Symbol:
Prkacb
Name:
protein kinase cAMP-activated catalytic subunit beta
RGD ID:
1310574
Description:
Enables cAMP-dependent protein kinase activity. Involved in negative regulation of meiotic cell cycle and protein phosphorylation. Located in perinuclear region of cytoplasm. Part of cAMP-dependent protein kinase complex. Biomarker of brain ischemia. Orthologous to human PRKACB (protein kinase cAMP-activated catalytic subunit beta); PARTICIPATES IN adenosine signaling pathway; dopamine signaling pathway; dopamine signaling pathway via D1 family of receptors; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cAMP-dependent protein kinase catalytic subunit beta; LOC310986; PKA C-beta; Prkacb_predicted; protein kinase, cAMP dependent, catalytic, beta; protein kinase, cAMP-dependent, beta catalytic subunit
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRKACB (protein kinase cAMP-activated catalytic subunit beta) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Prkacb (protein kinase, cAMP dependent, catalytic, beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prkacb (protein kinase cAMP-activated catalytic subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRKACB (protein kinase cAMP-activated catalytic subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRKACB (protein kinase cAMP-activated catalytic subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prkacb (protein kinase cAMP-activated catalytic subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRKACB (protein kinase cAMP-activated catalytic subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRKACB (protein kinase cAMP-activated catalytic subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prkacb (protein kinase cAMP-activated catalytic subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PRKACA (protein kinase cAMP-activated catalytic subunit alpha) HGNC
OrthoDB
Homo sapiens (human):
GNL3 (G protein nucleolar 3) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PRKACB (protein kinase cAMP-activated catalytic subunit beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prkacb (protein kinase, cAMP dependent, catalytic, beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkacba (protein kinase, cAMP-dependent, catalytic, beta a)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
prkacbb (protein kinase, cAMP-dependent, catalytic, beta b)
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
TPK1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TPK2
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TPK3
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
kin-1
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pka-C1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prkacb
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 238,297,140 - 238,389,317 (-) NCBI GRCr8 mRatBN7.2 2 235,636,878 - 235,726,928 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 235,636,885 - 235,726,198 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 243,435,379 - 243,522,815 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 241,326,025 - 241,413,467 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 236,193,035 - 236,280,486 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 252,602,197 - 252,691,886 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 252,605,307 - 252,691,886 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 271,129,418 - 271,218,985 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 244,949,303 - 245,035,266 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 227,617,114 - 227,701,913 (-) NCBI Celera Cytogenetic Map 2 q44 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prkacb Rat 1,2-dimethylhydrazine multiple interactions ISO Prkacb (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of PRKACB mRNA] CTD PMID:22206623 Prkacb Rat 1,2-dimethylhydrazine decreases expression ISO Prkacb (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PRKACB mRNA CTD PMID:22206623 Prkacb Rat 17alpha-ethynylestradiol decreases expression ISO Prkacb (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of PRKACB mRNA CTD PMID:17555576 Prkacb Rat 17alpha-ethynylestradiol multiple interactions ISO PRKACB (Homo sapiens) 6480464 PRKACB protein affects the reaction [Ethinyl Estradiol results in decreased expression of ABCB11 mRNA] more ... CTD PMID:27743861 Prkacb Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PRKACB mRNA CTD PMID:29097150 Prkacb Rat 17alpha-ethynylestradiol affects expression ISO PRKACB (Homo sapiens) 6480464 Ethinyl Estradiol affects the expression of PRKACB mRNA CTD PMID:18936297 Prkacb Rat 17beta-estradiol multiple interactions ISO PRKACB (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of PRKACB mRNA CTD PMID:30165855 Prkacb Rat 17beta-estradiol decreases expression ISO Prkacb (Mus musculus) 6480464 Estradiol results in decreased expression of PRKACB mRNA CTD PMID:39298647 Prkacb Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of PRKACB mRNA CTD PMID:32145629 Prkacb Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one affects expression ISO PRKACB (Homo sapiens) 6480464 Metribolone affects the expression of PRKACB mRNA alternative form and Metribolone affects the expression of PRKACB protein alternative form CTD PMID:16949795 Prkacb Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO PRKACB (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Prkacb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Prkacb (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PRKACB mRNA CTD PMID:20159946 Prkacb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRKACB mRNA CTD PMID:33387578 Prkacb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Prkacb (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PRKACB mRNA CTD PMID:21570461 Prkacb Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PRKACB mRNA CTD PMID:21346803 Prkacb Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PRKACB mRNA CTD PMID:21346803 Prkacb Rat 3',5'-cyclic