Symbol:
Pdcd1
Name:
programmed cell death 1
RGD ID:
1311658
Description:
Predicted to enable signaling receptor activity. Predicted to be involved in negative regulation of T cell activation; negative regulation of T cell mediated immune response to tumor cell; and positive regulation of T cell apoptotic process. Predicted to act upstream of or within negative regulation of B cell apoptotic process and negative regulation of tolerance induction. Predicted to be active in external side of plasma membrane. Biomarker of anti-basement membrane glomerulonephritis; periodontitis; and pre-eclampsia. Human ortholog(s) of this gene implicated in autoimmune disease (multiple); hepatitis B; hepatitis C; hepatocellular carcinoma; and lupus nephritis. Orthologous to human PDCD1 (programmed cell death 1); PARTICIPATES IN T cell receptor signaling pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC102550808; LOC301626; programmed cell death protein 1; programmed cell death protein 1-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 101,866,124 - 101,879,278 (-) NCBI GRCr8 mRatBN7.2 9 94,418,786 - 94,431,945 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 94,418,791 - 94,431,937 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 102,854,260 - 102,867,404 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 107,989,476 - 108,002,637 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 106,346,469 - 106,359,638 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 101,305,742 - 101,319,937 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 101,307,764 - 101,319,845 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 101,025,313 - 101,038,625 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 100,676,274 - 100,690,991 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 93,172,543 - 93,185,687 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 9 91,952,891 - 91,966,035 (-) NCBI Celera Cytogenetic Map 9 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pdcd1 Rat acute myeloid leukemia treatment ISO RGD:1323232 41410789 RGD Pdcd1 Rat acute myocarditis severity ISO RGD:1323232 40822819 associated with Coxsackievirus Infections; RGD Pdcd1 Rat acute myocarditis treatment ISO RGD:1323232 40822819 associated with Coxsackievirus Infections; RGD Pdcd1 Rat anogenital venereal wart ISO RGD:1323231 40400714 mRNA,protein:increased expression:multiple (human) RGD Pdcd1 Rat anti-basement membrane glomerulonephritis treatment IEP 7248671 RGD Pdcd1 Rat asthma treatment ISO RGD:1323232 41412180 associated with Chlamydia pneumonia RGD Pdcd1 Rat autoimmune hepatitis ISO RGD:1323231 40818236 RGD Pdcd1 Rat autoimmune hepatitis ISO RGD:1323232 41412171 RGD Pdcd1 Rat Burns treatment ISO RGD:1323232 41410788 associated with Pseudomonas Infections; associated with Staphylococcal Infections RGD Pdcd1 Rat cervix uteri carcinoma in situ severity ISO RGD:1323231 40822817 associated with Papillomavirus Infections; protein:increased expression:T cell RGD Pdcd1 Rat Chlamydia pneumonia ISO RGD:1323232 41412180 mRNA:increased expression:lung RGD Pdcd1 Rat Chronic Hepatitis B ISO RGD:1323231 40818262 DNA:SNP:exon: RGD Pdcd1 Rat Chronic Hepatitis B no_association ISO RGD:1323231 40818233 DNA:SNPs::+7146 G>A,+7209 C>T(human) RGD Pdcd1 Rat Chronic Hepatitis B disease_progression ISO RGD:1323231 40818231 DNA:SNP:3' UTR:rs10204525(human) RGD Pdcd1 Rat Chronic Hepatitis B ISO RGD:1323231 40818415 protein:altered expression:serum: RGD Pdcd1 Rat Colonic Neoplasms treatment ISO RGD:1323232 9589070 RGD Pdcd1 Rat Colorectal Neoplasms IEP 9589083 protein:increased expression:colonic mucosa, lymphocyte RGD Pdcd1 Rat cryptococcal meningitis treatment ISO RGD:1323231 41412178 RGD Pdcd1 Rat cryptococcal meningitis treatment ISO RGD:1323232 41412178 RGD Pdcd1 Rat cystitis ISO RGD:1323232 7248677 RGD Pdcd1 Rat Cytomegalovirus Infections susceptibility ISO RGD:1323231 40818426 associated with kidney transplantation; DNA:SNP: :rs11568821(human) RGD Pdcd1 Rat dilated cardiomyopathy ISO RGD:1323232 9589058 RGD Pdcd1 Rat Experimental Autoimmune Encephalomyelitis