Symbol:
CRP
Name:
C-reactive protein
RGD ID:
736633
HGNC Page
HGNC:2367
Description:
Enables several functions, including complement component C1q complex binding activity; low-density lipoprotein particle binding activity; and low-density lipoprotein particle receptor binding activity. Involved in several processes, including negative regulation of macrophage derived foam cell differentiation; positive regulation of superoxide anion generation; and regulation of gene expression. Acts upstream of or within vasoconstriction. Located in extracellular space. Implicated in several diseases, including Kawasaki disease; autoimmune disease (multiple); macular degeneration (multiple); middle cerebral artery infarction; and nephritis (multiple). Biomarker of several diseases, including auditory system disease (multiple); autoimmune disease (multiple); cardiovascular system disease (multiple); eye disease (multiple); and lung disease (multiple).
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
C-reactive protein, pentraxin-related; c-reactive protein, petaxin related; MGC149895; MGC88244; pentraxin 1; PTX1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Crp (C-reactive protein, pentraxin-related) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Crp (C-reactive protein) HGNC
EggNOG, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Pan paniscus (bonobo/pygmy chimpanzee):
CRP (C-reactive protein) NCBI
Ortholog
Canis lupus familiaris (dog):
CRP (C-reactive protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Crp (C-reactive protein) NCBI
Ortholog
Sus scrofa (pig):
CRP (C-reactive protein, pentraxin-related) HGNC
Ensembl, OrthoDB, Panther
Chlorocebus sabaeus (green monkey):
CRP (C-reactive protein) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Crp (C-reactive protein) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Apcs (amyloid P component, serum) HGNC
OrthoDB
Mus musculus (house mouse):
Apcs (amyloid P component, serum) HGNC
OrthoDB
Rattus norvegicus (Norway rat):
Mptx1 (mucosal pentraxin 1) HGNC
OrthoDB
Mus musculus (house mouse):
Mptx1 (mucosal pentraxin 1) HGNC
OrthoDB
Mus musculus (house mouse):
Mptx2 (mucosal pentraxin 2) HGNC
OrthoDB
Sus scrofa (pig):
APCS (amyloid P component, serum) HGNC
OrthoDB
Sus scrofa (pig):
CRP (C-reactive protein) HGNC
NCBI
Rattus norvegicus (Norway rat):
Tor3a (torsin family 3, member A) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Crp (C-reactive protein)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Crp (C-reactive protein, pentraxin-related)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:ch211-234p6.10
Alliance
DIOPT (ZFIN)
Danio rerio (zebrafish):
crp1 (C-reactive protein 1)
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Danio rerio (zebrafish):
apcs
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
apcs
Alliance
DIOPT (Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
crp.4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
crp.4.L
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
XB5856184 [provisional:crp]
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
crp.L
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
XB5742360 [provisional:apcs]
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
crp.1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
mgc107876
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
XB5810166 [provisional]
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
crp.2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
XB5886928 [provisional]
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
mgc108147
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Related Pseudogenes:
CRPP1
Allele / Splice:
See ClinVar data
Candidate Gene For:
GLUCO117_H GLUCO120_H GLUCO149_H GLUCO177_H GLUCO223_H
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
NCBI Annotation Information:
Note: This gene has been reviewed for its involvement in coronavirus biology, and is involved in cytokine storm inflammatory response.
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 159,712,289 - 159,714,589 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 159,712,289 - 159,714,589 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 159,682,079 - 159,684,379 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 157,948,703 - 157,951,003 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 156,495,152 - 156,497,452 NCBI Celera 1 132,750,525 - 132,752,817 (-) NCBI Celera Cytogenetic Map 1 q23.2 NCBI HuRef 1 131,038,539 - 131,040,831 (-) NCBI HuRef CHM1_1 1 161,076,594 - 161,078,894 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 158,849,333 - 158,851,633 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
CRP Human abdominal aortic aneurysm IEP 13782270 protein:increased expression:plasma RGD CRP Human Acute Coronary Syndrome IEP 9491837 protein:increased expression: : RGD CRP Human Acute Coronary Syndrome IDA 6907401 RGD CRP Human acute kidney failure ISO RGD:2411 6903282 protein:increased expression:serum RGD CRP Human acute kidney failure IDA 6906888 associated with Myocardial Infarction; RGD CRP Human acute stress disorder IEP 9585647 RGD CRP Human Acute Uveitis IEP 9491833 protein:increased expression:serum: RGD CRP Human Acute Uveitis ISO RGD:2411 9491782 protein:increased expression:plasma: RGD CRP Human aggressive periodontitis IEP 9491835 protein:increased expression:serum: RGD CRP Human Albuminuria IEP 6909147 associated with hypertension RGD CRP Human Albuminuria severity IEP 6907441 associated with Anemia, Sickle Cell; protein:increased expression:serum RGD CRP Human alcoholic liver cirrhosis severity IEP 6482305 RGD CRP Human Alzheimer's disease ISO RGD:10398 6904208 RGD CRP Human ankylosing spondylitis disease_progression IEP 6482308 RGD CRP Human ankylosing spondylitis IEP 9491788 protein:increased expression:serum: RGD CRP Human antiphospholipid syndrome IDA 6907402 RGD CRP Human anxiety disorder IEP 9491832 associated with Coronary Disease; RGD CRP Human arthritis IAGP 5508454 associated with Lupus Erythematosus, Systemic;DNA:SNP RGD CRP Human aspergillosis treatment IEP 9495929 RGD CRP Human asthma IEP 5131288 protein:increased expression:serum RGD CRP Human atherosclerosis disease_progression IEP 9491769 protein:increased expression:serum: RGD CRP Human atrial fibrillation disease_progression IEP 9491838 RGD CRP Human atrial fibrillation disease_progression IEP 9491839 associated with Idiopathic dilation cardiomyopathy;protein:increased expression:plasma: RGD CRP Human Bacteremia IEP 9491402 protein:increased expression:serum: RGD CRP Human bacterial infectious disease IEP 9495911 RGD CRP Human bacterial meningitis IEP 9491388 protein:increased expression:serum: RGD CRP Human Behcet's disease IEP 9491757 protein:increased expression:plasma,erythrocyte: RGD CRP Human Brain Hypoxia-Ischemia IDA 9585994 RGD CRP Human Brain Injuries disease_progression IEP 9585646 RGD CRP Human breast cancer IEP 9491787 protein:increased expression:nipple aspirate fluid RGD CRP Human breast carcinoma severity IEP 9585643 RGD CRP Human bronchiolitis severity IEP 5131282 RGD CRP Human Burns ISO RGD:2411 5131457 RGD CRP Human Cardiac Arrhythmias IEP 9495908 protein:increased expression:blood: RGD CRP Human cardiovascular system disease susceptibility IEP 9491755 RGD CRP Human cardiovascular system disease TAS 1580260 RGD CRP Human Chronic Hepatitis C IDA 6482311 RGD CRP Human chronic obstructive pulmonary disease severity IEP 5131279 protein:increased expression:serum RGD CRP Human chronic obstructive pulmonary disease IEP 5131278 protein:increased expression:serum RGD CRP Human colon cancer ISO RGD:2411 6903278 protein:increased expression:serum: RGD CRP Human Contrast-Induced Nephropathy IDA 6909166 