Symbol:
Smurf1
Name:
SMAD specific E3 ubiquitin protein ligase 1
RGD ID:
1594738
Description:
Predicted to enable SMAD binding activity; signaling receptor binding activity; and ubiquitin protein ligase activity. Involved in positive regulation of axon extension. Located in axon and neuronal cell body. Orthologous to human SMURF1 (SMAD specific E3 ubiquitin protein ligase 1); PARTICIPATES IN Bone morphogenetic proteins signaling pathway; transforming growth factor-beta Smad dependent signaling pathway; INTERACTS WITH 1,3-dinitrobenzene; 17beta-estradiol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
E3 ubiquitin-protein ligase SMURF1; LOC690516; RGD1309707; similar to Smad ubiquitination regulatory factor 1 isoform 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 14,748,717 - 14,840,273 (+) NCBI GRCr8 mRatBN7.2 12 9,635,009 - 9,726,520 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 9,635,025 - 9,726,519 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 10,438,588 - 10,530,424 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 11,061,801 - 11,153,638 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 10,086,150 - 10,176,124 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 11,433,815 - 11,526,465 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 11,407,213 - 11,526,465 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 13,499,018 - 13,591,105 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 9,950,304 - 10,042,391 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 11,439,779 - 11,530,606 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - PID (archival)
1,3-dinitrobenzene (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) amitrole (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP) butanal (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) cocaine (EXP) curcumin (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) divanadium pentaoxide (ISO) doxorubicin (ISO) elemental selenium (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) folic acid (ISO) formaldehyde (ISO) genistein (ISO) irinotecan (ISO) methapyrilene (ISO) methimazole (EXP) methoxychlor (EXP) methylmercury chloride (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nickel atom (EXP) nickel sulfate (EXP) paracetamol (EXP,ISO) pirinixic acid (ISO) quercetin (ISO) resveratrol (ISO) selenium atom (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) tacrolimus hydrate (ISO) testosterone (EXP,ISO) tetrachloromethane (ISO) thiram (ISO) triphenyl phosphate (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
autophagy (ISO) BMP signaling pathway (IEA,ISO) cell differentiation (IEA,ISO) defense response to virus (ISO) engulfment of target by autophagosome (IEA,ISO) negative regulation of activin receptor signaling pathway (IEA,ISO) negative regulation of BMP signaling pathway (IBA,IEA,ISO) negative regulation of ossification (ISO) negative regulation of transforming growth factor beta receptor signaling pathway (IEA,ISO) positive regulation of axon extension (IMP) positive regulation of dendrite extension (IEA,ISO) positive regulation of ubiquitin-dependent protein catabolic process (IEA,ISO) proteasome-mediated ubiquitin-dependent protein catabolic process (IBA,IEA,ISO) protein catabolic process (ISO) protein export from nucleus (IEA,ISO) protein K63-linked ubiquitination (ISO) protein localization to plasma membrane (IEA,ISO) protein polyubiquitination (IEA,ISO) protein targeting to vacuole involved in autophagy (IEA,ISO) protein ubiquitination (IEA,ISO) receptor catabolic process (IEA,ISO) regulation of axon extension (ISO) substrate localization to autophagosome (IEA,ISO) type 2 mitophagy (ISO) ubiquitin-dependent protein catabolic process (IEA,ISO)
1.
The Nedd4-like family of E3 ubiquitin ligases and cancer.
Chen C and Matesic LE, Cancer Metastasis Rev. 2007 Dec;26(3-4):587-604.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
p250GAP is a novel player in the Cdh1-APC/Smurf1 pathway of axon growth regulation.
Kannan M, etal., PLoS One. 2012;7(11):e50735. doi: 10.1371/journal.pone.0050735. Epub 2012 Nov 30.
4.
Up-regulation of Smurf1 after spinal cord injury in adult rats.
Li D, etal., J Mol Histol. 2013 Aug;44(4):381-90. doi: 10.1007/s10735-013-9499-2. Epub 2013 Apr 18.
5.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Comprehensive gene review and curation
RGD comprehensive gene curation
9.
Mechanisms of TGF-beta signaling from cell membrane to the nucleus.
Shi Y and Massague J, Cell. 2003 Jun 13;113(6):685-700.