AMP affects response to substance ISO PRKACB (Homo sapiens) 6480464 PRKACB protein mutant form affects the susceptibility to Cyclic AMP CTD PMID:29669941 Prkacb Rat 3',5'-cyclic AMP multiple interactions ISO PRKACB (Homo sapiens) 6480464 [PRKACB protein mutant form affects the susceptibility to Cyclic AMP] results in decreased stability of [PRKACB protein mutant form binds to PKIA protein] and [PRKACB protein mutant form affects the susceptibility to Cyclic AMP] results in decreased stability of [PRKACB protein mutant form binds to PRKAR1A protein] CTD PMID:29669941 Prkacb Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO PRKACB (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of PRKACB protein CTD PMID:31675489 Prkacb Rat 3,4-methylenedioxymethamphetamine increases expression ISO Prkacb (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PRKACB mRNA CTD PMID:19285098 Prkacb Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PRKACB (Homo sapiens) 6480464 [PRKACB protein mutant form results in increased susceptibility to [Colforsin co-treated with 1-Methyl-3-isobutylxanthine]] results in decreased stability of [PRKACB protein mutant form binds to PRKAR1A protein] more ... CTD PMID:29669941 Prkacb Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of PRKACB mRNA CTD PMID:19162173 Prkacb Rat 4,4'-sulfonyldiphenol decreases expression ISO Prkacb (Mus musculus) 6480464 bisphenol S results in decreased expression of PRKACB mRNA CTD PMID:39298647 Prkacb Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PRKACB mRNA CTD PMID:36041667 Prkacb Rat 4-hydroxyphenyl retinamide increases expression ISO Prkacb (Mus musculus) 6480464 Fenretinide results in increased expression of PRKACB mRNA CTD PMID:28973697 Prkacb Rat 4-vinylcyclohexene dioxide affects expression ISO Prkacb (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of PRKACB mRNA CTD PMID:20829426 Prkacb Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PRKACB mRNA CTD PMID:30047161 Prkacb Rat 8-Br-cAMP multiple interactions ISO PRKACB (Homo sapiens) 6480464 [PRKACB protein mutant form results in increased susceptibility to 8-Bromo Cyclic Adenosine Monophosphate analog] results in decreased stability of [PRKACB protein mutant form binds to PRKAR1A protein] CTD PMID:29669941 Prkacb Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PRKACB mRNA CTD PMID:31881176 Prkacb Rat aflatoxin B1 decreases methylation ISO PRKACB (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PRKACB gene CTD PMID:27153756 Prkacb Rat all-trans-retinoic acid decreases expression ISO PRKACB (Homo sapiens) 6480464 Tretinoin results in decreased expression of PRKACB mRNA CTD PMID:15498508 Prkacb Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PRKACB mRNA CTD PMID:30047161 Prkacb Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRKACB mRNA CTD PMID:16483693 Prkacb Rat androstane-3,17-diol affects expression ISO PRKACB (Homo sapiens) 6480464 Androstane-3 more ... CTD PMID:16949795 Prkacb Rat antirheumatic drug decreases expression ISO PRKACB (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of PRKACB mRNA CTD PMID:24449571 Prkacb Rat aristolochic acid A decreases expression ISO PRKACB (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PRKACB mRNA CTD PMID:33212167 Prkacb Rat arsenite(3-) increases expression ISO Prkacb (Mus musculus) 6480464 arsenite results in increased expression of PRKACB mRNA CTD PMID:33053406 Prkacb Rat arsenite(3-) decreases expression ISO Prkacb (Mus musculus) 6480464 arsenite results in decreased expression of PRKACB protein CTD PMID:37955338 Prkacb Rat Azoxymethane multiple interactions ISO Prkacb (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PRKACB mRNA CTD PMID:29950665 Prkacb Rat benzo[a]pyrene increases mutagenesis ISO PRKACB (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of PRKACB gene CTD PMID:25435355 Prkacb Rat benzo[a]pyrene decreases expression ISO PRKACB (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PRKACB mRNA CTD PMID:20064835 Prkacb Rat benzo[a]pyrene diol epoxide I decreases expression ISO PRKACB (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Prkacb Rat bis(2-chloroethyl) sulfide increases expression ISO Prkacb (Mus musculus) 6480464 Mustard Gas results in increased expression of PRKACB mRNA CTD PMID:15674844 Prkacb Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRKACB mRNA CTD PMID:25181051 and PMID:34947998 Prkacb Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PRKACB mRNA CTD PMID:36041667 Prkacb Rat bisphenol A decreases expression ISO PRKACB (Homo sapiens) 6480464 bisphenol A results in decreased expression of PRKACB protein CTD PMID:31675489 Prkacb Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PRKACB gene CTD PMID:28505145 Prkacb Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRKACB mRNA CTD PMID:29097150 and PMID:32145629 Prkacb Rat Bisphenol B increases expression ISO PRKACB (Homo sapiens) 6480464 bisphenol B results in increased expression of PRKACB protein CTD PMID:34186270 Prkacb Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PRKACB mRNA CTD PMID:36041667 Prkacb Rat butanal decreases expression ISO PRKACB (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PRKACB mRNA CTD PMID:26079696 Prkacb Rat butanal increases methylation ISO PRKACB (Homo sapiens) 6480464 butyraldehyde results in increased methylation of PRKACB gene CTD PMID:30002397 Prkacb Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of PRKACB mRNA CTD PMID:19167457 Prkacb Rat cannabidiol multiple interactions ISO PRKACB (Homo sapiens) 6480464 [PSEN1 protein affects the susceptibility to Cannabidiol] which affects the expression of PRKACB mRNA CTD PMID:33096116 Prkacb Rat capecitabine decreases response to substance ISO PRKACB (Homo sapiens) 6480464 PRKACB protein results in decreased susceptibility to Capecitabine CTD PMID:16734730 Prkacb Rat carbamazepine affects expression ISO PRKACB (Homo sapiens) 6480464 Carbamazepine affects the expression of PRKACB