associated with coronary disease; RGD CRP Human coronary artery disease IEP 2313344 associated with Diabetes Mellitus, Non-Insulin-Dependent;protein:increased expression:serum RGD CRP Human COVID-19 severity IEP 30309200 protein:increased expression:serum (human) RGD CRP Human COVID-19 severity IEP 30310238 protein:increased expression:serum (human) RGD CRP Human COVID-19 severity IEP 32698682 associated with hyperglycemia;protein:increased expression:serum (human) RGD CRP Human COVID-19 severity IEP 30310229 protein:increased expression:serum (human) RGD CRP Human COVID-19 severity IEP 30310230 protein:increased expression:blood (human) RGD CRP Human COVID-19 severity IEP 30310235 protein:increased expression:plasma (human) RGD CRP Human COVID-19 severity IEP 30309957 associated with cardiovascular system disease;protein:increased expression:blood (human) RGD CRP Human COVID-19 severity IEP 30296673 RGD CRP Human COVID-19 disease_progression IEP 30296681 associated with diabetes mellitus RGD CRP Human COVID-19 severity IEP 27226695 protein:increased expression:serum (human) RGD CRP Human COVID-19 severity IEP 27095965 protein:increased expression:serum (human) RGD CRP Human Crohn's disease severity IEP 6482309 protein:increased expression:serum RGD CRP Human depressive disorder IEP 6904211 associated with kidney failure, chronic; protein:increased expression:plasma RGD CRP Human Diabetic Foot disease_progression IEP 6906887 protein:increased expression:blood: RGD CRP Human Diabetic Nephropathies IEP 6906967 associated with Diabetes Mellitus, Type 2;protein:increased expression:urine RGD CRP Human Diabetic Nephropathies disease_progression IDA 6906965 associated with Diabetes Mellitus, Type 1 RGD CRP Human diabetic retinopathy IEP 8547537 protein:increased expression:serum: RGD CRP Human end stage renal disease disease_progression IEP 6906886 protein:increased expression:plasma RGD CRP Human Experimental Diabetes Mellitus ISO RGD:2411 6482316 RGD CRP Human Experimental Diabetes Mellitus ISO RGD:10398 6907422 RGD CRP Human Experimental Liver Cirrhosis ISO RGD:2411 9491781 protein:decreased expression:serum: RGD CRP Human familial hyperlipidemia ISO RGD:2411 8695929 protein:increased expression:serum: RGD CRP Human Fever of Unknown Origin IEP 9491382 RGD CRP Human heart disease IDA 1580259 RGD CRP Human human immunodeficiency virus infectious disease disease_progression IDA 6482303 RGD CRP Human Human Influenza IEP 5131277 protein:increased expression:serum RGD CRP Human hypertension IDA 9586008 RGD CRP Human hypertension ISO RGD:2411 5131461 protein:increased expression:plasma RGD CRP Human hypertension IEP 9491754 protein:increased expression:serum: RGD CRP Human hypertensive retinopathy IEP 9491786 protein:increased expression:blood: RGD CRP Human Hypoxia IEP 5131285 associated with Influenza RGD CRP Human Inflammation ISO RGD:2411 5131460 RGD CRP Human inflammatory bowel disease IDA 6482301 RGD CRP Human intermediate coronary syndrome disease_progression IEP 9491780 RGD CRP Human interstitial cystitis IEP 6907432 protein:increased expression:serum RGD CRP Human interstitial nephritis ISO RGD:10398 6907431 associated with ureteral obstruction RGD CRP Human interstitial nephritis onset IMP 6907431 associated with ureteral obstruction RGD CRP Human Intestinal Reperfusion Injury ISO RGD:2411 5129536 protein:increased expression:intestine: RGD CRP Human iron deficiency anemia ISO RGD:2411 5131463 protein:increased expression:plasma RGD CRP Human juvenile rheumatoid arthritis IEP 6906884 protein:increased expression:serum RGD CRP Human Kawasaki disease susceptibility IAGP 9495921 DNA:SNP: :1444 C-->T(human) RGD CRP Human kidney failure severity IEP 6907441 associated with Anemia, Sickle Cell; protein:increased expression:serum RGD CRP Human Kuhnt-Junius degeneration treatment IAGP 9491756 DNA:SNPs: :rs2808635,rs876538(human) RGD CRP Human Kuhnt-Junius degeneration IEP 9491775 RGD CRP Human Left Ventricular Hypertrophy IEP 6907433 associated with Lupus Nephritis; protein:increased expression:serum RGD CRP Human liver cirrhosis IEP 9491781 associated with Hepatitis C, Chronic;protein:decreased expression:serum RGD CRP Human low tension glaucoma IEP 9491770 protein:increased expression:plasma: RGD CRP Human low tension glaucoma no_association IEP 9491771 RGD CRP Human lupus nephritis no_association IDA 6909146 RGD CRP Human lupus nephritis IAGP 5508454 DNA:SNP RGD CRP Human lupus nephritis IDA 6907400 RGD CRP Human lupus nephritis IDA 6909145 RGD CRP Human Lymphatic Metastasis susceptibility IAGP 9580226 associated with Breast Neoplasm; DNA:polymorphism: :1846C>T(rs1205)(human) RGD CRP Human lymphopenia IAGP 5508454 associated with Lupus Erythematosus, Systemic;DNA:SNP RGD CRP Human macular degeneration IEP 9491760 protein:increased expression:serum: RGD CRP Human macular degeneration susceptibility IDA 9491758 RGD CRP Human mastoiditis disease_progression IEP 9491592 RGD CRP Human metabolic dysfunction and alcohol associated liver disease ISO RGD:2411 9491781 protein:increased expression:serum: RGD CRP Human Metabolic Syndrome IMP 6482318 RGD CRP Human mevalonic aciduria disease_progression IEP 9585642 RGD CRP Human middle cerebral artery infarction IDA 9585995 RGD CRP Human mouth disease ISO RGD:2411 6482317 protein:increased expression:serum RGD CRP Human Mycoplasma pneumoniae pneumonia IEP 5131292 RGD CRP Human myocardial infarction IEP 6482304 RGD CRP Human myocardial infarction ISO RGD:2411 5131456 protein:increased expression:serum RGD CRP Human myocardial infarction IEP 9491780 associated with Angina, Unstable; RGD CRP Human Myocardial Ischemia ISO RGD:2411 5128547 protein:increased expression:serum RGD CRP Human Myocardial Reperfusion Injury ISO RGD:2411 5128547 protein:increased expression:serum RGD CRP Human Neonatal Sepsis treatment ISO RGD:2411 458925287 RGD CRP Human non-arteritic anterior ischemic optic neuropathy IEP 9491785 protein:increased expression:blood: RGD CRP Human obesity IEP 5490970 protein:increased expression:serum RGD CRP Human obesity disease_progression ISO RGD:2411 15045599 mRNA:increased expression:liver (rat) RGD CRP Human obstructive sleep apnea IDA 5131290 RGD CRP Human opiate dependence IEP 408395144 protein:increased expression:serum RGD CRP Human otitis externa disease_progression IEP 9491591 RGD CRP Human otitis media treatment IEP 9491381 RGD CRP Human overactive bladder syndrome IEP 6907432 protein:increased expression:serum RGD CRP Human Parkinson's disease IEP 6482307 RGD CRP Human pelvic inflammatory disease IEP 38508897 protein:increased expression:plasma (human) RGD CRP Human pharyngoconjunctival fever IEP 9491593 RGD CRP Human Pneumococcal Pneumonia disease_progression IEP 5131293 RGD CRP Human pneumonia disease_progression IEP 5131291 RGD CRP Human pneumonia severity IEP 5131283 RGD CRP Human polymyalgia rheumatica treatment IEP 9495925 RGD CRP Human Polypoidal Choroidal Vasculopathy IEP 9491775 RGD CRP Human Postoperative Atrial Fibrillation no_association IEP 9495909 RGD CRP Human Pseudomonas Infections IDA 6906966 associated with Diabetes Mellitus, Type 1; RGD CRP Human Pseudomonas Infections ISO RGD:2411 5131464 protein:increased expression:blood RGD CRP Human psoriasis IEP 6482313 RGD CRP Human psoriasis treatment IEP 9495927 protein:increased expression:serum: RGD CRP Human pulmonary hypertension IEP 6482312 associated with Pulmonary Disease, Chronic Obstructive RGD CRP Human pulmonary sarcoidosis severity IEP 5131289 RGD CRP Human pulmonary tuberculosis IEP 5131287 associated with HIV Infections RGD CRP Human pulmonary tuberculosis severity IEP 5131284 RGD CRP Human pyelonephritis ISO RGD:2411 6482315 RGD CRP Human renal cell carcinoma disease_progression IEP 