10.
Protein kinase Czeta and glycogen synthase kinase-3beta control neuronal polarity in developing rodent enteric neurons, whereas SMAD specific E3 ubiquitin protein ligase 1 promotes neurite growth but does not influence polarity.
Vohra BP, etal., J Neurosci. 2007 Aug 29;27(35):9458-68.
Smurf1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 14,748,717 - 14,840,273 (+) NCBI GRCr8 mRatBN7.2 12 9,635,009 - 9,726,520 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 9,635,025 - 9,726,519 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 10,438,588 - 10,530,424 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 11,061,801 - 11,153,638 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 10,086,150 - 10,176,124 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 11,433,815 - 11,526,465 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 11,407,213 - 11,526,465 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 13,499,018 - 13,591,105 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 9,950,304 - 10,042,391 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 11,439,779 - 11,530,606 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
SMURF1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 99,027,440 - 99,144,108 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 99,027,440 - 99,144,108 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 98,625,063 - 98,741,731 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 98,463,000 - 98,579,659 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 7 93,353,908 - 93,471,364 (-) NCBI Celera Cytogenetic Map 7 q22.1 NCBI HuRef 7 93,257,804 - 93,374,432 (-) NCBI HuRef CHM1_1 7 98,555,482 - 98,672,053 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 100,260,765 - 100,377,379 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 97,981,091 - 98,097,765 (-) NCBI
Smurf1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 144,813,305 - 144,902,657 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 144,813,305 - 144,902,657 (-) Ensembl GRCm39 Ensembl GRCm38 5 144,876,495 - 144,965,899 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 144,876,495 - 144,965,847 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 145,637,364 - 145,726,699 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 145,130,022 - 145,219,357 (-) NCBI MGSCv36 mm8 MGSCv36 5 143,961,853 - 144,051,632 (-) NCBI MGSCv36 mm8 Celera 5 141,867,627 - 141,904,898 (-) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 84.83 NCBI
Smurf1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955460 14,774,545 - 14,802,879 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955460 14,774,545 - 14,860,783 (-) NCBI ChiLan1.0 ChiLan1.0
SMURF1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 116,882,049 - 116,998,395 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 165,146,684 - 165,263,030 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 90,995,923 - 91,112,240 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 104,500,965 - 104,568,046 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 104,500,965 - 104,568,046 (-) Ensembl panpan1.1 panPan2
SMURF1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 10,385,781 - 10,498,071 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 10,385,779 - 10,494,922 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 12,010,745 - 12,124,123 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 10,384,720 - 10,498,106 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 10,384,957 - 10,497,052 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 10,254,596 - 10,367,952 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 10,233,259 - 10,346,407 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 10,466,893 - 10,580,346 (+) NCBI UU_Cfam_GSD_1.0
Smurf1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 138,531,835 - 138,563,396 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936750 1,381,851 - 1,407,323 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936750 1,381,864 - 1,406,736 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SMURF1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 6,037,741 - 6,142,575 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 6,037,732 - 6,142,569 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 6,098,677 - 6,149,341 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SMURF1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 14,019,733 - 14,141,588 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 14,019,968 - 14,141,795 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666070 2,154,820 - 2,276,911 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Smurf1
.
