Symbol:
Klhl9
Name:
kelch-like family member 9
RGD ID:
1304814
Description:
Predicted to enable cullin family protein binding activity. Predicted to contribute to ubiquitin-protein transferase activity. Predicted to be involved in protein ubiquitination and regulation of cytokinesis. Predicted to be located in midbody. Predicted to be part of Cul3-RING ubiquitin ligase complex. Orthologous to human KLHL9 (kelch like family member 9); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
kelch-like 9; kelch-like 9 (Drosophila); kelch-like protein 9; LOC313348; RGD1304814; similar to Hypothetical protein KIAA1354
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 108,449,492 - 108,453,676 (-) NCBI GRCr8 mRatBN7.2 5 103,333,747 - 103,337,931 (-) NCBI mRatBN7.2 mRatBN7.2 UTH_Rnor_SHR_Utx 5 105,682,082 - 105,686,266 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 107,472,529 - 107,476,713 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 107,540,336 - 107,544,540 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 107,323,258 - 107,327,442 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 107,323,258 - 107,327,442 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 111,299,120 - 111,303,304 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 108,196,981 - 108,201,165 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 108,203,022 - 108,206,163 (-) NCBI Celera 5 102,067,020 - 102,071,204 (-) NCBI Celera Cytogenetic Map 5 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Klhl9 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of KLHL9 mRNA CTD PMID:22079256 Klhl9 Rat 1,2-dimethylhydrazine multiple interactions ISO Klhl9 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of KLHL9 mRNA CTD PMID:22206623 Klhl9 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of KLHL9 mRNA CTD PMID:29097150 Klhl9 Rat 17beta-estradiol decreases expression ISO Klhl9 (Mus musculus) 6480464 Estradiol results in decreased expression of KLHL9 mRNA CTD PMID:39298647 Klhl9 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Klhl9 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of KLHL9 mRNA CTD PMID:21570461 Klhl9 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KLHL9 mRNA CTD PMID:33387578 Klhl9 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KLHL9 mRNA CTD PMID:32109520 Klhl9 Rat 2-methylcholine affects expression ISO KLHL9 (Homo sapiens) 6480464 beta-methylcholine affects the expression of KLHL9 mRNA CTD PMID:21179406 Klhl9 Rat 2-palmitoylglycerol increases expression ISO KLHL9 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of KLHL9 mRNA CTD PMID:37199045 Klhl9 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Klhl9 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of KLHL9 mRNA CTD PMID:26251327 Klhl9 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of KLHL9 mRNA CTD PMID:28628672 Klhl9 Rat 4,4'-sulfonyldiphenol decreases expression ISO Klhl9 (Mus musculus) 6480464 bisphenol S results in decreased expression of KLHL9 mRNA CTD PMID:39298647 Klhl9 Rat 5-fluorouracil affects response to substance ISO KLHL9 (Homo sapiens) 6480464 KLHL9 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Klhl9 Rat all-trans-retinoic acid increases expression ISO KLHL9 (Homo sapiens) 6480464 Tretinoin results in increased expression of KLHL9 mRNA CTD PMID:23724009 Klhl9 Rat antimycin A decreases expression ISO KLHL9 (Homo sapiens) 6480464 Antimycin A results in decreased expression of KLHL9 mRNA CTD PMID:33512557 Klhl9 Rat aristolochic acid A decreases expression ISO KLHL9 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of KLHL9 mRNA CTD PMID:33212167 Klhl9 Rat arsane multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of KLHL9 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of KLHL9 mRNA CTD PMID:39836092 Klhl9 Rat arsenic atom multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of KLHL9 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of KLHL9 mRNA CTD PMID:39836092 Klhl9 Rat avobenzone decreases expression ISO KLHL9 (Homo sapiens) 6480464 avobenzone results in decreased expression of KLHL9 mRNA CTD PMID:31016361 Klhl9 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of KLHL9 mRNA CTD PMID:25181051 Klhl9 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KLHL9 mRNA CTD PMID:32145629 and PMID:34947998 Klhl9 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KLHL9 mRNA CTD PMID:33296240 Klhl9 Rat bisphenol A multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of KLHL9 mRNA CTD PMID:28628672 Klhl9 Rat cadmium atom multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of KLHL9 mRNA CTD PMID:35301059 Klhl9 Rat cadmium dichloride decreases expression ISO KLHL9 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of KLHL9 mRNA CTD PMID:38568856 Klhl9 Rat cadmium dichloride multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of KLHL9 mRNA CTD PMID:35301059 Klhl9 Rat caffeine affects