6904212 RGD CRP Human Renal Colic IDA 6909142 associated with Urolithiasis; RGD CRP Human renal fibrosis onset IMP 6907431 associated with ureteral obstruction RGD CRP Human renal fibrosis ISO RGD:10398 6907431 associated with ureteral obstruction RGD CRP Human renal hypertension ISO RGD:2411 6907405 protein:increased expression:serum RGD CRP Human retinal vein occlusion IEP 9491754 protein:increased expression:serum: RGD CRP Human rheumatoid arthritis ISO RGD:2411 6904209 RGD CRP Human rheumatoid arthritis IEP 6904209 protein:increased expression:serum RGD CRP Human Sepsis ISO RGD:2411 6482315 RGD CRP Human Sepsis IEP 9491784 protein:increased expression:blood: RGD CRP Human Serositis IAGP 5508454 associated with Lupus Erythematosus, Systemic;DNA:SNP RGD CRP Human Sjogren's syndrome IEP 9491774 associated with Arthritis, Rheumatoid;protein:increased expression:serum: RGD CRP Human Sjogren's syndrome IEP 9491835 RGD CRP Human Spinal Cord Injuries ISO RGD:2411 6903321 RGD CRP Human status epilepticus ISO RGD:2411 9586015 protein:increased expression:plasma: RGD CRP Human systemic lupus erythematosus no_association IDA 6909146 RGD CRP Human systemic lupus erythematosus treatment IDA 6909144 RGD CRP Human systemic lupus erythematosus disease_progression IDA 6907402 RGD CRP Human temporal arteritis IEP 9491785 protein:increased expression:blood: RGD CRP Human Tubulointerstitial Nephritis and Uveitis disease_progression IEP 6907435 RGD CRP Human type 1 diabetes mellitus IEP 6906966 RGD CRP Human type 1 diabetes mellitus IEP 8547537 protein:increased expression:serum: RGD CRP Human type 2 diabetes mellitus IEP 9491772 RGD CRP Human urticaria IEP 6482310 protein:increased expression:serum RGD CRP Human uveal melanoma disease_progression IEP 9491834 RGD CRP Human vestibular neuronitis disease_progression IEP 9491594 RGD
Only show annotations with direct experimental evidence (0 objects hidden)
CRP Human (-)-epigallocatechin 3-gallate decreases expression ISO RGD:2411 6480464 epigallocatechin gallate results in decreased expression of CRP mRNA; epigallocatechin gallate results in decreased expression more ... CTD PMID:19782057 CRP Human (1->4)-beta-D-glucan multiple interactions ISO RGD:10398 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CRP mRNA CTD PMID:36331819 CRP Human (4Z,7Z,10Z,13Z,16Z)-docosa-4,7,10,13,16-pentaenoic acid affects expression EXP 6480464 docosapentaenoic acid affects the expression of CRP protein CTD PMID:22113248 CRP Human (R)-lipoic acid multiple interactions ISO RGD:2411 6480464 Cyclosporine inhibits the reaction [Thioctic Acid inhibits the reaction [Acetic Acid results in increased expression more ... CTD PMID:26276312 CRP Human (R,R,R)-alpha-tocopherol multiple interactions EXP 6480464 [alpha-Tocopherol co-treated with gamma-Tocopherol] results in decreased expression of CRP protein CTD PMID:18191645 CRP Human 1,1-dichloroethene increases expression ISO RGD:2411 6480464 vinylidene chloride results in increased expression of CRP protein CTD PMID:14565772 CRP Human 1-O-palmitoyl-2-O-(5-oxovaleryl)-sn-glycero-3-phosphocholine increases expression EXP 6480464 1-palmitoyl-2-(5-oxovaleroyl)-sn-glycero-3-phosphorylcholine results in increased expression of CRP mRNA CTD PMID:16386258 CRP Human 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with Cyproterone Acetate] results in increased expression of CRP protein; [Ethinyl Estradiol more ... CTD PMID:12616983|PMID:14557435|PMID:15769986|PMID:16982228|PMID:17105841|PMID:17903073 CRP Human 17alpha-ethynylestradiol affects expression ISO RGD:10398 6480464 Ethinyl Estradiol affects the expression of CRP mRNA CTD PMID:14976129 CRP Human 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of CRP protein CTD PMID:10959719 CRP Human 17beta-estradiol affects expression EXP 6480464 Estradiol analog affects the expression of CRP protein CTD PMID:12876635 CRP Human 17beta-estradiol increases expression ISO RGD:10398 6480464 Estradiol results in increased expression of CRP mRNA CTD PMID:39298647 CRP Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with dienogest] results in increased expression of CRP protein CTD PMID:15970291 CRP Human 17beta-estradiol increases expression ISO RGD:2411 6480464 Estradiol results in increased expression of CRP mRNA; Estradiol results in increased expression of CRP more ... CTD PMID:20838740|PMID:32145629 CRP Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of CRP protein CTD PMID:12616983 CRP Human 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:2411 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of CRP mRNA CTD PMID:20056577 CRP Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:2411 6480464 Tetrachlorodibenzodioxin affects the expression of CRP mRNA CTD PMID:22298810 CRP Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:2411 6480464 Tetrachlorodibenzodioxin results in decreased expression of CRP mRNA CTD PMID:18796159|PMID:21215274|PMID:21724226|PMID:33387578 CRP Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:10398 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of CRP mRNA CTD PMID:38648751 CRP Human 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine increases expression EXP 6480464 Platelet Activating Factor results in increased expression of CRP mRNA CTD PMID:16386258 CRP Human 2-trans,6-trans,10-trans-geranylgeranyl diphosphate multiple interactions EXP 6480464 geranylgeranyl pyrophosphate inhibits the reaction [Simvastatin inhibits the reaction [CRP results in increased expression of more ... CTD PMID:18023360 CRP Human 3',5'-cyclic AMP multiple interactions ISO RGD:10398 6480464 Cyclic AMP inhibits the reaction [IL1B protein results in increased expression of CRP mRNA] CTD PMID:22117073 CRP Human 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of CRP mRNA CTD PMID:26519613 CRP Human 3,3',4,4'-tetrachlorobiphenyl increases expression EXP 6480464 3,4,3',4'-tetrachlorobiphenyl results in increased expression of CRP mRNA CTD PMID:26519613 CRP Human 3,3',4,4'-tetrachlorobiphenyl increases expression ISO RGD:10398 6480464 3,4,3',4'-tetrachlorobiphenyl results in increased expression of CRP protein CTD PMID:30935970 CRP Human 3H-1,2-dithiole-3-thione decreases expression ISO RGD:2411 6480464 1,2-dithiol-3-thione results in decreased expression of CRP mRNA CTD PMID:19162173 CRP Human 4,4'-sulfonyldiphenol affects expression ISO RGD:10398 6480464 bisphenol S affects the expression of CRP mRNA CTD PMID:39298647 CRP Human 4,4'-sulfonyldiphenol multiple interactions ISO RGD:2411 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 CRP Human 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide multiple interactions EXP 6480464 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide promotes the reaction [Ethanol results in increased expression of CRP protein] CTD PMID:27989594 CRP Human 7,12-dimethyltetraphene multiple interactions ISO RGD:10398 6480464 [9,10-Dimethyl-1,2-benzanthracene co-treated with Croton Oil] results in increased expression of CRP protein; Cisplatin inhibits the more ... CTD PMID:37352108 CRP Human abacavir increases expression EXP 6480464 abacavir results in increased expression of CRP protein CTD PMID:19891054 CRP Human acalabrutinib affects expression EXP 6480464 acalabrutinib affects the expression of CRP protein CTD PMID:32503877 CRP Human acetamide decreases expression ISO RGD:2411 6480464 acetamide results in decreased expression of CRP mRNA CTD PMID:31881176 CRP Human acetic acid increases expression ISO RGD:2411 6480464 Acetic Acid results in increased expression of CRP protein CTD PMID:26276312|PMID:30594690 CRP Human acetic acid multiple interactions ISO RGD:2411 6480464 Cyclosporine inhibits the reaction [Thioctic Acid inhibits the reaction [Acetic Acid results in increased expression more ... CTD PMID:26276312|PMID:30594690 CRP Human acrylamide decreases expression ISO RGD:2411 6480464 Acrylamide results in decreased expression of CRP mRNA CTD PMID:28959563 CRP Human acrylamide increases expression ISO RGD:10398 6480464 Acrylamide results in increased expression of CRP mRNA CTD PMID:30807115 CRP Human aflatoxin B1 decreases expression ISO RGD:10398 6480464 Aflatoxin B1 results in decreased expression of CRP mRNA CTD PMID:19770486 CRP Human aflatoxin B1 increases expression ISO RGD:2411 6480464 Aflatoxin B1 results in increased expression of CRP mRNA CTD PMID:33354967 CRP Human aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of CRP mRNA CTD PMID:22100608 CRP Human alclofenac decreases expression EXP 6480464 alclofenac results in decreased expression of CRP protein CTD PMID:241598 CRP Human aluminium atom multiple interactions EXP 6480464 [Zinc co-treated with Aluminum] results in increased expression of CRP protein; [Zinc co-treated with Copper more ... CTD PMID:27816692 CRP Human aluminium(0) multiple interactions EXP 6480464 [Zinc co-treated with Aluminum] results in increased expression of CRP protein; [Zinc co-treated with Copper more ... CTD PMID:27816692 CRP Human amiodarone multiple interactions EXP 6480464 Amiodarone inhibits the reaction [CRP protein results in increased expression of CCL2 protein]; Amiodarone inhibits more ... CTD PMID:19225199 CRP Human amlodipine multiple interactions EXP 6480464 [Atorvastatin co-treated with Amlodipine] results in decreased expression of CRP protein CTD PMID:18389332 CRP Human ammonium chloride affects expression ISO RGD:2411 6480464 Ammonium Chloride affects the expression of CRP mRNA CTD PMID:16483693 CRP Human amphetamine decreases expression ISO RGD:2411 6480464 Amphetamine results in decreased expression of CRP mRNA CTD PMID:30779732 CRP Human apigenin multiple interactions ISO RGD:10398 6480464 Apigenin inhibits the reaction [Methotrexate results in increased expression of CRP protein] CTD PMID:33845614 CRP Human arsane increases expression EXP 6480464 Arsenic results in increased expression of CRP protein CTD PMID:23761297 CRP Human arsenic atom increases expression EXP 6480464 Arsenic results in increased expression of CRP protein CTD PMID:23761297 CRP Human arsenous acid increases expression ISO RGD:2411 6480464 Arsenic Trioxide results in increased expression of CRP CTD PMID:21851829 CRP Human atorvastatin calcium multiple interactions EXP 6480464 [Atorvastatin co-treated with Amlodipine] results in decreased expression of CRP protein; Atorvastatin inhibits the reaction more ... CTD PMID:18389332|PMID:21584495 CRP Human atorvastatin calcium multiple interactions ISO RGD:2411 6480464 Atorvastatin inhibits the reaction [sodium arsenite results in increased expression of CRP protein] CTD PMID:25058445 CRP Human atorvastatin calcium decreases expression EXP 6480464 Atorvastatin results in decreased expression of CRP protein CTD PMID:16025360|PMID:16360360|PMID:17673219 CRP Human benidipine multiple interactions ISO RGD:2411 6480464 benidipine inhibits the reaction [Isoproterenol results in increased expression of and results in increased secretion more ... CTD PMID:25269373 CRP Human benzbromarone multiple interactions EXP 6480464 Benzbromarone inhibits the reaction [IL1B protein results in increased expression of CRP protein] CTD PMID:21329621 CRP Human benzbromarone decreases expression EXP 6480464 Benzbromarone results in decreased expression of CRP protein CTD PMID:21329621 CRP Human benzene affects expression ISO RGD:2411 6480464 Benzene affects the expression of CRP mRNA CTD PMID:15878777 CRP Human benzene affects response to substance EXP 6480464 CRP gene SNP affects the susceptibility to Benzene CTD PMID:21540635 CRP Human benzo[a]pyrene decreases expression ISO RGD:10398 6480464 Benzo(a)pyrene results in decreased expression of CRP mRNA CTD PMID:19770486 CRP Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of CRP mRNA CTD PMID:32234424 CRP Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of CRP promoter CTD PMID:27901495 CRP Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of CRP 3' UTR CTD PMID:27901495 CRP Human benzylpenicillin multiple interactions ISO RGD:10398 6480464 [Penicillin G co-treated with Erythromycin] results in increased expression of CRP mRNA CTD PMID:27503388 CRP Human bezafibrate decreases expression EXP 6480464 Bezafibrate results in decreased expression of CRP protein CTD PMID:11893366 CRP Human bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:10398 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated more ... CTD PMID:33484791|PMID:38954831 CRP Human bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated more ... CTD PMID:32949613 CRP Human bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of CRP protein CTD PMID:31163220 CRP Human bisphenol A decreases expression ISO RGD:2411 6480464 bisphenol A results in decreased expression of CRP mRNA CTD PMID:25181051 CRP Human bisphenol A increases secretion EXP 6480464 bisphenol A results in increased secretion of CRP protein CTD PMID:33625709 CRP Human bisphenol A increases secretion ISO RGD:2411 6480464 bisphenol A results in increased secretion of CRP protein CTD PMID:33847390 CRP Human bisphenol A multiple interactions ISO RGD:2411 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:33847390|PMID:35945320|PMID:36041667 CRP Human bisphenol A multiple interactions ISO RGD:10398 6480464 Centella asiatica extract inhibits the reaction [bisphenol A results in increased secretion of CRP protein] CTD PMID:38042274 CRP Human bisphenol A increases secretion ISO RGD:10398 6480464 bisphenol A results in increased secretion of CRP protein CTD PMID:38042274 CRP Human bisphenol A increases expression ISO RGD:2411 6480464 bisphenol A results in increased expression of CRP mRNA CTD PMID:32145629 CRP Human bisphenol A affects expression ISO RGD:2411 6480464 bisphenol A affects the expression of CRP mRNA CTD PMID:30903817 CRP Human bisphenol F increases expression ISO RGD:10398 6480464 bisphenol F results in increased expression of CRP mRNA CTD PMID:38685157 CRP Human bisphenol F multiple interactions ISO RGD:2411 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 CRP Human bivalirudin decreases expression EXP 6480464 bivalirudin results in decreased expression of CRP protein CTD PMID:16118546 CRP Human boron atom multiple interactions ISO RGD:2411 6480464 Boron inhibits the reaction [Dietary Fats results in increased expression of CRP mRNA] CTD PMID:36419211 CRP Human Botulinum toxin type A multiple interactions ISO RGD:2411 6480464 Rivastigmine inhibits the reaction [Botulinum Toxins, Type A results in increased expression of CRP protein] CTD PMID:29739252 CRP Human Botulinum toxin type A increases expression ISO RGD:2411 6480464 Botulinum Toxins, Type A results in increased expression of CRP protein CTD PMID:29739252 CRP Human Bromperidol multiple interactions EXP 6480464 [bromperidol co-treated with Flunitrazepam] results in increased expression of CRP protein CTD PMID:15298663 CRP Human Butylbenzyl phthalate multiple interactions ISO RGD:10398 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated more ... CTD PMID:38954831 CRP Human Butylbenzyl phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated more ... CTD PMID:32949613 CRP Human cadmium atom decreases expression EXP 6480464 Cadmium results in decreased expression of CRP mRNA CTD PMID:24376830 CRP Human calcitriol decreases expression EXP 6480464 Calcitriol results in decreased expression of CRP protein CTD PMID:21350317 CRP Human candesartan multiple interactions EXP 6480464 candesartan promotes the reaction [Fenofibrate results