susceptibility ISO RGD:1323232 40818258 RGD Pdcd1 Rat Experimental Melanoma treatment ISO RGD:1323232 9589070 RGD Pdcd1 Rat Fungemia treatment ISO RGD:1323232 40818234 RGD Pdcd1 Rat Fungemia ISO RGD:1323232 40818234 protein:increased expression:CD4 Tcell, CD8 Tcell: RGD Pdcd1 Rat Helicobacter Infections severity ISO RGD:1323231 40818417 RGD Pdcd1 Rat Hepatic Echinococcosis ISO RGD:1323232 41412175 mRNA, protein:increased expression:liver RGD Pdcd1 Rat hepatitis ISO RGD:1323231 40818425 protein:increased expression: leukocyte RGD Pdcd1 Rat hepatitis A disease_progression ISO RGD:1323231 40818419 RGD Pdcd1 Rat hepatitis B susceptibility ISO RGD:1323231 40818423 DNA:SNP: :rs2227981(human) RGD Pdcd1 Rat hepatitis B disease_progression ISO RGD:1323231 40818272 RGD Pdcd1 Rat hepatitis B disease_progression ISO RGD:1323231 40818414 DNA:SNPs,halptype: :rs36084323, rs2227981,rs2227982(human) RGD Pdcd1 Rat hepatitis C disease_progression ISO RGD:1323231 11052797 DNA:SNP:3' UTR:rs10204525(human) RGD Pdcd1 Rat hepatocellular carcinoma disease_progression ISO RGD:1323231 40818257 associated with hepatitis B;DNA:SNP: : +8669 A>G (human) RGD Pdcd1 Rat hepatocellular carcinoma disease_progression ISO RGD:1323231 41410800 associated with hepatitis B RGD Pdcd1 Rat histoplasmosis treatment ISO RGD:1323232 40822806 RGD Pdcd1 Rat human immunodeficiency virus infectious disease ISO RGD:1323231 41412179 RGD Pdcd1 Rat hydronephrosis ISO RGD:1323232 7248681 RGD Pdcd1 Rat lupus nephritis ISO RGD:1323231 7248675 DNA:polymorphism: : RGD Pdcd1 Rat lupus nephritis ISO RGD:1323231 7248676 DNA:polymorphism:intron:6867 C>T (human) RGD Pdcd1 Rat lupus nephritis onset ISO RGD:1323232 7248678 RGD Pdcd1 Rat lymphocytic choriomeningitis ISO RGD:1323232 41410802 RGD Pdcd1 Rat lymphocytic choriomeningitis treatment ISO RGD:1323232 40818232 RGD Pdcd1 Rat melanoma treatment ISO RGD:1323232 40818261 associated with influenza RGD Pdcd1 Rat myocarditis ISO RGD:1323232 9589065 RGD Pdcd1 Rat periodontitis IEP 40886271 protein:increased expression:periodontium RGD Pdcd1 Rat Pneumovirus Infections treatment ISO RGD:1323232 40822811 associated with reinfection RGD Pdcd1 Rat pre-eclampsia treatment IEP 40886269 RGD Pdcd1 Rat pre-eclampsia ISO RGD:1323231 40886269 protein:increased expression:Treg cell RGD Pdcd1 Rat pulmonary tuberculosis treatment ISO RGD:1323231 40818418 RGD Pdcd1 Rat pulmonary tuberculosis ISO RGD:1323231 40818418 protein:increased expression:Tcell, B cell, monocyte RGD Pdcd1 Rat Recurrent Respiratory Papillomatosis ISO RGD:1323231 40822813 RGD Pdcd1 Rat renal cell carcinoma disease_progression ISO RGD:1323231 7248680 RGD Pdcd1 Rat respiratory syncytial virus infectious disease ISO RGD:1323232 11056952 protein:increased expression:CD4 Tcell, CD8 Tcell from lung: RGD Pdcd1 Rat respiratory syncytial virus infectious disease ISO RGD:1323231 11056952 protein:increased expression: CD8 Tcell from nasal wash: RGD Pdcd1 Rat Schistosomiasis Japonica ISO RGD:1323231 40818413 protein:increased expression:CD4 T cell RGD Pdcd1 Rat Schistosomiasis Japonica severity ISO RGD:1323232 40818413 RGD Pdcd1 Rat Schistosomiasis Japonica ISO RGD:1323232 40818413 protein:increased expression:CD4 T cell RGD Pdcd1 Rat Sepsis ISO RGD:1323231 40818424 protein:increased expression:B cell,CD4T cell RGD Pdcd1 Rat Sepsis ISO RGD:1323231 40818235 protein:increased expression:T cell RGD Pdcd1 Rat Sepsis disease_progression ISO RGD:1323231 41412183 protein:increased expression:T cell RGD Pdcd1 Rat Sepsis disease_progression ISO RGD:1323232 40818273 RGD Pdcd1 Rat Sepsis disease_progression ISO RGD:1323231 40822808 RGD Pdcd1 Rat Spinal Cord Injuries treatment IEP 40886268 RGD Pdcd1 Rat stomach cancer disease_progression ISO RGD:1323231 40818238 RGD Pdcd1 Rat stomach cancer ISO RGD:1323231 41410790 associated with Epstein-Barr Virus Infections RGD Pdcd1 Rat Streptococcus pneumonia treatment ISO RGD:1323232 40818422 RGD Pdcd1 Rat systemic lupus erythematosus ISO RGD:1323231 7248679 RGD Pdcd1 Rat systemic lupus erythematosus ISO RGD:1323231 7248674 DNA:polymorphism: : 7,146 G>A (human) RGD Pdcd1 