Predicted Target Of
Count of predictions: 891 Count of miRNA genes: 300 Interacting mature miRNAs: 403 Transcripts: ENSRNOT00000031901 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 5921918 25247790 Rat 70213 Niddm27 Non-insulin dependent diabetes mellitus QTL 27 3.72 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 11200494 52308831 Rat 2306789 Ean6 Experimental allergic neuritis QTL 6 4.9 nervous system integrity trait (VT:0010566) experimental autoimmune neuritis severity score (CMO:0001528) 12 1 29775522 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 11200494 52308831 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 11200494 52308831 Rat 1357337 Gluco3 Glucose level QTL 3 0.0004 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 12 1 16966671 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 3489416 48489416 Rat 1331739 Hrtrt14 Heart rate QTL 14 3.56232 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 12 1 38687564 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 11200497 52308831 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 1 33700600 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 11743528 52308831 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 11200494 52308831 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 11869600 16966542 Rat 61334 Gluco17 Glucose level QTL 17 6.3 adipocyte glucose uptake trait (VT:0004185) adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874) 12 1 16966671 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 1 38635130 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 28133365 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 12233000 30490641 Rat 1300174 Bw15 Body weight QTL 15 2.93 body mass (VT:0001259) body weight loss (CMO:0001399) 12 1 28606299 Rat 1331787 Rf41 Renal function QTL 41 2.998 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 12 1 33700556 Rat 724526 Uae3 Urinary albumin excretion QTL 3 4.9 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 12 1 15486827 Rat 1331763 Wbc2 White blood cell count QTL 2 3.162 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 12 11200494 52308831 Rat 7204484 Bp358 Blood pressure QTL 358 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 1 24849755 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 11200494 52308831 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 2747694 47747694 Rat 2303568 Bw88 Body weight QTL 88 3 body mass (VT:0001259) body weight (CMO:0000012) 12 1 28606299 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 3087180 48087180 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 11200494 52308831 Rat 7243862 Mcs30 Mammary carcinoma susceptibility QTL 30 8.62 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 12 5633306 50633306 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 7901625 33938215 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 11200494 52308831 Rat
RH142403
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 9,726,080 - 9,726,238 (+) MAPPER mRatBN7.2 Rnor_6.0 12 11,526,027 - 11,526,184 NCBI Rnor6.0 Rnor_5.0 12 13,590,667 - 13,590,824 UniSTS Rnor5.0 RGSC_v3.4 12 10,041,953 - 10,042,110 UniSTS RGSC3.4 Celera 12 11,530,168 - 11,530,325 UniSTS RH 3.4 Map 12 144.41 UniSTS Cytogenetic Map 12 p11 UniSTS
BE096092
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 9,653,529 - 9,653,679 (+) MAPPER mRatBN7.2 Rnor_6.0 12 11,453,456 - 11,453,605 NCBI Rnor6.0 Rnor_6.0 12 11,425,771 - 11,425,920 NCBI Rnor6.0 Rnor_5.0 12 13,518,096 - 13,518,245 UniSTS Rnor5.0 Rnor_5.0 12 13,490,974 - 13,491,123 UniSTS Rnor5.0 RGSC_v3.4 12 9,969,383 - 9,969,532 UniSTS RGSC3.4 Celera 12 11,457,969 - 11,458,118 UniSTS RH 3.4 Map 12 119.7 UniSTS Cytogenetic Map 12 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000031901 ⟹ ENSRNOP00000031927
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 9,635,025 - 9,726,519 (+) Ensembl Rnor_6.0 Ensembl 12 11,433,813 - 11,523,820 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000082989 ⟹ ENSRNOP00000071653
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 9,635,309 - 9,726,519 (+) Ensembl Rnor_6.0 Ensembl 12 11,407,213 - 11,526,465 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000084577 ⟹ ENSRNOP00000073635