in decreased expression of CRP protein]; Fenofibrate promotes the more ... CTD PMID:16443859 CRP Human candesartan decreases expression EXP 6480464 candesartan results in decreased expression of CRP protein CTD PMID:14620923|PMID:16443859 CRP Human carbon monoxide increases expression EXP 6480464 Carbon Monoxide results in increased expression of CRP protein CTD PMID:18629312 CRP Human carbon nanotube increases expression ISO RGD:10398 6480464 Nanotubes, Carbon results in increased expression of CRP CTD PMID:21654424 CRP Human carnosine multiple interactions ISO RGD:10398 6480464 Carnosine inhibits the reaction [Acetaminophen results in increased expression of CRP protein] CTD PMID:19799668 CRP Human carnosine multiple interactions ISO RGD:2411 6480464 Carnosine inhibits the reaction [Sodium Nitrite results in increased expression of CRP protein] CTD PMID:28266762|PMID:28833918 CRP Human carrageenan multiple interactions ISO RGD:2411 6480464 caffeic acid phenethyl ester inhibits the reaction [Carrageenan results in increased expression of CRP protein]; more ... CTD PMID:34789018 CRP Human carrageenan increases expression ISO RGD:2411 6480464 Carrageenan results in increased expression of CRP protein CTD PMID:34789018 CRP Human carvedilol decreases expression EXP 6480464 carvedilol results in decreased expression of CRP protein CTD PMID:15047035 CRP Human carvedilol multiple interactions ISO RGD:2411 6480464 Carvedilol inhibits the reaction [Arginine results in increased expression of CRP protein] CTD PMID:32569593 CRP Human celecoxib decreases expression EXP 6480464 Celecoxib results in decreased expression of CRP CTD PMID:12551863 CRP Human chlorpyrifos increases expression ISO RGD:2411 6480464 Chlorpyrifos results in increased expression of CRP protein CTD PMID:39419344 CRP Human chlorpyrifos multiple interactions ISO RGD:2411 6480464 [Chlorpyrifos co-treated with Dimethoate] results in increased expression of CRP protein CTD PMID:39419344 CRP Human chromium(6+) increases expression EXP 6480464 chromium hexavalent ion results in increased expression of CRP protein CTD PMID:28596144 CRP Human cisplatin multiple interactions ISO RGD:10398 6480464 Cisplatin inhibits the reaction [[9,10-Dimethyl-1,2-benzanthracene co-treated with Croton Oil] results in increased expression of CRP more ... CTD PMID:37352108 CRP Human clofibric acid multiple interactions ISO RGD:2411 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of CRP mRNA CTD PMID:17602206 CRP Human clozapine increases expression EXP 6480464 Clozapine results in increased expression of CRP protein CTD PMID:17685758 CRP Human cobalt dichloride decreases expression ISO RGD:2411 6480464 cobaltous chloride results in decreased expression of CRP mRNA CTD PMID:24386269 CRP Human cocaine increases expression EXP 6480464 Cocaine results in increased expression of CRP protein CTD PMID:11988210 CRP Human colesevelam hydrochloride decreases expression EXP 6480464 Colesevelam Hydrochloride results in decreased expression of CRP protein CTD PMID:16616026 CRP Human copper atom multiple interactions EXP 6480464 [Zinc co-treated with Copper co-treated with Aluminum] results in increased expression of CRP protein CTD PMID:27816692 CRP Human copper atom decreases expression ISO RGD:2411 6480464 Copper results in decreased expression of CRP mRNA CTD PMID:30556269 CRP Human copper(0) multiple interactions EXP 6480464 [Zinc co-treated with Copper co-treated with Aluminum] results in increased expression of CRP protein CTD PMID:27816692 CRP Human copper(0) decreases expression ISO RGD:2411 6480464 Copper results in decreased expression of CRP mRNA CTD PMID:30556269 CRP Human copper(II) sulfate decreases expression EXP 6480464 Copper Sulfate results in decreased expression of CRP mRNA CTD PMID:19549813 CRP Human copper(II) sulfate multiple interactions ISO RGD:2411 6480464 Curcumin analog inhibits the reaction [Copper Sulfate results in increased secretion of CRP protein]; Curcumin more ... CTD PMID:30431687 CRP Human copper(II) sulfate increases secretion ISO RGD:2411 6480464 Copper Sulfate results in increased secretion of CRP protein CTD PMID:30431687 CRP Human curcumin multiple interactions ISO RGD:2411 6480464 Curcumin analog inhibits the reaction [Copper Sulfate results in increased secretion of CRP protein]; Curcumin more ... CTD PMID:21378372|PMID:26713546|PMID:30431687 CRP Human curcumin multiple interactions ISO RGD:10398 6480464 [Curcumin co-treated with Niacin co-treated with ZM 241385] inhibits the reaction [Rotenone results in increased more ... CTD PMID:31820278 CRP Human cyanocob(III)alamin multiple interactions EXP 6480464 [Folic Acid co-treated with Riboflavin co-treated with Vitamin B 6 co-treated with Vitamin B 12] more ... CTD PMID:16517955 CRP Human cyclophosphamide multiple interactions ISO RGD:2411 6480464 allyl sulfide inhibits the reaction [Cyclophosphamide results in increased secretion of CRP protein] CTD PMID:31779506 CRP Human cyclophosphamide increases secretion ISO RGD:2411 6480464 Cyclophosphamide results in increased secretion of CRP protein CTD PMID:31779506 CRP Human cyclosporin A decreases expression ISO RGD:10398 6480464 Cyclosporine results in decreased expression of CRP mRNA CTD PMID:19770486 CRP Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of CRP mRNA CTD PMID:27989131 CRP Human cyclosporin A multiple interactions ISO RGD:2411 6480464 Cyclosporine inhibits the reaction [Thioctic Acid inhibits the reaction [Acetic Acid results in increased expression more ... CTD PMID:26276312 CRP Human cyclosporin A decreases expression ISO RGD:2411 6480464 Cyclosporine results in decreased expression of CRP mRNA CTD PMID:24971338 CRP Human cyproconazole increases expression ISO RGD:10398 6480464 cyproconazole results in increased expression of CRP mRNA CTD PMID:22334560 CRP Human cyproterone acetate multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with Cyproterone Acetate] results in increased expression of CRP protein CTD PMID:14557435 CRP Human D-penicillamine decreases expression EXP 6480464 Penicillamine results in decreased expression of CRP protein CTD PMID:241598 CRP Human daidzein multiple interactions EXP 6480464 [Genistein co-treated with daidzein] results in decreased expression of CRP protein CTD PMID:16332659 CRP Human delta-tocotrienol multiple interactions EXP 6480464 [resveratrol co-treated with pterostilbene co-treated with Quercetin co-treated with tocotrienol, delta co-treated with Niacin] results more ... CTD PMID:24319627 CRP Human deoxynivalenol increases expression ISO RGD:10398 6480464 deoxynivalenol results in increased expression of CRP mRNA CTD PMID:22968694 CRP Human desferrioxamine B multiple interactions ISO RGD:2411 6480464 Deferoxamine inhibits the reaction [Copper Sulfate results in increased secretion of CRP protein] CTD PMID:30431687 CRP Human desogestrel multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with Desogestrel] results in increased expression of CRP protein; Simvastatin inhibits the more ... CTD PMID:17105841 CRP Human dexamethasone multiple interactions ISO RGD:2411 6480464 Dexamethasone promotes the reaction [Losartan inhibits the reaction [Tobacco Smoke Pollution results in increased expression more ... CTD PMID:32812458 CRP Human dexamethasone multiple interactions ISO RGD:10398 6480464 Dexamethasone inhibits the reaction [[Lipopolysaccharides co-treated with IL10 protein] results in increased expression of CRP more ... CTD PMID:37177863 CRP Human Diallyl sulfide multiple interactions ISO RGD:2411 6480464 allyl sulfide inhibits the reaction [Cyclophosphamide results in increased secretion of CRP protein] CTD PMID:31779506 CRP Human diarsenic trioxide increases expression ISO RGD:2411 