Rat toxic shock syndrome ISO RGD:1323231 40822808 protein:increased expression:serum RGD Pdcd1 Rat toxic shock syndrome severity ISO RGD:1323231 41410786 protein:increased expression:lymphocyte, mononcyte RGD Pdcd1 Rat Transplant Rejection ISO RGD:1323232 9589063 RGD Pdcd1 Rat Transplant Rejection severity ISO RGD:1323231 7248673 mRNA:increased expression:leukocytes, Mononuclear: RGD Pdcd1 Rat Transplant Rejection ISO RGD:1323232 9589060 RGD Pdcd1 Rat triple-receptor negative breast cancer treatment ISO RGD:1323232 40818259 RGD Pdcd1 Rat tuberculosis treatment ISO RGD:1323231 41412174 RGD Pdcd1 Rat type 2 diabetes mellitus ISO RGD:1323232 7248672 protein:increased expression:kidney RGD Pdcd1 Rat Viral Bronchiolitis ISO RGD:1323232 40818270 protein:increased expression:CD8 T cell RGD Pdcd1 Rat viral encephalitis ISO RGD:1323232 40818239 protein:increased expression: CD8 T celll RGD
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Pdcd1 Rat protein binding enables ISO RGD:1323232 1624291 PR:Q9EP73|UniProtKB:Q9EP73|UniProtKB:Q9WUL5 PMID:15568026, PMID:18641123, PMID:21884581, PMID:23417675 RGD PMID:15568026|PMID:18641123|PMID:21884581|PMID:23417675 Pdcd1 Rat protein binding enables ISO RGD:1323231 1624291 UniProtKB:Q06124|UniProtKB:Q4QTK1|UniProtKB:Q6PIJ6|UniProtKB:Q9BQ51|UniProtKB:Q9NZQ7|UniProtKB:Q9NZQ7-1 PMID:15240681, PMID:17489864, PMID:20587542, PMID:21982860, PMID:23417675, PMID:26602187, PMID:28046066, PMID:30487606 RGD PMID:15240681|PMID:17489864|PMID:20587542|PMID:21982860|PMID:23417675|PMID:26602187|PMID:28046066|PMID:30487606 Pdcd1 Rat signaling receptor activity enables ISO RGD:1323231 1624291 PMID:21276005, PMID:38377992 RGD PMID:21276005|PMID:38377992
Imported Annotations - KEGG (archival)
1.
Roles of programmed death-1 (PD-1)/PD-1 ligands pathway in the development of murine acute myocarditis caused by coxsackievirus B3.
null
2.
Endoplasmic reticulum stress response and inflammatory cytokines in type 2 diabetic nephropathy: role of indoleamine 2,3-dioxygenase and programmed death-1.
Baban B, etal., Exp Mol Pathol. 2013 Apr;94(2):343-51. doi: 10.1016/j.yexmp.2012.11.004. Epub 2012 Dec 5.
3.
Genetic, immunologic, and immunohistochemical analysis of the programmed death 1/programmed death ligand 1 pathway in human systemic lupus erythematosus.
Bertsias GK, etal., Arthritis Rheum. 2009 Jan;60(1):207-18. doi: 10.1002/art.24227.
4.
Expression of programmed death 1 and its ligands in the liver of autoimmune hepatitis C57BL/6 mice.
Cao J, etal., Chin Med J (Engl). 2009 Aug 20;122(16):1941-6.
5.
Blockade of the negative co-stimulatory molecules PD-1 and CTLA-4 improves survival in primary and secondary fungal sepsis.
Chang KC, etal., Crit Care. 2013 May 11;17(3):R85. doi: 10.1186/cc12711.
6.
In vitro and in vivo effect of PD-1/PD-L1 blockade on microglia/macrophage activation and T cell subset balance in cryptococcal meningitis.
Che YM, etal., J Cell Biochem. 2018 Apr;119(4):3044-3057. doi: 10.1002/jcb.26432. Epub 2017 Dec 26.
7.
Programmed cell death-1 3'-untranslated region polymorphism is associated with spontaneous clearance of hepatitis B virus infection.
Chihab H, etal., J Med Virol. 2018 Nov;90(11):1730-1738. doi: 10.1002/jmv.25265. Epub 2018 Aug 13.
8.
Phenotypic Characteristics of PD-1 and CTLA-4 Expression in Symptomatic Acute Hepatitis A.
Cho H, etal., Gut Liver. 2016 Mar;10(2):288-94. doi: 10.5009/gnl14368.
9.
CD72/CD100 and PD-1/PD-L1 markers are increased on T and B cells in HIV-1+ viremic individuals, and CD72/CD100 axis is correlated with T-cell exhaustion.
Correa-Rocha R, etal., PLoS One. 2018 Aug 30;13(8):e0203419. doi: 10.1371/journal.pone.0203419. eCollection 2018.
10.
Gene transfer of programmed death ligand-1.Ig prolongs cardiac allograft survival.
Dudler J, etal., Transplantation. 2006 Dec 27;82(12):1733-7.
11.
Viral acute lower respiratory infections impair CD8+ T cells through PD-1.
Erickson JJ, etal., J Clin Invest. 2012 Aug;122(8):2967-82. doi: 10.1172/JCI62860. Epub 2012 Jul 17.
12.
Programmed death-1 impairs secondary effector lung CD8⁺ T cells during respiratory virus reinfection.