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 9,635,309 - 9,726,519 (+) Ensembl Rnor_6.0 Ensembl 12 11,433,819 - 11,523,771 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112221 ⟹ ENSRNOP00000076358
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 9,700,949 - 9,726,519 (+) Ensembl
RefSeq Acc Id:
NM_001109598 ⟹ NP_001103068
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,749,043 - 14,840,273 (+) NCBI mRatBN7.2 12 9,635,309 - 9,726,519 (+) NCBI Rnor_6.0 12 11,433,815 - 11,526,465 (+) NCBI Rnor_5.0 12 13,499,018 - 13,591,105 (+) NCBI RGSC_v3.4 12 9,950,304 - 10,042,391 (+) ENTREZGENE Celera 12 11,439,779 - 11,530,606 (+) ENTREZGENE
Sequence:
GCCGGCCGGCCGCTGGCGGGAGATGTCGAACCCCGGGACCCGTAGGAACGGCTCCAGCATCAAGATCCGTCTGACAGTATTGTGTGCCAAGAACCTTGCAAAGAAAGACTTCTTCAGACTCCCCGACC
hide sequence
RefSeq Acc Id:
XM_006248882 ⟹ XP_006248944
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,748,717 - 14,840,273 (+) NCBI mRatBN7.2 12 9,635,009 - 9,726,520 (+) NCBI Rnor_6.0 12 11,433,819 - 11,526,465 (+) NCBI Rnor_5.0 12 13,499,018 - 13,591,105 (+) NCBI
Sequence:
GCCGGCCGCTGGCGGGAGATGTCGAACCCCGGGACCCGTAGGAACGGCTCCAGCATCAAGATCCGTCTGACAGTATTGTGTGCCAAGAACCTTGCAAAGAAAGACTTCTTCAGACTCCCCGACCCCTT
hide sequence
RefSeq Acc Id:
XM_008769002 ⟹ XP_008767224
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,748,751 - 14,840,273 (+) NCBI mRatBN7.2 12 9,635,009 - 9,726,520 (+) NCBI Rnor_6.0 12 11,433,819 - 11,526,465 (+) NCBI
Sequence:
GCCGGCCGCTGGCGGGAGATGTCGAACCCCGGGACCCGTAGGAACGGCTCCAGCATCAAGATCC
hide sequence
RefSeq Acc Id:
XM_017598462 ⟹ XP_017453951
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,748,748 - 14,840,273 (+) NCBI mRatBN7.2 12 9,635,009 - 9,726,520 (+) NCBI Rnor_6.0 12 11,433,819 - 11,526,465 (+) NCBI
Sequence:
GCCGGCCGCTGGCGGGAGATGTCGAACCCCGGGACCCGTAGGAACGGCTCCAGCATCAAGATCC
hide sequence
RefSeq Acc Id:
XM_039089789 ⟹ XP_038945717
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,748,749 - 14,840,273 (+) NCBI mRatBN7.2 12 9,635,009 - 9,726,520 (+) NCBI
RefSeq Acc Id:
XR_010056420
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,750,769 - 14,815,647 (+) NCBI
RefSeq Acc Id:
NP_001103068 ⟸ NM_001109598
- UniProtKB:
D3ZCF5 (UniProtKB/TrEMBL), A6K1G6 (UniProtKB/TrEMBL)
- Sequence:
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDA
hide sequence
RefSeq Acc Id:
XP_006248944 ⟸ XM_006248882
- Peptide Label:
isoform X4
- UniProtKB:
A0A0G2K612 (UniProtKB/TrEMBL), D3ZCF5 (UniProtKB/TrEMBL)
- Sequence:
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDA
hide sequence
RefSeq Acc Id:
XP_008767224 ⟸ XM_008769002
- Peptide Label:
isoform X2
- UniProtKB:
D3ZCF5 (UniProtKB/TrEMBL)
- Sequence:
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDA
hide sequence
RefSeq Acc Id:
XP_017453951 ⟸ XM_017598462
- Peptide Label:
isoform X1
- UniProtKB:
D3ZCF5 (UniProtKB/TrEMBL)
- Sequence:
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDA
hide sequence
Ensembl Acc Id:
ENSRNOP00000071653 ⟸ ENSRNOT00000082989
Ensembl Acc Id:
ENSRNOP00000073635 ⟸ ENSRNOT00000084577
Ensembl Acc Id:
ENSRNOP00000031927 ⟸ ENSRNOT00000031901
RefSeq Acc Id:
XP_038945717 ⟸ XM_039089789
- Peptide Label:
isoform X3
- UniProtKB:
D3ZCF5 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000076358 ⟸ ENSRNOT00000112221
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2010-04-23
Smurf1
SMAD specific E3 ubiquitin protein ligase 1
LOC690516
similar to Smad ubiquitination regulatory factor 1 isoform 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-07-08
LOC690516
similar to Smad ubiquitination regulatory factor 1 isoform 2
RGD1309707
similar to RIKEN cDNA 4930431E10
Data merged from RGD:1309707
1643240 APPROVED
2008-04-30
RGD1309707
similar to RIKEN cDNA 4930431E10
RGD1309707_predicted
similar to RIKEN cDNA 4930431E10 (predicted)
'predicted' is removed
2292626 APPROVED
2006-11-20
LOC690516
similar to Smad ubiquitination regulatory factor 1 isoform 2
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-20
RGD1309707_predicted
similar to RIKEN cDNA 4930431E10 (predicted)
LOC288469_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC288469_predicted
similar to RIKEN cDNA 4930431E10 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