mRNA CTD PMID:24752500 Prkacb Rat carbon nanotube decreases expression ISO Prkacb (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of PRKACB mRNA CTD PMID:25554681 Prkacb Rat CGP 52608 multiple interactions ISO PRKACB (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PRKACB gene] CTD PMID:28238834 Prkacb Rat cisplatin decreases expression ISO PRKACB (Homo sapiens) 6480464 Cisplatin results in decreased expression of PRKACB mRNA CTD PMID:27392435 Prkacb Rat cisplatin multiple interactions ISO PRKACB (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of PRKACB mRNA CTD PMID:27392435 Prkacb Rat clozapine decreases expression EXP 6480464 Clozapine results in decreased expression of PRKACB mRNA and Clozapine results in decreased expression of PRKACB protein CTD PMID:11907174 Prkacb Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of PRKACB mRNA CTD PMID:15860345 Prkacb Rat colforsin daropate hydrochloride multiple interactions ISO PRKACB (Homo sapiens) 6480464 [PRKACB protein mutant form results in increased susceptibility to [Colforsin co-treated with 1-Methyl-3-isobutylxanthine]] results in decreased stability of [PRKACB protein mutant form binds to PRKAR1A protein] more ... CTD PMID:29669941 Prkacb Rat coumarin increases phosphorylation ISO PRKACB (Homo sapiens) 6480464 coumarin results in increased phosphorylation of PRKACB protein CTD PMID:35688186 Prkacb Rat coumestrol decreases expression ISO PRKACB (Homo sapiens) 6480464 Coumestrol results in decreased expression of PRKACB mRNA CTD PMID:19167446 Prkacb Rat crocidolite asbestos decreases expression ISO PRKACB (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of PRKACB mRNA CTD PMID:23634900 Prkacb Rat cyclosporin A increases expression ISO PRKACB (Homo sapiens) 6480464 Cyclosporine results in increased expression of PRKACB mRNA CTD PMID:20106945 Prkacb Rat cylindrospermopsin decreases expression ISO PRKACB (Homo sapiens) 6480464 cylindrospermopsin results in decreased expression of PRKACB protein CTD PMID:27494769 Prkacb Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of PRKACB mRNA CTD PMID:23914054 Prkacb Rat deguelin increases expression ISO PRKACB (Homo sapiens) 6480464 deguelin results in increased expression of PRKACB mRNA CTD PMID:33512557 Prkacb Rat dexamethasone decreases phosphorylation EXP 6480464 Dexamethasone results in decreased phosphorylation of PRKACB protein CTD PMID:20032058 Prkacb Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased phosphorylation of PRKACB protein] CTD PMID:20032058 Prkacb Rat dextran sulfate multiple interactions ISO Prkacb (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PRKACB mRNA CTD PMID:29950665 Prkacb Rat Dibutyl phosphate affects expression ISO PRKACB (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PRKACB mRNA CTD PMID:37042841 Prkacb Rat diclofenac affects expression ISO PRKACB (Homo sapiens) 6480464 Diclofenac affects the expression of PRKACB mRNA CTD PMID:24752500 Prkacb Rat diuron increases expression EXP 6480464 Diuron results in increased expression of PRKACB mRNA CTD PMID:21551480 Prkacb Rat Doramectin decreases expression EXP 6480464 doramectin results in decreased expression of PRKACB mRNA CTD PMID:35137919 Prkacb Rat dorsomorphin multiple interactions ISO PRKACB (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Prkacb Rat doxifluridine decreases response to substance ISO PRKACB (Homo sapiens) 6480464 PRKACB protein results in decreased susceptibility to doxifluridine CTD PMID:16734730 Prkacb Rat doxorubicin decreases expression ISO PRKACB (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PRKACB mRNA CTD PMID:29803840 Prkacb Rat entinostat decreases expression ISO PRKACB (Homo sapiens) 6480464 entinostat results in decreased expression of PRKACB mRNA CTD PMID:27188386 Prkacb Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PRKACB mRNA CTD PMID:20655511 Prkacb Rat ethanol affects splicing ISO Prkacb (Mus musculus) 6480464 Ethanol affects the splicing of PRKACB mRNA CTD PMID:30319688 Prkacb Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of PRKACB mRNA CTD PMID:34044035 Prkacb Rat folic acid decreases expression ISO Prkacb (Mus musculus) 6480464 Folic Acid results in decreased expression of PRKACB mRNA CTD PMID:25629700 Prkacb Rat folic acid multiple interactions ISO Prkacb (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of PRKACB mRNA] CTD PMID:22206623 Prkacb Rat formononetin multiple interactions ISO Prkacb (Mus musculus) 6480464 [Lipopolysaccharides co-treated with formononetin] results in increased phosphorylation of PRKACB protein CTD PMID:37269934 Prkacb Rat FR900359 increases phosphorylation ISO PRKACB (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PRKACB protein CTD PMID:37730182 Prkacb Rat gallic acid decreases expression ISO PRKACB (Homo sapiens) 6480464 Gallic Acid results in decreased expression of PRKACB mRNA CTD PMID:34408198 Prkacb Rat gamma-hexachlorocyclohexane affects expression EXP 6480464 Hexachlorocyclohexane affects the expression of PRKACB mRNA CTD PMID:17785943 Prkacb Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PRKACB mRNA CTD PMID:22061828 Prkacb Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of PRKACB gene CTD PMID:35440735 Prkacb Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of PRKACB mRNA CTD PMID:15860345 Prkacb Rat heptanal increases methylation ISO PRKACB (Homo sapiens) 6480464 heptanal results in increased methylation of PRKACB gene CTD PMID:30002397 Prkacb Rat hexanal increases methylation ISO PRKACB (Homo sapiens) 6480464 n-hexanal results in increased methylation of PRKACB gene CTD PMID:30002397 Prkacb Rat hydrogen cyanide decreases expression ISO Prkacb (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of PRKACB mRNA CTD PMID:33914522 Prkacb Rat hydrogen sulfide increases expression ISO Prkacb (Mus musculus) 6480464 Hydrogen Sulfide results in increased expression of PRKACB protein CTD PMID:29932956 Prkacb Rat ivermectin decreases expression ISO