Erickson JJ, etal., J Immunol. 2014 Nov 15;193(10):5108-17. doi: 10.4049/jimmunol.1302208. Epub 2014 Oct 22.
13.
Programmed death 1 protects from fatal circulatory failure during systemic virus infection of mice.
Frebel H, etal., J Exp Med. 2012 Dec 17;209(13):2485-99. doi: 10.1084/jem.20121015. Epub 2012 Dec 10.
14.
Therapy With Carboplatin and Anti-PD-1 Antibodies Before Surgery Demonstrates Sustainable Anti-Tumor Effects for Secondary Cancers in Mice With Triple-Negative Breast Cancer.
Gao M, etal., Front Immunol. 2020 Mar 5;11:366. doi: 10.3389/fimmu.2020.00366. eCollection 2020.
15.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
16.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
17.
DUG is a novel homologue of translation initiation factor 4G that binds eIF4A.
Goke A, etal., Biochem Biophys Res Commun 2002 Sep 13;297(1):78-82.
18.
Regulation of Trypanosoma cruzi-induced myocarditis by programmed death cell receptor 1.
Gutierrez FR, etal., Infect Immun. 2011 May;79(5):1873-81. doi: 10.1128/IAI.01047-10. Epub 2011 Feb 28.
19.
Immune suppression in premalignant respiratory papillomas: enriched functional CD4+Foxp3+ regulatory T cells and PD-1/PD-L1/L2 expression.
Hatam LJ, etal., Clin Cancer Res. 2012 Apr 1;18(7):1925-35. doi: 10.1158/1078-0432.CCR-11-2941. Epub 2012 Feb 9.
20.
Dexmedetomidine Mitigates Microglia-Mediated Neuroinflammation through Upregulation of Programmed Cell Death Protein 1 in a Rat Spinal Cord Injury Model.
He H, etal., J Neurotrauma. 2018 Nov 1;35(21):2591-2603. doi: 10.1089/neu.2017.5625. Epub 2018 Jun 7.
21.
Association between a polymorphism in the human programmed death-1 (PD-1) gene and cytomegalovirus infection after kidney transplantation.
Hoffmann TW, etal., J Med Genet. 2010 Jan;47(1):54-8. doi: 10.1136/jmg.2009.068841. Epub 2009 Jul 5.
22.
A Programmed Cell Death-1 Haplotype is Associated with Clearance of Hepatitis B Virus.
Hou Z, etal., Ann Clin Lab Sci. 2017 May;47(3):334-343.
23.
PD-1 expression by macrophages plays a pathologic role in altering microbial clearance and the innate inflammatory response to sepsis.
Huang X, etal., Proc Natl Acad Sci U S A. 2009 Apr 14;106(15):6303-8. doi: 10.1073/pnas.0809422106. Epub 2009 Mar 30.
24.
Prognostic Significance of PD-1, PD-L1 and CD8 Gene Expression Levels in Gastric Cancer.
Ito S, etal., Oncology. 2020;98(7):501-511. doi: 10.1159/000506075. Epub 2020 May 7.
25.
Correlation of CpG methylation of the Pdcd1 gene with PD-1 expression on CD8+ T cells and medical laboratory indicators in chronic hepatitis B infection.
Jiao L, etal., J Gene Med. 2020 Feb;22(2):e3148. doi: 10.1002/jgm.3148. Epub 2020 Jan 9.
26.
Association of a PDCD1 polymorphism with renal manifestations in systemic lupus erythematosus.
Johansson M, etal., Arthritis Rheum. 2005 Jun;52(6):1665-9.
27.
Chronically inflamed livers up-regulate expression of inhibitory B7 family members.
Kassel R, etal., Hepatology. 2009 Nov;50(5):1625-37. doi: 10.1002/hep.23173.
28.
Non-oncogenic Acute Viral Infections Disrupt Anti-cancer Responses and Lead to Accelerated Cancer-Specific Host Death.
Kohlhapp FJ, etal., Cell Rep. 2016 Oct 18;17(4):957-965. doi: 10.1016/j.celrep.2016.09.068.
29.
Upregulation of PD-1 on CD4⁺CD25⁺ T cells is associated with immunosuppression in liver of mice infected with Echinococcus multilocularis.
La X, etal., Int Immunopharmacol. 2015 Jun;26(2):357-66. doi: 10.1016/j.intimp.2015.04.013. Epub 2015 Apr 20.
30.
Anti-programmed death-1 synergizes with granulocyte macrophage colony-stimulating factor--secreting tumor cell immunotherapy providing therapeutic benefit to mice with established tumors.
Li B, etal., Clin Cancer Res. 2009 Mar 1;15(5):1623-34. doi: 10.1158/1078-0432.CCR-08-1825. Epub 2009 Feb 10.
31.
Genetic polymorphisms of immune checkpoint proteins PD-1 and TIM-3 are associated with survival of patients with hepatitis B virus-related hepatocellular carcinoma.
Li Z, etal., Oncotarget. 2016 May 3;7(18):26168-80. doi: 10.18632/oncotarget.8435.
32.
Genetic variations in LTA gene and PDCD1 gene and intrauterine infection of hepatitis B virus: a case-control study in China.