phosphorylation ISO KLHL9 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of KLHL9 protein CTD PMID:35688186 Klhl9 Rat captan decreases expression ISO Klhl9 (Mus musculus) 6480464 Captan results in decreased expression of KLHL9 mRNA CTD PMID:31558096 Klhl9 Rat CGP 52608 multiple interactions ISO KLHL9 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KLHL9 gene] CTD PMID:28238834 Klhl9 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of KLHL9 mRNA CTD PMID:22023808 Klhl9 Rat cobalt dichloride decreases expression ISO KLHL9 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of KLHL9 mRNA CTD PMID:19320972 Klhl9 Rat copper atom multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of KLHL9 mRNA CTD PMID:20971185 Klhl9 Rat copper(0) multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of KLHL9 mRNA CTD PMID:20971185 Klhl9 Rat crocidolite asbestos increases methylation ISO KLHL9 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased methylation of KLHL9 promoter CTD PMID:29626692 Klhl9 Rat dexamethasone multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of KLHL9 mRNA CTD PMID:28628672 Klhl9 Rat Dibutyl phosphate affects expression ISO KLHL9 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of KLHL9 mRNA CTD PMID:37042841 Klhl9 Rat dicrotophos decreases expression ISO KLHL9 (Homo sapiens) 6480464 dicrotophos results in decreased expression of KLHL9 mRNA CTD PMID:28302478 Klhl9 Rat elemental selenium multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of KLHL9 mRNA CTD PMID:19244175 Klhl9 Rat fenthion decreases expression ISO Klhl9 (Mus musculus) 6480464 Fenthion results in decreased expression of KLHL9 mRNA CTD PMID:34813904 Klhl9 Rat folic acid multiple interactions ISO Klhl9 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of KLHL9 mRNA CTD PMID:22206623 Klhl9 Rat folpet decreases expression ISO Klhl9 (Mus musculus) 6480464 folpet results in decreased expression of KLHL9 mRNA CTD PMID:31558096 Klhl9 Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of KLHL9 gene CTD PMID:31011160 Klhl9 Rat hydralazine multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of KLHL9 mRNA CTD PMID:17183730 Klhl9 Rat indometacin multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of KLHL9 mRNA CTD PMID:28628672 Klhl9 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of KLHL9 mRNA CTD PMID:20080153 Klhl9 Rat manganese atom multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of KLHL9 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of KLHL9 mRNA CTD PMID:39836092 Klhl9 Rat manganese(0) multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of KLHL9 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of KLHL9 mRNA CTD PMID:39836092 Klhl9 Rat manganese(II) chloride multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of KLHL9 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of KLHL9 mRNA CTD PMID:39836092 Klhl9 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of KLHL9 mRNA CTD PMID:30467583 Klhl9 Rat methidathion decreases expression ISO Klhl9 (Mus musculus) 6480464 methidathion results in decreased expression of KLHL9 mRNA CTD PMID:34813904 Klhl9 Rat methylmercury chloride decreases expression ISO KLHL9 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of KLHL9 mRNA CTD PMID:28001369 Klhl9 Rat pirinixic acid decreases expression ISO Klhl9 (Mus musculus) 6480464 pirinixic acid results in decreased expression of KLHL9 mRNA CTD PMID:18445702 Klhl9 Rat potassium chromate multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of KLHL9 mRNA CTD PMID:22079256 Klhl9 Rat potassium chromate decreases expression ISO KLHL9 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of KLHL9 mRNA CTD PMID:22079256 Klhl9 Rat quercetin decreases expression ISO KLHL9 (Homo sapiens) 6480464 Quercetin results in decreased expression of KLHL9 mRNA CTD PMID:21632981 Klhl9 Rat rimonabant multiple interactions ISO Klhl9 (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of KLHL9 mRNA] CTD PMID:19030233 Klhl9 Rat rotenone decreases expression ISO KLHL9 (Homo sapiens) 6480464 Rotenone results in decreased expression of KLHL9 mRNA CTD PMID:33512557 Klhl9 Rat selenium atom multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of KLHL9 mRNA CTD PMID:19244175 Klhl9 Rat sodium arsenite decreases expression ISO KLHL9 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of KLHL9 mRNA CTD PMID:38568856 Klhl9 Rat sodium arsenite multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of KLHL9 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of KLHL9 mRNA CTD PMID:39836092 Klhl9 Rat sodium dichromate decreases expression ISO Klhl9 (Mus musculus) 6480464 sodium bichromate results in decreased expression of KLHL9 mRNA CTD PMID:31558096 Klhl9 Rat tebufenpyrad decreases expression ISO KLHL9 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of KLHL9 mRNA CTD PMID:33512557 Klhl9 Rat temozolomide increases expression