6480464 Arsenic Trioxide results in increased expression of CRP CTD PMID:21851829 CRP Human dibutyl phthalate multiple interactions ISO RGD:10398 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated more ... CTD PMID:38954831 CRP Human diclofenac multiple interactions EXP 6480464 Diclofenac inhibits the reaction [TNF protein results in increased expression of CRP mRNA]; Diclofenac inhibits more ... CTD PMID:27313093 CRP Human diclofenac multiple interactions ISO RGD:2411 6480464 [Diclofenac co-treated with lipopolysaccharide, E coli O55-B5] results in increased expression of CRP protein; Diclofenac more ... CTD PMID:25772430 CRP Human diclofenac decreases expression ISO RGD:2411 6480464 Diclofenac results in decreased expression of CRP protein CTD PMID:25772430 CRP Human dienogest multiple interactions EXP 6480464 [Estradiol co-treated with dienogest] results in increased expression of CRP protein CTD PMID:15970291 CRP Human diethyl phthalate multiple interactions ISO RGD:10398 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated more ... CTD PMID:38954831 CRP Human diisobutyl phthalate multiple interactions ISO RGD:10398 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated more ... CTD PMID:38954831 CRP Human diisononyl phthalate multiple interactions ISO RGD:10398 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated more ... CTD PMID:38954831 CRP Human diisononyl phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated more ... CTD PMID:32949613 CRP Human dimethoate increases expression ISO RGD:2411 6480464 Dimethoate results in increased expression of CRP protein CTD PMID:39419344 CRP Human dimethoate multiple interactions ISO RGD:2411 6480464 [Chlorpyrifos co-treated with Dimethoate] results in increased expression of CRP protein CTD PMID:39419344 CRP Human disodium selenite affects expression EXP 6480464 Sodium Selenite affects the expression of CRP protein CTD PMID:12867288 CRP Human disodium selenite multiple interactions ISO RGD:2411 6480464 Sodium Selenite inhibits the reaction [bisphenol A results in increased secretion of CRP protein] CTD PMID:33847390 CRP Human doxazosin decreases expression EXP 6480464 Doxazosin results in decreased expression of CRP protein CTD PMID:16680063 CRP Human elemental boron multiple interactions ISO RGD:2411 6480464 Boron inhibits the reaction [Dietary Fats results in increased expression of CRP mRNA] CTD PMID:36419211 CRP Human endosulfan decreases expression ISO RGD:2411 6480464 Endosulfan results in decreased expression of CRP mRNA CTD PMID:29391264 CRP Human epoxiconazole increases expression ISO RGD:10398 6480464 epoxiconazole results in increased expression of CRP mRNA CTD PMID:22334560 CRP Human eptifibatide increases expression EXP 6480464 eptifibatide results in increased expression of CRP protein CTD PMID:16391376 CRP Human erythromycin A multiple interactions ISO RGD:10398 6480464 [Penicillin G co-treated with Erythromycin] results in increased expression of CRP mRNA CTD PMID:27503388 CRP Human erythromycin A increases expression ISO RGD:10398 6480464 Erythromycin results in increased expression of CRP mRNA CTD PMID:27503388 CRP Human ethanol increases expression EXP 6480464 Ethanol results in increased expression of CRP protein CTD PMID:27989594 CRP Human ethanol multiple interactions EXP 6480464 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide promotes the reaction [Ethanol results in increased expression of CRP protein]; salvianolic acid B more ... CTD PMID:27989594 CRP Human ethanol multiple interactions ISO RGD:2411 6480464 salvianolic acid B inhibits the reaction [Ethanol results in increased expression of CRP mRNA]; salvianolic more ... CTD PMID:27989594 CRP Human ethanol increases expression ISO RGD:2411 6480464 Ethanol results in increased expression of CRP mRNA; Ethanol results in increased expression of CRP more ... CTD PMID:27989594 CRP Human ezetimibe multiple interactions EXP 6480464 [Ezetimibe co-treated with Simvastatin] results in decreased expression of CRP protein; [Simvastatin co-treated with Ezetimibe] more ... CTD PMID:18420099|PMID:20152243 CRP Human fenofibrate multiple interactions EXP 6480464 candesartan promotes the reaction [Fenofibrate results in decreased expression of CRP protein]; Fenofibrate promotes the more ... CTD PMID:16443859 CRP Human fenofibrate decreases expression EXP 6480464 Fenofibrate results in decreased expression of CRP protein CTD PMID:16123850|PMID:16443859 CRP Human flucloxacillin multiple interactions EXP 6480464 [Floxacillin co-treated with Gentamicins co-treated with Rifampin] results in increased expression of CRP protein CTD PMID:16943303 CRP Human flunitrazepam multiple interactions EXP 6480464 [bromperidol co-treated with Flunitrazepam] results in increased expression of CRP protein CTD PMID:15298663 CRP Human flutamide increases expression ISO RGD:2411 6480464 Flutamide results in increased expression of CRP mRNA CTD PMID:24793618 CRP Human folic acid multiple interactions EXP 6480464 [Eicosapentaenoic Acid co-treated with Docosahexaenoic Acids co-treated with Oleic Acid co-treated with Folic Acid co-treated more ... CTD PMID:16517955|PMID:17237316 CRP Human folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of CRP protein CTD PMID:16491109 CRP Human fosfomycin decreases expression EXP 6480464 Fosfomycin results in decreased expression of CRP protein CTD PMID:12680319 CRP Human fructose multiple interactions ISO RGD:2411 6480464 [Dietary Fats co-treated with Fructose] results in increased expression of CRP mRNA; Curcumin inhibits the more ... CTD PMID:19632207|PMID:25108154|PMID:26713546 CRP Human fructose increases expression ISO RGD:10398 6480464 Fructose results in increased expression of CRP protein CTD PMID:31672515 CRP Human fructose increases expression ISO RGD:2411 6480464 Fructose results in increased expression of CRP protein CTD PMID:25108154|PMID:26713546 CRP Human fumonisin B1 decreases expression ISO RGD:10398 6480464 fumonisin B1 results in decreased expression of CRP mRNA CTD PMID:16221962 CRP Human furan increases methylation ISO RGD:2411 6480464 furan results in increased methylation of CRP gene CTD PMID:22079235 CRP Human furan decreases expression ISO RGD:2411 6480464 furan results in decreased expression of CRP mRNA CTD PMID:15120968|PMID:25539665 CRP Human gamma-tocopherol multiple interactions EXP 6480464 [alpha-Tocopherol co-treated with gamma-Tocopherol] results in decreased expression of CRP protein CTD PMID:18191645 CRP Human genistein multiple interactions EXP 6480464 [Genistein co-treated with daidzein] results in decreased expression of CRP protein CTD PMID:16332659 CRP Human genistein increases expression ISO RGD:2411 6480464 Genistein results in increased expression of CRP mRNA; Genistein results in increased expression of CRP more ... CTD PMID:20838740 CRP Human gentamycin multiple interactions EXP 6480464 [Floxacillin co-treated with Gentamicins co-treated with Rifampin] results in increased expression of CRP protein CTD PMID:16943303 CRP Human gentamycin decreases expression ISO RGD:2411 6480464 Gentamicins results in decreased expression of CRP mRNA CTD PMID:33387578 CRP Human geraniol multiple interactions ISO RGD:2411 6480464 geraniol inhibits the reaction [Isoproterenol results in increased expression of CRP protein] CTD PMID:35608392 CRP Human gestodene multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with Gestodene] results in increased expression of CRP protein CTD PMID:12616983 CRP Human ginsenoside Re increases expression ISO RGD:2411 6480464 ginsenoside Re results in increased expression of CRP protein CTD PMID:16797897 CRP Human gossypin multiple interactions ISO RGD:2411 6480464 gossypin inhibits the reaction [Lipopolysaccharides results in increased expression of CRP protein] CTD PMID:37148149 CRP Human heparin increases expression EXP 6480464 Heparin results in increased expression of CRP protein CTD PMID:16391376 CRP Human indinavir decreases expression EXP 6480464 Indinavir results in decreased expression of CRP protein CTD PMID:15622323 CRP Human indometacin multiple interactions ISO RGD:2411 6480464 Indomethacin inhibits the reaction [Carrageenan results in increased expression of CRP protein]; Indomethacin inhibits the more ... CTD PMID:34789018|PMID:35446470 CRP Human iron(2+) sulfate (anhydrous) decreases expression EXP 6480464 ferrous sulfate results in decreased expression of CRP mRNA; ferrous sulfate results in decreased expression more ... CTD PMID:17119383|PMID:19428942 CRP Human iron(III) citrate increases expression EXP 6480464 ferric citrate results in increased expression of CRP mRNA CTD PMID:29959986 CRP Human isoprenaline increases expression ISO RGD:2411 6480464 Isoproterenol results in increased expression of CRP protein CTD PMID:35608392|PMID:38439645 CRP Human isoprenaline multiple interactions ISO RGD:2411 6480464 benidipine inhibits the reaction [Isoproterenol results in increased expression of and results in increased secretion more ... CTD PMID:25269373|PMID:35608392|PMID:38439645 CRP Human ivermectin increases expression EXP 6480464 Ivermectin results in increased expression of CRP protein CTD PMID:8555762 CRP Human kaempferol decreases expression EXP 6480464 kaempferol results in decreased expression of CRP mRNA; kaempferol results in decreased expression of CRP more ... CTD PMID:17184768 CRP Human L-arginine multiple interactions ISO RGD:2411 6480464 Carvedilol inhibits the reaction [Arginine results in increased expression of CRP protein] CTD PMID:32569593 CRP Human L-arginine increases expression ISO RGD:2411 6480464 Arginine results in increased expression of CRP protein CTD PMID:32569593 CRP Human L-ascorbic acid multiple interactions EXP 6480464 [Vitamin E co-treated with Ascorbic Acid co-treated with Folic Acid co-treated with Riboflavin co-treated with more ... CTD PMID:16517955 CRP Human lead diacetate multiple interactions ISO RGD:2411 6480464 Curcumin inhibits the reaction [lead acetate results in increased secretion of CRP protein] CTD PMID:21378372 CRP Human lead diacetate increases secretion ISO RGD:2411 6480464 lead acetate results in increased secretion of CRP protein CTD PMID:21378372 CRP Human lead nitrate multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated more ... CTD PMID:32949613 CRP Human lead(0) increases expression EXP 6480464 Lead results in increased expression of CRP protein CTD PMID:23484121 CRP Human lead(0) multiple interactions EXP 6480464 [GSTM1 gene mutant form co-treated with GSTT1 gene mutant form] promotes the reaction [Lead results more ... CTD PMID:23484121 CRP Human levonorgestrel multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with Levonorgestrel] results in increased expression of CRP protein CTD PMID:15769986 CRP Human lipoic acid multiple interactions ISO RGD:2411 6480464 Cyclosporine inhibits the reaction [Thioctic Acid inhibits the reaction [Acetic Acid results in increased expression more ... CTD PMID:26276312 CRP Human lipopolysaccharide multiple interactions EXP 6480464 Atorvastatin inhibits the reaction [Lipopolysaccharides results in increased expression of CRP mRNA]; Atorvastatin inhibits the more ... CTD PMID:15824212|PMID:21584495 CRP Human lipopolysaccharide multiple interactions ISO RGD:2411 6480464 gossypin inhibits the reaction [Lipopolysaccharides results in increased expression of CRP protein] CTD PMID:37148149 CRP Human lipopolysaccharide multiple interactions ISO RGD:10398 6480464 [Lipopolysaccharides co-treated with IL10 protein] results in increased expression of CRP protein; [TLR4 protein co-treated more ... CTD PMID:37177863 CRP Human lipopolysaccharide increases expression ISO RGD:2411 6480464 Lipopolysaccharides results in increased expression of CRP protein CTD PMID:37148149 CRP Human lipopolysaccharide increases expression ISO RGD:10398 6480464 Lipopolysaccharides results in increased expression of CRP mRNA; Lipopolysaccharides results in increased expression of CRP more ... CTD PMID:12057914|PMID:17321000|PMID:37177863 CRP Human lipopolysaccharide decreases expression ISO RGD:10398 6480464 Lipopolysaccharides results in decreased expression of CRP mRNA CTD PMID:12057914 CRP Human lipopolysaccharide increases secretion EXP 6480464 Lipopolysaccharides results in increased secretion of CRP protein CTD PMID:19675143 CRP Human lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of CRP mRNA; Lipopolysaccharides results in increased expression of CRP more ... CTD PMID:15824212|PMID:20699433|PMID:21584495 CRP Human losartan multiple interactions ISO RGD:2411 6480464 Dexamethasone promotes the reaction [Losartan inhibits the reaction [Tobacco Smoke Pollution results in increased expression more ... CTD PMID:32812458 CRP Human lovastatin multiple interactions ISO RGD:2411 6480464 Lovastatin inhibits the reaction [Cholesterol, Dietary results in increased expression of CRP protein] CTD PMID:35734936 CRP Human lupeol multiple interactions ISO RGD:2411 6480464 lupeol inhibits the reaction [COL2A1 results in increased secretion of CRP protein] CTD PMID:35446470 CRP Human medroxyprogesterone acetate multiple interactions EXP 6480464 [Estrogens, Conjugated (USP) co-treated with Medroxyprogesterone Acetate] results in increased expression of CRP protein CTD PMID:15990257|PMID:17882670 CRP Human mercury atom multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated more ... CTD PMID:32949613 CRP Human mercury(0) multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated more ... CTD PMID:32949613 CRP Human Mesaconitine increases expression ISO RGD:2411 6480464 mesaconitine results in increased expression of CRP protein CTD PMID:37182599 CRP Human metformin decreases expression EXP 6480464 Metformin results in decreased expression of CRP protein CTD PMID:14557435 CRP Human metformin multiple interactions ISO RGD:2411 6480464 Metformin inhibits the reaction [Fructose results in increased expression of CRP protein] CTD PMID:25108154 CRP Human methotrexate increases expression ISO RGD:10398 6480464 Methotrexate results in increased expression of CRP protein CTD PMID:33845614 CRP Human methotrexate multiple interactions ISO RGD:10398 6480464 Apigenin inhibits the reaction [Methotrexate results in increased expression of CRP protein] CTD PMID:33845614 CRP Human mevalonic acid multiple interactions EXP 6480464 Mevalonic Acid inhibits the reaction [Simvastatin inhibits the reaction [CRP results in increased expression of more ... CTD PMID:18023360 CRP Human milrinone decreases expression EXP 6480464 Milrinone results in decreased expression of CRP protein CTD PMID:11772795 CRP Human mono(2-ethyl-5-hydroxyhexyl) phthalate decreases expression EXP 6480464 mono(2-ethyl-5-hydroxyhexyl) phthalate results in decreased expression of CRP protein CTD PMID:21349512 CRP Human mono(2-ethyl-5-oxohexyl) phthalate decreases expression EXP 6480464 mono(2-ethyl-5-oxohexyl)phthalate results in decreased expression of CRP mRNA; mono(2-ethyl-5-oxohexyl)phthalate results in decreased expression of CRP more ... CTD PMID:21349512|PMID:32015430 CRP Human monobenzyl phthalate increases expression EXP 6480464 mono-benzyl phthalate results in increased expression of CRP protein CTD PMID:21349512 CRP Human Monobutylphthalate increases expression EXP 6480464 monobutyl phthalate results in increased expression of CRP mRNA CTD PMID:32015430 CRP Human morphine increases expression EXP 6480464 Morphine results in increased expression of CRP protein