PRKACB (Homo sapiens) 6480464 Ivermectin results in decreased expression of PRKACB protein CTD PMID:32959892 Prkacb Rat Kemptide increases phosphorylation ISO PRKACB (Homo sapiens) 6480464 PRKACB protein results in increased phosphorylation of kemptide CTD PMID:29669941 Prkacb Rat lead(0) affects expression ISO PRKACB (Homo sapiens) 6480464 Lead affects the expression of PRKACB mRNA CTD PMID:28903495 Prkacb Rat lipopolysaccharide increases expression ISO Prkacb (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of PRKACB mRNA CTD PMID:12057914 Prkacb Rat lipopolysaccharide multiple interactions ISO Prkacb (Mus musculus) 6480464 [Lipopolysaccharides co-treated with formononetin] results in increased phosphorylation of PRKACB protein CTD PMID:37269934 Prkacb Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PRKACB mRNA CTD PMID:30047161 Prkacb Rat Methylazoxymethanol acetate increases expression EXP 6480464 Methylazoxymethanol Acetate results in increased expression of PRKACB mRNA CTD PMID:28349193 Prkacb Rat motexafin gadolinium multiple interactions ISO PRKACB (Homo sapiens) 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in increased expression of PRKACB mRNA CTD PMID:16357179 Prkacb Rat motexafin gadolinium increases expression ISO PRKACB (Homo sapiens) 6480464 motexafin gadolinium results in increased expression of PRKACB mRNA CTD PMID:16357179 Prkacb Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PRKACB gene CTD PMID:33148267 Prkacb Rat nitrates decreases expression EXP 6480464 Nitrates results in decreased expression of PRKACB mRNA CTD PMID:30022042 Prkacb Rat nonanal increases methylation ISO PRKACB (Homo sapiens) 6480464 nonanal results in increased methylation of PRKACB gene CTD PMID:30002397 Prkacb Rat octanal increases methylation ISO PRKACB (Homo sapiens) 6480464 caprylic aldehyde results in increased methylation of PRKACB gene CTD PMID:30002397 Prkacb Rat oxybenzone increases expression ISO PRKACB (Homo sapiens) 6480464 oxybenzone results in increased expression of PRKACB mRNA CTD PMID:36581016 Prkacb Rat paracetamol affects expression ISO PRKACB (Homo sapiens) 6480464 Acetaminophen affects the expression of PRKACB mRNA CTD PMID:25458485 Prkacb Rat PCB138 affects expression ISO PRKACB (Homo sapiens) 6480464 2 more ... CTD PMID:21703328 Prkacb Rat pentanal decreases expression ISO PRKACB (Homo sapiens) 6480464 pentanal results in decreased expression of PRKACB mRNA CTD PMID:26079696 Prkacb Rat pentanal increases methylation ISO PRKACB (Homo sapiens) 6480464 pentanal results in increased methylation of PRKACB gene CTD PMID:30002397 Prkacb Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of PRKACB mRNA CTD PMID:19162173 Prkacb Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PRKACB gene CTD PMID:33148267 Prkacb Rat phenylmercury acetate decreases expression ISO PRKACB (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of PRKACB mRNA CTD PMID:26272509 Prkacb Rat phenylmercury acetate multiple interactions ISO PRKACB (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PRKACB mRNA CTD PMID:27188386 Prkacb Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of PRKACB mRNA CTD PMID:19162173 Prkacb Rat piroxicam decreases expression ISO PRKACB (Homo sapiens) 6480464 Piroxicam results in decreased expression of PRKACB mRNA CTD PMID:21858171 Prkacb Rat propanal increases methylation ISO PRKACB (Homo sapiens) 6480464 propionaldehyde results in increased methylation of PRKACB gene CTD PMID:30002397 Prkacb Rat resveratrol decreases expression ISO Prkacb (Mus musculus) 6480464 resveratrol results in decreased expression of PRKACB mRNA CTD PMID:22610192 Prkacb Rat SB 431542 multiple interactions ISO PRKACB (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Prkacb Rat sodium arsenite increases expression ISO PRKACB (Homo sapiens) 6480464 sodium arsenite results in increased expression of PRKACB mRNA CTD PMID:38568856 Prkacb Rat sodium fluoride decreases expression ISO Prkacb (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of PRKACB mRNA CTD PMID:21340527 Prkacb Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of PRKACB mRNA CTD PMID:30047161 Prkacb Rat sulindac multiple interactions EXP 6480464 [Sulindac co-treated with lipopolysaccharide and E coli O55-B5] affects the expression of PRKACB mRNA CTD PMID:20371263 Prkacb Rat tamibarotene decreases expression ISO PRKACB (Homo sapiens) 6480464 tamibarotene results in decreased expression of PRKACB mRNA CTD PMID:15498508 Prkacb Rat tamoxifen affects expression ISO Prkacb (Mus musculus) 6480464 Tamoxifen affects the expression of PRKACB mRNA CTD PMID:17555576 and PMID:20937368 Prkacb Rat testosterone decreases expression ISO Prkacb (Mus musculus) 6480464 Testosterone results in decreased expression of PRKACB mRNA CTD PMID:21669218 Prkacb Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased phosphorylation of PRKACB protein] CTD PMID:20032058 Prkacb Rat testosterone enanthate affects expression EXP 6480464 testosterone enanthate affects the expression of PRKACB mRNA CTD PMID:25603467 Prkacb Rat testosterone enanthate affects expression ISO PRKACB (Homo sapiens) 6480464 testosterone enanthate affects the expression of PRKACB mRNA CTD PMID:17440010 Prkacb Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PRKACB mRNA CTD PMID:34492290 Prkacb Rat titanium dioxide multiple interactions ISO Prkacb (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PRKACB mRNA CTD PMID:29950665 Prkacb Rat titanium dioxide increases methylation ISO Prkacb (Mus musculus) 6480464 titanium dioxide results in increased methylation of PRKACB promoter CTD PMID:35295148 Prkacb Rat torcetrapib increases expression ISO PRKACB (Homo sapiens) 6480464 torcetrapib results in increased expression of PRKACB mRNA CTD PMID:23228038 Prkacb Rat trichostatin A decreases expression ISO PRKACB (Homo sapiens) 6480464 trichostatin A results in decreased expression of PRKACB mRNA CTD PMID:22723015 more ... Prkacb Rat trichostatin A multiple