ISO KLHL9 (Homo sapiens) 6480464 Temozolomide results in increased expression of KLHL9 mRNA CTD PMID:31758290 Klhl9 Rat titanium dioxide decreases methylation ISO Klhl9 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KLHL9 gene CTD PMID:35295148 Klhl9 Rat tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of KLHL9 mRNA CTD PMID:31129395 Klhl9 Rat trichloroethene decreases expression ISO Klhl9 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of KLHL9 mRNA CTD PMID:19448997 Klhl9 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of KLHL9 mRNA CTD PMID:33387578 Klhl9 Rat triphenyl phosphate affects expression ISO KLHL9 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of KLHL9 mRNA CTD PMID:37042841 Klhl9 Rat urethane decreases expression ISO KLHL9 (Homo sapiens) 6480464 Urethane results in decreased expression of KLHL9 mRNA CTD PMID:28818685 Klhl9 Rat valproic acid multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of KLHL9 mRNA CTD PMID:17183730 Klhl9 Rat valproic acid affects expression ISO KLHL9 (Homo sapiens) 6480464 Valproic Acid affects the expression of KLHL9 mRNA CTD PMID:25979313 Klhl9 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of KLHL9 mRNA CTD PMID:23555832 Klhl9 Rat vitamin E multiple interactions ISO KLHL9 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of KLHL9 mRNA CTD PMID:19244175
Imported Annotations - KEGG (archival)
Klhl9 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 108,449,492 - 108,453,676 (-) NCBI GRCr8 mRatBN7.2 5 103,333,747 - 103,337,931 (-) NCBI mRatBN7.2 mRatBN7.2 UTH_Rnor_SHR_Utx 5 105,682,082 - 105,686,266 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 107,472,529 - 107,476,713 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 107,540,336 - 107,544,540 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 107,323,258 - 107,327,442 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 107,323,258 - 107,327,442 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 111,299,120 - 111,303,304 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 108,196,981 - 108,201,165 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 108,203,022 - 108,206,163 (-) NCBI Celera 5 102,067,020 - 102,071,204 (-) NCBI Celera Cytogenetic Map 5 q32 NCBI
KLHL9 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 21,329,665 - 21,335,404 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 21,320,024 - 21,335,404 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 21,329,664 - 21,335,403 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 21,321,018 - 21,325,429 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 21,321,019 - 21,325,371 NCBI Celera 9 21,269,331 - 21,273,742 (-) NCBI Celera Cytogenetic Map 9 p21.3 NCBI HuRef 9 21,294,476 - 21,298,889 (-) NCBI HuRef CHM1_1 9 21,330,834 - 21,335,247 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 21,343,833 - 21,349,574 (-) NCBI T2T-CHM13v2.0
Klhl9 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 88,636,529 - 88,640,745 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 88,636,529 - 88,640,702 (-) Ensembl GRCm39 Ensembl GRCm38 4 88,718,292 - 88,722,508 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 88,718,292 - 88,722,465 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 88,364,196 - 88,368,412 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 88,190,813 - 88,193,692 (-) NCBI MGSCv36 mm8 Celera 4 87,227,411 - 87,231,634 (-) NCBI Celera Cytogenetic Map 4 C4 NCBI cM Map 4 42.02 NCBI
Klhl9 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955472 12,851,352 - 12,854,245 (-) NCBI ChiLan1.0 ChiLan1.0
KLHL9 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 103,197,022 - 103,201,449 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 103,202,967 - 103,207,394 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 21,191,847 - 21,196,242 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 21,809,412 - 21,813,812 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 21,811,230 - 21,813,251 (-) Ensembl panpan1.1 panPan2
KLHL9 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 40,792,064 - 40,796,433 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 40,792,603 - 40,794,456 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 39,465,303 - 39,469,495 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 41,735,006 - 41,739,198 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 11 40,414,965 - 40,419,157 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 40,292,449 - 40,296,641 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 40,906,715 - 40,910,907 (+) NCBI UU_Cfam_GSD_1.0
Klhl9
KLHL9 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 201,585,965 - 201,591,830 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 201,587,241 - 201,591,830 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 224,955,237 - 224,959,819 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
Klhl9
.