Liu T, etal., Amino Acids. 2018 Jul;50(7):877-883. doi: 10.1007/s00726-018-2568-9. Epub 2018 May 21.
33.
The PD-1/PD-L costimulatory pathway critically affects host resistance to the pathogenic fungus Histoplasma capsulatum.
Lázár-Molnár E, etal., Proc Natl Acad Sci U S A. 2008 Feb 19;105(7):2658-63. doi: 10.1073/pnas.0711918105. Epub 2008 Feb 11.
34.
Programmed Death-Ligand 1 Expression Is Common in Gastric Cancer Associated With Epstein-Barr Virus or Microsatellite Instability.
Ma C, etal., Am J Surg Pathol. 2016 Nov;40(11):1496-1506. doi: 10.1097/PAS.0000000000000698.
35.
Blockade of the PD-1/PD-1L pathway reverses the protective effect of anti-CD40L therapy in a rat to mouse concordant islet xenotransplantation model.
Mai G, etal., Xenotransplantation. 2007 May;14(3):243-8.
36.
Anti-programmed cell death-1 antibody as a new serological marker for type 1 autoimmune hepatitis.
Matsumoto K, etal., J Gastroenterol Hepatol. 2014 Jan;29(1):110-5. doi: 10.1111/jgh.12340.
37.
PD-1 suppresses protective immunity to Streptococcus pneumoniae through a B cell-intrinsic mechanism.
McKay JT, etal., J Immunol. 2015 Mar 1;194(5):2289-99. doi: 10.4049/jimmunol.1401673. Epub 2015 Jan 26.
38.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
39.
Modulation of expression of Programmed Death-1 by administration of probiotic Dahi in DMH-induced colorectal carcinogenesis in rats.
Mohania D, etal., Acta Biomed. 2013 Sep 1;84(2):102-9.
40.
A putative regulatory polymorphism in PD-1 is associated with nephropathy in a population-based cohort of systemic lupus erythematosus patients.
Nielsen C, etal., Lupus. 2004;13(7):510-6.
41.
Hydronephrosis associated with antiurothelial and antinuclear autoantibodies in BALB/c-Fcgr2b-/-Pdcd1-/- mice.
Okazaki T, etal., J Exp Med. 2005 Dec 19;202(12):1643-8. Epub 2005 Dec 13.
42.
Autoantibodies against cardiac troponin I are responsible for dilated cardiomyopathy in PD-1-deficient mice.
Okazaki T, etal., Nat Med. 2003 Dec;9(12):1477-83. Epub 2003 Nov 2.
43.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
44.
Notch Signaling Pathway Was Involved in Regulating Programmed Cell Death 1 Expression during Sepsis-Induced Immunosuppression.
Pan T, etal., Mediators Inflamm. 2015;2015:539841. doi: 10.1155/2015/539841. Epub 2015 Apr 30.
45.
Frontline Science: Anti-PD-L1 protects against infection with common bacterial pathogens after burn injury.
Patil NK, etal., J Leukoc Biol. 2018 Jan;103(1):23-33. doi: 10.1002/JLB.5HI0917-360R. Epub 2017 Dec 21.
46.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
47.
Stimulation of the PD-1/PDL-1 T-cell co-inhibitory pathway is effective in treatment of experimental autoimmune glomerulonephritis.
Reynolds J, etal., Nephrol Dial Transplant. 2012 Apr;27(4):1343-50. doi: 10.1093/ndt/gfr529. Epub 2011 Sep 29.
48.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
49.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
50.
Comprehensive gene review and curation
RGD comprehensive gene curation
51.
Monocyte programmed death ligand-1 expression after 3-4 days of sepsis is associated with risk stratification and mortality in septic patients: a prospective cohort study.
Shao R, etal., Crit Care. 2016 May 9;20(1):124. doi: 10.1186/s13054-016-1301-x.
52.
The characteristic profiles of PD-1 and PD-L1 expressions and dynamic changes during treatment in active tuberculosis.
Shen L, etal., Tuberculosis (Edinb). 2016 Dec;101:146-150. doi: 10.1016/j.tube.2016.10.001. Epub 2016 Oct 1.
53.
Immunovirotherapy with vesicular stomatitis virus and PD-L1 blockade enhances therapeutic outcome in murine acute myeloid leukemia.
Shen W, etal., Blood. 2016 Mar 17;127(11):1449-58. doi: 10.1182/blood-2015-06-652503. Epub 2015 Dec 28.
54.
Mechanistic investigation of immunosuppression in patients with condyloma acuminata.
Shi YJ, etal., Mol Med Rep. 2013 Aug;8(2):480-6. doi: 10.3892/mmr.2013.1511. Epub 2013 Jun 6.
55.
PD-1 Dynamically Regulates Inflammation and Development of Brain-Resident Memory CD8 T Cells During Persistent Viral Encephalitis.
Shwetank, etal., Front Immunol. 2019 Apr 17;10:783. doi: 10.3389/fimmu.2019.00783. eCollection 2019.
56.
Inhibiting the programmed death 1 pathway rescues Mycobacterium tuberculosis-specific interferon γ-producing T cells from apoptosis in patients with pulmonary tuberculosis.