interactions ISO PRKACB (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PRKACB mRNA CTD PMID:27188386 Prkacb Rat triclosan increases expression EXP 6480464 Triclosan results in increased expression of PRKACB mRNA CTD PMID:30447264 Prkacb Rat triphenyl phosphate affects expression ISO PRKACB (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PRKACB mRNA CTD PMID:37042841 Prkacb Rat triptonide increases expression ISO Prkacb (Mus musculus) 6480464 triptonide results in increased expression of PRKACB mRNA CTD PMID:33045310 Prkacb Rat valproic acid decreases expression ISO Prkacb (Mus musculus) 6480464 Valproic Acid results in decreased expression of PRKACB mRNA CTD PMID:21427059 Prkacb Rat valproic acid affects methylation ISO PRKACB (Homo sapiens) 6480464 Valproic Acid affects the methylation of PRKACB gene CTD PMID:29501571 Prkacb Rat valproic acid decreases expression ISO PRKACB (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PRKACB mRNA CTD PMID:23179753 more ... Prkacb Rat valproic acid multiple interactions ISO PRKACB (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PRKACB mRNA CTD PMID:27188386 Prkacb Rat valproic acid increases expression ISO PRKACB (Homo sapiens) 6480464 Valproic Acid results in increased expression of PRKACB mRNA CTD PMID:29154799 and PMID:29501571 Prkacb Rat valproic acid affects expression ISO Prkacb (Mus musculus) 6480464 Valproic Acid affects the expression of PRKACB mRNA CTD PMID:17963808 Prkacb Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of PRKACB gene CTD PMID:31079544 Prkacb Rat vorinostat decreases expression ISO PRKACB (Homo sapiens) 6480464 vorinostat results in decreased expression of PRKACB mRNA CTD PMID:27188386 Prkacb Rat zinc acetate multiple interactions ISO PRKACB (Homo sapiens) 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in increased expression of PRKACB mRNA CTD PMID:16357179 Prkacb Rat zinc acetate increases expression ISO PRKACB (Homo sapiens) 6480464 Zinc Acetate results in increased expression of PRKACB mRNA CTD PMID:16357179 Prkacb Rat zoledronic acid increases expression ISO PRKACB (Homo sapiens) 6480464 zoledronic acid results in increased expression of PRKACB mRNA CTD PMID:20977926
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3',5'-cyclic AMP (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 4-vinylcyclohexene dioxide (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) androstane-3,17-diol (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (EXP) butanal (ISO) C60 fullerene (EXP) cannabidiol (ISO) capecitabine (ISO) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) cisplatin (ISO) clozapine (EXP) colforsin daropate hydrochloride (ISO) coumarin (ISO) coumestrol (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) decabromodiphenyl ether (EXP) deguelin (ISO) dexamethasone (EXP) dextran sulfate (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) diuron (EXP) Doramectin (EXP) dorsomorphin (ISO) doxifluridine (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (EXP,ISO) fipronil (EXP) folic acid (ISO) formononetin (ISO) FR900359 (ISO) gallic acid (ISO) gamma-hexachlorocyclohexane (EXP) gentamycin (EXP) glyphosate (EXP) haloperidol (EXP) heptanal (ISO) hexanal (ISO) hydrogen cyanide (ISO) hydrogen sulfide (ISO) ivermectin (ISO) Kemptide (ISO) lead(0) (ISO) lipopolysaccharide (ISO) methimazole (EXP) Methylazoxymethanol acetate (EXP) motexafin gadolinium (ISO) N,N-diethyl-m-toluamide (EXP) nitrates (EXP) nonanal (ISO) octanal (ISO) oxybenzone (ISO) paracetamol (ISO) PCB138 (ISO) pentanal (ISO) perfluorooctanoic acid (EXP) permethrin (EXP) phenylmercury acetate (ISO) pirinixic acid (EXP) piroxicam (ISO) propanal (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) sulindac (EXP) tamibarotene (ISO) tamoxifen (ISO) testosterone (EXP,ISO) testosterone enanthate (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) torcetrapib (ISO) trichostatin A (ISO) triclosan (EXP) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO) zinc acetate (ISO) zoledronic acid (ISO)
Molecular Function
ATP binding (IEA,ISO,ISS) cAMP-dependent protein kinase activity (IBA,IDA,IEA,ISO,ISS) kinase activity (IEA) magnesium ion binding (IEA,ISO,ISS) nucleotide binding (IEA) protein binding (ISO) protein kinase A regulatory subunit binding (IC) protein kinase activity (IEA) protein serine kinase activity (IEA) protein serine/threonine kinase activity (IEA,TAS) transferase activity (IEA) ubiquitin protein ligase binding (IEA,ISO)
1.
Differential effects of haloperidol and clozapine on cAMP binding, protein kinase A (PKA) activity, and mRNA and protein expression of selective regulatory and catalytic subunit isoforms of PKA in rat brain.
Dwivedi Y, etal., J Pharmacol Exp Ther. 2002 Apr;301(1):197-209.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
A genetic test of the effects of mutations in PKA on mossy fiber LTP and its relation to spatial and contextual learning.
Huang YY, etal., Cell. 1995 Dec 29;83(7):1211-22.
4.
Regulation of mRNA expression involved in Ras and PKA signal pathways during rat hypoglossal nerve regeneration.
Kiryu S, etal., Brain Res Mol Brain Res. 1995 Mar;29(1):147-56.
5.
An active protein kinase A (PKA) is involved in meiotic arrest of rat growing oocytes.
Kovo M, etal., Reproduction. 2006 Jul;132(1):33-43.
6.
Phosphorylation of the cAMP-dependent protein kinase (PKA) regulatory subunit modulates PKA-AKAP interaction, substrate phosphorylation, and calcium signaling in cardiac cells.
Manni S, etal., J Biol Chem. 2008 Aug 29;283(35):24145-54. Epub 2008 Jun 12.
7.
Impairment of cerebral cAMP-mediated signal transduction system and of spatial memory function after microsphere embolism in rats.
Nagakura A, etal., Neuroscience. 2002;113(3):519-28.
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Isolation of a complementary DNA encoding the catalytic subunit of protein kinase A and studies on the expression of this sequence in rat hepatomas and regenerating liver.