Predicted Target Of
Count of predictions: 172 Count of miRNA genes: 127 Interacting mature miRNAs: 141 Transcripts: ENSRNOT00000008510 Prediction methods: Miranda Result types: miRGate_prediction
1357396 Bw44 Body weight QTL 44 4.19 body mass (VT:0001259) body weight (CMO:0000012) 5 68984307 104251008 Rat 1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 61380 Edpm5 Estrogen-dependent pituitary mass QTL 5 4.5 0.92 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 5 68984307 104251008 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1298070 Scl18 Serum cholesterol level QTL 18 3.7 blood LDL cholesterol amount (VT:0000181) calculated plasma low density lipoprotein cholesterol level (CMO:0001245) 5 79584860 124584860 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1357402 Bw46 Body weight QTL 46 4.47 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 5 68984307 104251008 Rat 2302381 Bw84 Body weight QTL 84 4.47 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 5 68984307 104251008 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 1598859 Cm66 Cardiac mass QTL 66 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 79584860 124584860 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 1582212 Livw2 Liver weight QTL 2 3.5 0.0004 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 5 99016066 119085810 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 7394708 Emca11 Estrogen-induced mammary cancer QTL 11 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 99753548 113061097 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 1598846 Bp293 Blood pressure QTL 293 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 79584860 124584860 Rat 1358909 Kidm25 Kidney mass QTL 25 1.87 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 90067849 128034027 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 1600362 Mcs19 Mammary carcinoma susceptibility QTL 19 2.5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 99485997 103690167 Rat 1298086 Bp156 Blood pressure QTL 156 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 84132602 129132602 Rat 2290005 Mcs24 Mammary carcinoma susceptibility QTL 24 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 64719390 109719390 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 2312671 Scl64 Serum cholesterol level QTL 64 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 68984307 104251008 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358889 Bp261 Blood pressure QTL 261 2.86 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 90067849 128034027 Rat 2316957 Pur21 Proteinuria QTL 21 6.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 5 59793528 113558156 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000008510 ⟹ ENSRNOP00000061990
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 107,323,258 - 107,327,442 (+) Ensembl
RefSeq Acc Id:
NM_001107944 ⟹ NP_001101414
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 108,449,492 - 108,453,676 (-) NCBI mRatBN7.2 5 103,333,747 - 103,337,931 (-) NCBI Rnor_6.0 5 107,323,258 - 107,327,442 (+) NCBI Rnor_5.0 5 111,299,120 - 111,303,304 (+) NCBI RGSC_v3.4 5 108,196,981 - 108,201,165 (-) RGD Celera 5 102,067,020 - 102,071,204 (-) RGD
Sequence:
TCCGGAAGGTCGAGCTGGGCGTCGGTGCTAGGCCGCCGTTCTAGGCCCAAGTCGGAATTCCAGGCCCTGCTCCAAGCCAAGCCGGTGGCCGCAGAGACACATCGAAGACCGCAGAAGTCGCAGCCGCA
hide sequence
RefSeq Acc Id:
NP_001101414 ⟸ NM_001107944
- UniProtKB:
B5DEL5 (UniProtKB/TrEMBL), A0A8I5ZU85 (UniProtKB/TrEMBL)
- Sequence:
MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGEEIFPVHRAMMASASDYFKAMFTGGMKEKDLMCIKLHGVNKVGLKKIIDFIYTAKLSLNMDNLQDTLEA
hide sequence
Ensembl Acc Id:
ENSRNOP00000061990 ⟸ ENSRNOT00000008510
RGD ID: 13693830 Promoter ID: EPDNEW_R4355 Type: initiation region Name: Klhl9_1 Description: kelch-like family member 9 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 107,323,255 - 107,323,315 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-02-06
Klhl9
kelch-like family member 9
Klhl9
kelch-like 9 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Klhl9
kelch-like 9 (Drosophila)
Klhl9_predicted
kelch-like 9 (Drosophila) (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Klhl9_predicted
kelch-like 9 (Drosophila) (predicted)
RGD1304814_predicted
similar to Hypothetical protein KIAA1354 (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-20
RGD1304814_predicted
similar to Hypothetical protein KIAA1354 (predicted)
LOC313348_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC313348_predicted
similar to Hypothetical protein KIAA1354 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