Singh A, etal., J Infect Dis. 2013 Aug 15;208(4):603-15. doi: 10.1093/infdis/jit206. Epub 2013 May 9.
57.
Programmed Death Ligand 1 Promotes Early-Life Chlamydia Respiratory Infection-Induced Severe Allergic Airway Disease.
Starkey MR, etal., Am J Respir Cell Mol Biol. 2016 Apr;54(4):493-503. doi: 10.1165/rcmb.2015-0204OC.
58.
BALB/c-Fcgr2bPdcd1 mouse expressing anti-urothelial antibody is a novel model of autoimmune cystitis.
Sugino Y, etal., Sci Rep. 2012;2:317. doi: 10.1038/srep00317. Epub 2012 Mar 19.
59.
PD-1 is expressed by tumor-infiltrating immune cells and is associated with poor outcome for patients with renal cell carcinoma.
Thompson RH, etal., Clin Cancer Res. 2007 Mar 15;13(6):1757-61.
60.
The PD-1/PD-L1 inhibitory pathway is altered in pre-eclampsia and regulates T cell responses in pre-eclamptic rats.
Tian M, etal., Sci Rep. 2016 Jun 9;6:27683. doi: 10.1038/srep27683.
61.
Association of PDCD1 polymorphisms with childhood-onset systemic lupus erythematosus.
Velazquez-Cruz R, etal., Eur J Hum Genet. 2007 Mar;15(3):336-41. Epub 2007 Jan 17.
62.
Aberrant production of soluble inducible T cell co‑stimulator and soluble programmed cell death protein 1 in patients with chronic hepatitis B.
Wang D, etal., Mol Med Rep. 2017 Dec;16(6):8556-8562. doi: 10.3892/mmr.2017.7630. Epub 2017 Sep 26.
63.
TLR4 signaling improves PD-1 blockade therapy during chronic viral infection.
Wang Y, etal., PLoS Pathog. 2019 Feb 6;15(2):e1007583. doi: 10.1371/journal.ppat.1007583. eCollection 2019 Feb.
64.
Programmed death 1 mRNA in peripheral blood as biomarker of acute renal allograft rejection.
Wang YW, etal., Chin Med J (Engl). 2011 Mar;124(5):674-8.
65.
Lymphocyte subset expression and serum concentrations of PD-1/PD-L1 in sepsis - pilot study.
Wilson JK, etal., Crit Care. 2018 Apr 17;22(1):95. doi: 10.1186/s13054-018-2020-2.
66.
Blockade of programmed death-1 in young (New Zealand black x New Zealand white)F1 mice promotes the activity of suppressive CD8+ T cells that protect from lupus-like disease.
Wong M, etal., J Immunol. 2010 Dec 1;185(11):6563-71. doi: 10.4049/jimmunol.0903401. Epub 2010 Nov 1.
67.
Suppression of furin by interferon-γ and the impact on hepatitis B virus antigen biosynthesis in human hepatocytes.
Wu JF, etal., Am J Pathol. 2012 Jul;181(1):19-25. doi: 10.1016/j.ajpath.2012.03.036. Epub 2012 May 24.
68.
Expression of CD25(high) regulatory T cells and PD-1 in gastric infiltrating CD4(+) T lymphocytes in patients with Helicobacter pylori infection.
Wu YY, etal., Clin Vaccine Immunol. 2011 Jul;18(7):1198-201. doi: 10.1128/CVI.00422-10. Epub 2011 May 11.
69.
Immune Checkpoint Receptors Tim-3 and PD-1 Regulate Monocyte and T Lymphocyte Function in Septic Patients.
Xia Q, etal., Mediators Inflamm. 2018 Nov 22;2018:1632902. doi: 10.1155/2018/1632902. eCollection 2018.
70.
Genetic variations of IL-28B and PD-1 are in association with the susceptibility and outcomes of HCV infection in Southeast China.
Xiao W, etal., Infect Genet Evol. 2015 Jun;32:89-96. doi: 10.1016/j.meegid.2015.02.022. Epub 2015 Mar 5.
71.
Increased expression of programmed death (PD)-1 and its ligand PD-L1 correlates with impaired cell-mediated immunity in high-risk human papillomavirus-related cervical intraepithelial neoplasia.
Yang W, etal., Immunology. 2013 Aug;139(4):513-22. doi: 10.1111/imm.12101.
72.
[Temporal expression of PD-1 and PD-L1 during the development of experimental periodontitis in rats and its implications].
Yang X, etal., Shanghai Kou Qiang Yi Xue. 2019 Dec;28(6):591-596.
73.
Control of pathogenic effector T-cell activities in situ by PD-L1 expression on respiratory inflammatory dendritic cells during respiratory syncytial virus infection.
Yao S, etal., Mucosal Immunol. 2015 Jul;8(4):746-59. doi: 10.1038/mi.2014.106. Epub 2014 Dec 3.
74.
Upregulation of circulating PD-L1/PD-1 is associated with poor post-cryoablation prognosis in patients with HBV-related hepatocellular carcinoma.
Zeng Z, etal., PLoS One. 2011;6(9):e23621. doi: 10.1371/journal.pone.0023621. Epub 2011 Sep 1.