Roth JS, etal., Cancer Res. 1990 Mar 15;50(6):1675-80.
14.
Localized effects of cAMP mediated by distinct routes of protein kinase A.
Tasken K and Aandahl EM, Physiol Rev. 2004 Jan;84(1):137-67.
15.
DARPP-32, Jack of All Trades... Master of Which?
Yger M and Girault JA, Front Behav Neurosci. 2011 Sep 8;5:56. doi: 10.3389/fnbeh.2011.00056. eCollection 2011.
16.
Stimulation of c-Rel transcriptional activity by PKA catalytic subunit beta.
Yu SH, etal., J Mol Med. 2004 Sep;82(9):621-8. Epub 2004 Jun 9.
Prkacb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 238,297,140 - 238,389,317 (-) NCBI GRCr8 mRatBN7.2 2 235,636,878 - 235,726,928 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 235,636,885 - 235,726,198 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 243,435,379 - 243,522,815 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 241,326,025 - 241,413,467 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 236,193,035 - 236,280,486 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 252,602,197 - 252,691,886 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 252,605,307 - 252,691,886 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 271,129,418 - 271,218,985 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 244,949,303 - 245,035,266 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 227,617,114 - 227,701,913 (-) NCBI Celera Cytogenetic Map 2 q44 NCBI
PRKACB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 84,078,079 - 84,238,498 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 84,078,062 - 84,238,498 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 84,543,762 - 84,704,181 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 84,316,333 - 84,476,769 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 82,787,965 - 82,948,395 (+) NCBI Celera Cytogenetic Map 1 p31.1 NCBI HuRef 1 82,654,090 - 82,814,484 (+) NCBI HuRef CHM1_1 1 84,658,575 - 84,819,019 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 83,918,534 - 84,078,964 (+) NCBI T2T-CHM13v2.0
Prkacb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 146,435,334 - 146,518,691 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 146,435,329 - 146,518,745 (-) Ensembl GRCm39 Ensembl GRCm38 3 146,729,579 - 146,812,946 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 146,729,574 - 146,812,990 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 146,392,543 - 146,475,910 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 146,666,965 - 146,750,316 (-) NCBI MGSCv36 mm8 Celera 3 153,182,525 - 153,265,941 (-) NCBI Celera Cytogenetic Map 3 H2 NCBI cM Map 3 72.28 NCBI
Prkacb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955423 9,629,378 - 9,747,820 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955423 9,630,308 - 9,747,820 (-) NCBI ChiLan1.0 ChiLan1.0
PRKACB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 142,704,501 - 142,865,759 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 141,858,945 - 142,019,573 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 116,625,640 - 116,786,396 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 85,574,094 - 85,647,446 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 85,487,681 - 85,644,253 (+) Ensembl panpan1.1 panPan2
PRKACB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 63,615,445 - 63,729,386 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 63,618,323 - 63,730,146 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 66,263,759 - 66,377,569 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 64,155,572 - 64,269,668 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 64,155,572 - 64,269,867 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 63,683,378 - 63,796,798 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 63,652,236 - 63,766,014 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 64,158,621 - 64,272,439 (-) NCBI UU_Cfam_GSD_1.0
Prkacb Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 94,841,492 - 94,952,128 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936608 1,353,897 - 1,464,636 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936608 1,353,905 - 1,464,636 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRKACB Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 129,520,376 - 129,635,733 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 129,520,397 - 129,636,207 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 119,719,887 - 119,778,443 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRKACB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 49,109,774 - 49,273,200 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 49,108,425 - 49,178,806 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 68,486,789 - 68,652,007 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prkacb
.
Predicted Target Of
Count of predictions: 33 Count of miRNA genes: 32 Interacting mature miRNAs: 33 Transcripts: ENSRNOT00000068739 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
