
Gja4
gap junction membrane channel protein alpha 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Gja4
gap junction membrane channel protein alpha 4
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
expression increases in response to sciatic nerve injury
728686