75.
PD-1 deletion restores susceptibility to experimental autoimmune encephalomyelitis in miR-155-deficient mice.
Zhang J and Braun MY, Int Immunol. 2014 Jul;26(7):407-15. doi: 10.1093/intimm/dxu043. Epub 2014 Mar 19.
76.
Predictive Value of Soluble Programmed Death-1 for Severe Sepsis and Septic Shock During the First Week in an Intensive Care Unit.
Zhao Y, etal., Shock. 2019 Mar;51(3):289-297. doi: 10.1097/SHK.0000000000001171.
77.
Association between hepatitis B viral burden in chronic infection and a functional single nucleotide polymorphism of the PDCD1 gene.
Zheng L, etal., J Clin Immunol. 2010 Nov;30(6):855-60. doi: 10.1007/s10875-010-9450-1. Epub 2010 Aug 11.
78.
Blockade of PD-1 Signaling Enhances Th2 Cell Responses and Aggravates Liver Immunopathology in Mice with Schistosomiasis japonica.
Zhou S, etal., PLoS Negl Trop Dis. 2016 Oct 28;10(10):e0005094. doi: 10.1371/journal.pntd.0005094. eCollection 2016 Oct.
79.
Relationship between programmed cell death-1 polymorphisms and clearance of hepatitis B virus.
Ülger Y, etal., Int J Immunogenet. 2015 Jun;42(3):133-9. doi: 10.1111/iji.12187. Epub 2015 Mar 4.
Pdcd1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 101,866,124 - 101,879,278 (-) NCBI GRCr8 mRatBN7.2 9 94,418,786 - 94,431,945 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 94,418,791 - 94,431,937 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 102,854,260 - 102,867,404 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 107,989,476 - 108,002,637 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 106,346,469 - 106,359,638 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 101,305,742 - 101,319,937 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 101,307,764 - 101,319,845 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 101,025,313 - 101,038,625 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 100,676,274 - 100,690,991 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 93,172,543 - 93,185,687 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 9 91,952,891 - 91,966,035 (-) NCBI Celera Cytogenetic Map 9 q36 NCBI
PDCD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 241,849,884 - 241,858,894 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 241,849,884 - 241,858,894 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 242,792,036 - 242,801,046 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 242,440,711 - 242,449,731 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 236,456,683 - 236,465,707 (-) NCBI Celera Cytogenetic Map 2 q37.3 NCBI HuRef 2 234,541,510 - 234,550,535 (-) NCBI HuRef CHM1_1 2 242,797,131 - 242,806,156 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 242,351,431 - 242,360,440 (-) NCBI T2T-CHM13v2.0
Pdcd1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 93,966,027 - 93,980,278 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 93,966,027 - 93,980,278 (-) Ensembl GRCm39 Ensembl GRCm38 1 94,038,305 - 94,052,553 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 94,038,305 - 94,052,553 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 95,934,882 - 95,949,130 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 95,868,711 - 95,882,959 (-) NCBI MGSCv36 mm8 Celera 1 96,903,284 - 96,917,529 (-) NCBI Celera Cytogenetic Map 1 D NCBI cM Map 1 47.47 NCBI
Pdcd1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955542 49,259 - 58,823 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955542 49,290 - 57,747 (+) NCBI ChiLan1.0 ChiLan1.0
PDCD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 144,543,641 - 144,553,063 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 144,558,538 - 144,568,773 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 130,849,353 - 130,858,776 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3
PDCD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 51,606,559 - 51,618,903 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 51,608,173 - 51,618,723 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 51,830,362 - 51,840,346 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 51,809,256 - 51,820,132 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 51,809,263 - 51,823,016 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 51,659,966 - 51,669,894 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 51,399,146 - 51,409,148 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 51,676,302 - 51,686,322 (-) NCBI UU_Cfam_GSD_1.0
Pdcd1
PDCD1
PDCD1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 127,877,383 - 127,886,234 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 127,878,554 - 127,886,088 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 71,433,325 - 71,442,153 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pdcd1
.