631563 Hcuc3 Hepatic copper content QTL 3 3.87 liver copper amount (VT:0003065) liver copper weight to liver dry weight ratio (CMO:0001512) 2 229059610 249053267 Rat 1331767 Hrtrt12 Heart rate QTL 12 3.373 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 218414747 240841241 Rat 8693697 Alc36 Alcohol consumption QTL 36 2 0.592 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 2 217139753 236660713 Rat 1298075 Scl17 Serum cholesterol level QTL 17 3.4 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 211744537 249053267 Rat 2293833 Kiddil8 Kidney dilation QTL 8 2.9 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 219753301 247136170 Rat 1598835 Anxrr18 Anxiety related response QTL 18 2.98 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 2 200990457 245990457 Rat 2298479 Eau5 Experimental allergic uveoretinitis QTL 5 0.0021 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 2 202446871 237938339 Rat 1300126 Bp175 Blood pressure QTL 175 3.46 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 214226044 247136170 Rat 7207490 Bss111 Bone structure and strength QTL 111 6.4 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 2 211744537 249053267 Rat 7207484 Bss108 Bone structure and strength QTL 108 5.3 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 2 211744537 249053267 Rat 2313073 Bmd75 Bone mineral density QTL 75 4.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 2 215377404 237938339 Rat 8693622 Alc26 Alcohol consumption QTL 26 2.4 0.667 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 2 221136523 241305619 Rat 7411555 Bw132 Body weight QTL 132 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 2 223389739 249053267 Rat 9587428 Epfw6 Epididymal fat weight QTL 6 7.47 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 2 223389739 249053267 Rat 7207482 Bss107 Bone structure and strength QTL 107 7 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 2 211744537 249053267 Rat 2293844 Kiddil7 Kidney dilation QTL 7 3.5 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 219753301 247136170 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 2317752 Glom23 Glomerulus QTL 23 3.6 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 2 193452645 245889826 Rat 1549836 Bss2 Bone structure and strength QTL 2 7.5 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 2 211744537 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 2317885 Alcrsp28 Alcohol response QTL 28 2.1 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 212828222 249053267 Rat
RH133906
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 181,975,550 - 181,975,757 (+) MAPPER mRatBN7.2 Rnor_6.0 1 198,801,547 - 198,801,753 NCBI Rnor6.0 Rnor_5.0 1 205,799,940 - 205,800,146 UniSTS Rnor5.0 RGSC_v3.4 1 186,620,151 - 186,620,357 UniSTS RGSC3.4 Celera 1 179,628,164 - 179,628,370 UniSTS Cytogenetic Map 1 q36 UniSTS Cytogenetic Map 2 q44 UniSTS
X61434
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 235,639,593 - 235,639,757 (+) MAPPER mRatBN7.2 Rnor_6.0 2 252,605,036 - 252,605,199 NCBI Rnor6.0 Rnor_5.0 2 271,132,135 - 271,132,298 UniSTS Rnor5.0 RGSC_v3.4 2 244,949,032 - 244,949,195 UniSTS RGSC3.4 Celera 2 227,616,843 - 227,617,006 UniSTS Cytogenetic Map 2 q44 UniSTS
RH139283
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 235,640,477 - 235,640,719 (+) MAPPER mRatBN7.2 Rnor_6.0 2 252,605,920 - 252,606,161 NCBI Rnor6.0 Rnor_5.0 2 271,133,019 - 271,133,260 UniSTS Rnor5.0 RGSC_v3.4 2 244,949,916 - 244,950,157 UniSTS RGSC3.4 Celera 2 227,617,727 - 227,617,968 UniSTS Cytogenetic Map 2 q44 UniSTS
BF417257
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 235,702,694 - 235,702,787 (+) MAPPER mRatBN7.2 Rnor_6.0 2 252,668,523 - 252,668,615 NCBI Rnor6.0 Rnor_5.0 2 271,195,622 - 271,195,714 UniSTS Rnor5.0 RGSC_v3.4 2 245,011,907 - 245,011,999 UniSTS RGSC3.4 Celera 2 227,678,543 - 227,678,635 UniSTS Cytogenetic Map 2 q44 UniSTS
Prkacb
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 235,655,423 - 235,656,709 (+) MAPPER mRatBN7.2 mRatBN7.2 1 181,975,264 - 181,975,344 (+) MAPPER mRatBN7.2 Rnor_6.0 1 198,801,261 - 198,801,340 NCBI Rnor6.0 Rnor_6.0 2 252,620,866 - 252,622,151 NCBI Rnor6.0 Rnor_5.0 2 271,147,965 - 271,149,250 UniSTS Rnor5.0 Rnor_5.0 1 205,799,654 - 205,799,733 UniSTS Rnor5.0 RGSC_v3.4 1 186,619,865 - 186,619,944 UniSTS RGSC3.4 RGSC_v3.4 2 244,964,862 - 244,966,147 UniSTS RGSC3.4 Celera 2 227,632,322 - 227,633,607 UniSTS Celera 1 179,627,878 - 179,627,957 UniSTS Cytogenetic Map 1 q36 UniSTS Cytogenetic Map 2 q44 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000068739 ⟹ ENSRNOP00000062228
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 235,636,885 - 235,726,198 (-) Ensembl Rnor_6.0 Ensembl 2 252,605,307 - 252,691,886 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109432 ⟹ ENSRNOP00000085004
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 235,636,885 - 235,668,313 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117576 ⟹ ENSRNOP00000092040
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 235,636,885 - 235,681,232 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119870 ⟹ ENSRNOP00000097634
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 235,636,885 - 235,666,414 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119887 ⟹ ENSRNOP00000086804
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 235,636,885 - 235,693,675 (-) Ensembl
RefSeq Acc Id:
NM_001077645 ⟹ NP_001071113
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 238,300,127 - 238,386,315 (-) NCBI mRatBN7.2 2 235,639,865 - 235,726,052 (-) NCBI Rnor_6.0 2 252,605,307 - 252,691,886 (-) NCBI Rnor_5.0 2 271,129,418 - 271,218,985 (-) NCBI RGSC_v3.4 2 244,949,303 - 245,035,266 (-) RGD Celera 2 227,617,114 - 227,701,913 (-) RGD
Sequence:
GGGACGGCCCCGGTCCCCTCCCCTCCGTCACTCCTGCTTACGGACTCCCGGGTCATGGGGAACACGGCGATCGCCAAGAAAGGCAGCGAAGTGGAGAGCGTGAAAGAATTCCTAGCCAAAGCCAAAGA
hide sequence
RefSeq Acc Id:
XM_006233451 ⟹ XP_006233513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 238,297,140 - 238,354,036 (-) NCBI mRatBN7.2 2 235,636,878 - 235,693,469 (-) NCBI Rnor_6.0 2 252,602,197 - 252,659,842 (-) NCBI Rnor_5.0 2 271,129,418 - 271,218,985 (-) NCBI
Sequence:
ATTATTTATAGACAGGCACATTATCTGTAAATTAATAGGTGGTACTGGTATGCTGTTTCTGTAGTTCTCATATACATTAACCTCTGAGTCCTTTGAAATTATGAGATTAGTAAATATTTTTCTTAGTC
hide sequence
RefSeq Acc Id:
XM_006233452 ⟹ XP_006233514
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 238,297,140 - 238,353,341 (-) NCBI mRatBN7.2 2 235,636,878 - 235,681,193 (-) NCBI Rnor_6.0 2 252,602,197 - 252,648,734 (-) NCBI Rnor_5.0 2 271,129,418 - 271,218,985 (-) NCBI
Sequence:
GATATGATTGATATAATTCTCTTGTAAAATAAAACTTCTTTGAACTAATAATGCATGTGTACATTTTTGAGCTCATCCCTAGCAGTTTAAGGTTGGATACTCACCAGCTCATACACAGTCACATGTCT
hide sequence
RefSeq Acc Id:
XM_006233453 ⟹ XP_006233515
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 238,297,140 - 238,353,341 (-) NCBI mRatBN7.2 2 235,636,878 - 235,680,776 (-) NCBI Rnor_6.0 2 252,602,197 - 252,646,399 (-) NCBI Rnor_5.0 2 271,129,418 - 271,218,985 (-) NCBI
Sequence:
AGCATTTTAAAGATATGTTTGATATGAAAAGATATGAAAAGGGTAGCTCAGTGCTCACATGTAG
hide sequence
RefSeq Acc Id:
XM_039101884 ⟹ XP_038957812
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 238,379,688 - 238,389,317 (-) NCBI mRatBN7.2 2 235,719,433 - 235,726,928 (-) NCBI
RefSeq Acc Id:
NP_001071113 ⟸ NM_001077645
- UniProtKB:
P68182 (UniProtKB/Swiss-Prot), A0A8I6GBC1 (UniProtKB/TrEMBL), A6HWE9 (UniProtKB/TrEMBL)
- Sequence:
MGNTAIAKKGSEVESVKEFLAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGE
hide sequence
RefSeq Acc Id:
XP_006233513 ⟸ XM_006233451
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A4F6 (UniProtKB/TrEMBL), A0A8I6GBC1 (UniProtKB/TrEMBL), A6HWF0 (UniProtKB/TrEMBL)
- Sequence:
MAAHKELSFGQHTGTPTALQKLEGFASRLFHRHSKGTAQDQKAALEEEGLQASEHTASWDKPMKEFLAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVV
hide sequence
RefSeq Acc Id:
XP_006233514 ⟸ XM_006233452
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6GBC1 (UniProtKB/TrEMBL), A6HWF1 (UniProtKB/TrEMBL)
- Sequence:
MGLLKEFLAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILD
hide sequence
RefSeq Acc Id:
XP_006233515 ⟸ XM_006233453
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AV42 (UniProtKB/TrEMBL), A6HWF2 (UniProtKB/TrEMBL), Q05759 (UniProtKB/TrEMBL)
- Sequence:
MNVKEFLAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDK
hide sequence
Ensembl Acc Id:
ENSRNOP00000062228 ⟸ ENSRNOT00000068739
RefSeq Acc Id:
XP_038957812 ⟸ XM_039101884
- Peptide Label:
isoform X4
Ensembl Acc Id:
ENSRNOP00000086804 ⟸ ENSRNOT00000119887
Ensembl Acc Id:
ENSRNOP00000097634 ⟸ ENSRNOT00000119870
Ensembl Acc Id:
ENSRNOP00000085004 ⟸ ENSRNOT00000109432
Ensembl Acc Id:
ENSRNOP00000092040 ⟸ ENSRNOT00000117576
BioCyc Gene G2FUF-50889 BioCyc
Ensembl Genes ENSRNOG00000004978 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript ENSRNOT00000068739 ENTREZGENE
ENSRNOT00000068739.2 UniProtKB/Swiss-Prot
ENSRNOT00000117576 ENTREZGENE
ENSRNOT00000119887 ENTREZGENE
ENSRNOT00000127717 ENTREZGENE
Gene3D-CATH Phosphorylase Kinase, domain 1 UniProtKB/Swiss-Prot
Transferase(Phosphotransferase) domain 1 UniProtKB/Swiss-Prot
InterPro AGC-kinase_C UniProtKB/Swiss-Prot
Kinase-like_dom_sf UniProtKB/Swiss-Prot
Prot_kinase_dom UniProtKB/Swiss-Prot
Protein_kinase_ATP_BS UniProtKB/Swiss-Prot
Ser/Thr_kinase_AS UniProtKB/Swiss-Prot
STKc_PKA UniProtKB/Swiss-Prot
KEGG Report rno:293508 UniProtKB/Swiss-Prot
NCBI Gene Prkacb ENTREZGENE
PANTHER CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT BETA UniProtKB/Swiss-Prot
CYCLIC NUCLEOTIDE-DEPENDENT PROTEIN KINASE UniProtKB/Swiss-Prot
Pfam Pkinase UniProtKB/Swiss-Prot
PhenoGen Prkacb PhenoGen
PROSITE AGC_KINASE_CTER UniProtKB/Swiss-Prot
PROTEIN_KINASE_ATP UniProtKB/Swiss-Prot
PROTEIN_KINASE_DOM UniProtKB/Swiss-Prot
PROTEIN_KINASE_ST UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000004978 RatGTEx
SMART S_TK_X UniProtKB/Swiss-Prot
S_TKc UniProtKB/Swiss-Prot
Superfamily-SCOP SSF56112 UniProtKB/Swiss-Prot
UniProt A0A8I6A4F6 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AUN6_RAT UniProtKB/TrEMBL
A0A8I6AV42 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6GBC1 ENTREZGENE, UniProtKB/TrEMBL
A6HWE9 ENTREZGENE, UniProtKB/TrEMBL
A6HWF0 ENTREZGENE, UniProtKB/TrEMBL
A6HWF1 ENTREZGENE, UniProtKB/TrEMBL
A6HWF2 ENTREZGENE, UniProtKB/TrEMBL
KAPCB_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Q05759 ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary P05206 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-03
Prkacb
protein kinase cAMP-activated catalytic subunit beta
Prkacb
protein kinase, cAMP-dependent, beta catalytic subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-11-30
Prkacb
protein kinase, cAMP-dependent, beta catalytic subunit
Prkacb
protein kinase, cAMP dependent, catalytic, beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-08-18
Prkacb
protein kinase, cAMP dependent, catalytic, beta
Prkacb_predicted
protein kinase, cAMP dependent, catalytic, beta (predicted)
gene changed from predicted status to normal gene status
1299863 APPROVED
2005-01-12
Prkacb_predicted
protein kinase, cAMP dependent, catalytic, beta (predicted)
Symbol and Name status set to approved
70820 APPROVED