Predicted Target Of
Count of predictions: 167 Count of miRNA genes: 119 Interacting mature miRNAs: 132 Transcripts: ENSRNOT00000025743, ENSRNOT00000074915 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1582203 Gluco19 Glucose level QTL 19 3.3 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 92491589 100929786 Rat 724515 Uae16 Urinary albumin excretion QTL 16 8 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 58163035 100929646 Rat 731171 Glom6 Glomerulus QTL 6 2.8 0.0003 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 9 64573531 109573531 Rat 724547 Cm21 Cardiac mass QTL 21 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 9 79271511 102910209 Rat 61385 Edpm9 Estrogen-dependent pituitary mass QTL 9 3.43 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 63869687 108869687 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 1578760 Cm53 Cardiac mass QTL 53 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 56771635 101771635 Rat 1581580 Uae34 Urinary albumin excretion QTL 34 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 62072275 96470995 Rat 1300134 Bp185 Blood pressure QTL 185 3.73 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 61381434 104821652 Rat 1354626 Bvd1 Brain ventricular dilatation QTL 1 3.73 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 9 75712843 111552878 Rat 4889852 Pur26 Proteinuria QTL 26 15 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 77813894 101597663 Rat 7794784 Mcs31 Mammary carcinoma susceptibility QTL 31 2.98 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 9 77813894 111552878 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 1578757 Pur6 Proteinuria QTL 6 3.3 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 62072275 96470995 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
15
2
10
53
63
63
22
31
22
12
132
65
26
28
42
41
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025743 ⟹ ENSRNOP00000025743
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 94,418,791 - 94,431,937 (-) Ensembl Rnor_6.0 Ensembl 9 101,025,313 - 101,038,625 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000074915 ⟹ ENSRNOP00000067189
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 9 101,307,764 - 101,319,845 (-) Ensembl
RefSeq Acc Id:
NM_001106927 ⟹ NP_001100397
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 101,866,126 - 101,879,270 (-) NCBI mRatBN7.2 9 94,418,791 - 94,431,937 (-) NCBI Rnor_6.0 9 101,306,765 - 101,319,909 (-) NCBI Rnor_5.0 9 100,676,274 - 100,690,991 (-) NCBI RGSC_v3.4 9 93,172,543 - 93,185,687 (-) RGD Celera 9 91,952,891 - 91,966,035 (-) RGD
Sequence:
TGAGCAGCGGAGGAGGAGGAGGAAGAAGAGACCGTGACTGAAGACACAGCCAGGGGCTCTGGGCATGTGGGTCCAGCAGGTACCCTGGTCATTCACTTGGGCTGTGCTACAGTTGAGCTGGCAATCAG
hide sequence
RefSeq Acc Id:
XM_006245524 ⟹ XP_006245586
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 101,866,124 - 101,879,278 (-) NCBI mRatBN7.2 9 94,418,786 - 94,431,945 (-) NCBI
Sequence:
GTTTCCTTTCCGCACAGACAACTCTGCCTGAGCAGCGGAGGAGGAGGAGGAAGAAGAGACCGTG
hide sequence
RefSeq Acc Id:
XM_008767396 ⟹ XP_008765618
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 101,866,124 - 101,879,278 (-) NCBI mRatBN7.2 9 94,418,786 - 94,431,945 (-) NCBI
Sequence:
GTTTCCTTTCCGCACAGACAACTCTGCCTGAGCAGCGGAGGAGGAGGAGGAAGAAGAGACCGTGACTGAAGACACAGCCAGGGGCTCTGGGCATGTGGGTCCAGCAGGTACCCTGGTCATTCACTTGG
hide sequence
RefSeq Acc Id:
XM_017596858 ⟹ XP_017452347
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 101,866,124 - 101,879,278 (-) NCBI mRatBN7.2 9 94,418,786 - 94,431,945 (-) NCBI
Sequence:
GTTTCCTTTCCGCACAGACAACTCTGCCTGAGCAGCGGAGGAGGAGGAGGAAGAAGAGACCGTG
hide sequence
RefSeq Acc Id:
NP_001100397 ⟸ NM_001106927
- Peptide Label:
precursor
- UniProtKB:
D3ZIN8 (UniProtKB/TrEMBL), A6JR44 (UniProtKB/TrEMBL)
- Sequence:
MWVQQVPWSFTWAVLQLSWQSGWLLEVLNKPWRPLTFSPTWLTVSEGANATFTCSFSNWSEDLKLNWYRLSPSNQTEKQAAFCNGYSQPVRDARFQIVQLPNGHDFHMNILDARRNDSGIYLCGAISL
hide sequence
Ensembl Acc Id:
ENSRNOP00000067189 ⟸ ENSRNOT00000074915
RefSeq Acc Id:
XP_017452347 ⟸ XM_017596858
- Peptide Label:
isoform X3
- Sequence:
MWVQQVPWSFTWAVLQLSWQSGWLLEVLNKPWRPLTFSPTWLTVSEGANATFTCSFSNWSEDLK
hide sequence
RefSeq Acc Id:
XP_008765618 ⟸ XM_008767396
- Peptide Label:
isoform X2
- Sequence:
MWVQQVPWSFTWAVLQLSWQSGWLLEVLNKPWRPLTFSPTWLTVSEGANATFTCSFSNWSEDLKLNWYRLSPSNQTEKQAAFCNGYSQPVRDARFQIVQLPNGHDFHMNILDARRNDSGIYLCGAISL
hide sequence
RefSeq Acc Id:
XP_006245586 ⟸ XM_006245524
- Peptide Label:
isoform X1
- Sequence:
MWVQQVPWSFTWAVLQLSWQSGWLLEVLNKPWRPLTFSPTWLTVSEGANATFTCSFSNWSEDLK
hide sequence
Ensembl Acc Id:
ENSRNOP00000025743 ⟸ ENSRNOT00000025743
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-11-05
Pdcd1
programmed cell death 1
LOC102550808
programmed cell death protein 1-like
Data merged from RGD:7721299
737654 APPROVED
2013-12-18
LOC102550808
programmed cell death protein 1-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-04-30
Pdcd1
programmed cell death 1
Pdcd1_predicted
programmed cell death 1 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Pdcd1_predicted
programmed cell death 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