CTD PMID:18980684 CRP Human myricitrin multiple interactions ISO RGD:10398 6480464 myricitrin inhibits the reaction [APOE gene mutant form results in increased expression of CRP protein] CTD PMID:23639522 CRP Human N-nitrosodiethylamine multiple interactions ISO RGD:2411 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of CRP mRNA; [Diethylnitrosamine co-treated with Thioacetamide] more ... CTD PMID:17602206|PMID:28943392 CRP Human N-nitrosodimethylamine decreases expression ISO RGD:2411 6480464 Dimethylnitrosamine results in decreased expression of CRP protein CTD PMID:17719030 CRP Human N-Nitrosopyrrolidine decreases expression EXP 6480464 N-Nitrosopyrrolidine results in decreased expression of CRP mRNA CTD PMID:32234424 CRP Human neoechinulin A increases expression ISO RGD:10398 6480464 neoechinulin A results in increased expression of CRP mRNA CTD PMID:19818335 CRP Human nickel atom multiple interactions EXP 6480464 [nickel chloride results in increased abundance of Nickel] which results in increased expression of CRP more ... CTD PMID:31943712 CRP Human nickel dichloride multiple interactions EXP 6480464 [nickel chloride results in increased abundance of Nickel] which results in increased expression of CRP more ... CTD PMID:31943712 CRP Human nicotinic acid multiple interactions EXP 6480464 [resveratrol co-treated with pterostilbene co-treated with Quercetin co-treated with tocotrienol, delta co-treated with Niacin] results more ... CTD PMID:18420099|PMID:24319627 CRP Human nicotinic acid multiple interactions ISO RGD:10398 6480464 [Curcumin co-treated with Niacin co-treated with ZM 241385] inhibits the reaction [Rotenone results in increased more ... CTD PMID:31820278 CRP Human nicotinic acid decreases expression EXP 6480464 Niacin results in decreased expression of CRP protein CTD PMID:16950175|PMID:18420099 CRP Human nitrofen increases expression ISO RGD:2411 6480464 nitrofen results in increased expression of CRP mRNA CTD PMID:33484710 CRP Human nitrogen dioxide increases expression EXP 6480464 Nitrogen Dioxide results in increased expression of CRP protein CTD PMID:18629312|PMID:22306530 CRP Human nomegestrol multiple interactions EXP 6480464 nomegestrol inhibits the reaction [Estrogens, Conjugated (USP) results in increased expression of CRP protein] CTD PMID:17882670 CRP Human nomegestrol acetate multiple interactions EXP 6480464 [Estrogens, Conjugated (USP) co-treated with nomegestrol acetate] results in decreased expression of CRP protein CTD PMID:15990257 CRP Human Nonidet P-40 increases expression EXP 6480464 Nonidet P-40 results in increased expression of CRP mRNA CTD PMID:26552463 CRP Human norgestimate multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with norgestimate] results in increased expression of CRP protein CTD PMID:16982228 CRP Human O-methyleugenol decreases expression EXP 6480464 methyleugenol results in decreased expression of CRP mRNA CTD PMID:32234424 CRP Human obeticholic acid decreases expression EXP 6480464 obeticholic acid results in decreased expression of CRP mRNA CTD PMID:27939613 CRP Human okadaic acid decreases expression EXP 6480464 Okadaic Acid results in decreased expression of CRP mRNA CTD PMID:38832940 CRP Human oleic acid multiple interactions EXP 6480464 [Eicosapentaenoic Acid co-treated with Docosahexaenoic Acids co-treated with Oleic Acid co-treated with Folic Acid co-treated more ... CTD PMID:17237316 CRP Human olmesartan decreases expression EXP 6480464 olmesartan results in decreased expression of CRP protein CTD PMID:18360012 CRP Human Olmesartan medoxomil multiple interactions ISO RGD:2411 6480464 Olmesartan Medoxomil inhibits the reaction [Acetic Acid results in increased expression of CRP protein] CTD PMID:30594690 CRP Human ozone multiple interactions ISO RGD:2411 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of CRP more ... CTD PMID:33317425 CRP Human p-menthan-3-ol multiple interactions ISO RGD:2411 6480464 [Tobacco Smoke Pollution co-treated with Menthol] results in increased expression of and results in increased more ... CTD PMID:27818348 CRP Human pamidronate decreases expression EXP 6480464 pamidronate results in decreased expression of CRP protein CTD PMID:11683535 CRP Human pamidronate increases expression EXP 6480464 pamidronate results in increased expression of CRP protein CTD PMID:9351880 CRP Human paracetamol increases expression ISO RGD:10398 6480464 Acetaminophen results in increased expression of CRP protein CTD PMID:19799668 CRP Human paracetamol decreases expression ISO RGD:2411 6480464 Acetaminophen results in decreased expression of CRP mRNA CTD PMID:33387578 CRP Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CRP mRNA CTD PMID:29067470 CRP Human paracetamol increases secretion ISO RGD:10398 6480464 Acetaminophen results in increased secretion of CRP protein CTD PMID:27866976 CRP Human paracetamol multiple interactions ISO RGD:10398 6480464 Carnosine inhibits the reaction [Acetaminophen results in increased expression of CRP protein]; rosiglitazone inhibits the more ... CTD PMID:19799668|PMID:27866976 CRP Human Pentoxifylline decreases expression EXP 6480464 Pentoxifylline results in decreased expression of CRP protein CTD PMID:14970111 CRP Human perfluorobutanesulfonic acid increases expression EXP 6480464 perfluorobutanesulfonic acid results in increased expression of CRP mRNA CTD PMID:33772556 CRP Human perfluorononanoic acid decreases expression EXP 6480464 perfluoro-n-nonanoic acid results in decreased expression of CRP mRNA CTD PMID:32588087 CRP Human perfluorooctane-1-sulfonic acid affects expression ISO RGD:10398 6480464 perfluorooctane sulfonic acid affects the expression of CRP mRNA CTD PMID:19429403 CRP Human perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of CRP mRNA CTD PMID:33772556 CRP Human perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:10398 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CRP mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 CRP Human perfluorooctane-1-sulfonic acid decreases expression ISO RGD:10398 6480464 perfluorooctane sulfonic acid results in decreased expression of CRP mRNA CTD PMID:20936131 CRP Human perfluorooctanoic acid affects expression ISO RGD:10398 6480464 perfluorooctanoic acid affects the expression of CRP mRNA CTD PMID:19429403 CRP Human perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of CRP mRNA CTD PMID:33772556 CRP Human perfluorooctanoic acid increases expression ISO RGD:10398 6480464 perfluorooctanoic acid results in increased expression of CRP protein CTD PMID:26054880 CRP Human perfluorooctanoic acid multiple interactions ISO RGD:10398 6480464 Quercetin inhibits the reaction [perfluorooctanoic acid results in increased expression of CRP protein] CTD PMID:26054880 CRP Human permethrin multiple interactions ISO RGD:2411 6480464 Dietary Fats promotes the reaction [Permethrin results in increased expression of CRP protein] CTD PMID:34224971 CRP Human permethrin increases expression ISO RGD:2411 6480464 Permethrin results in increased expression of CRP protein CTD PMID:34224971 CRP Human phenethyl caffeate multiple interactions ISO RGD:2411 6480464 caffeic acid phenethyl ester inhibits the reaction [Carrageenan results in increased expression of CRP protein] CTD PMID:34789018 CRP Human phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of CRP mRNA CTD PMID:19084549 CRP Human phorbol 13-acetate 12-myristate multiple interactions ISO RGD:2411 6480464 CRP protein inhibits the reaction [Tetradecanoylphorbol Acetate results in increased abundance of Superoxides] CTD PMID:9767445 CRP Human phosphatidylcholine decreases activity EXP 6480464 Phosphatidylcholines results in decreased activity of CRP protein CTD PMID:16962105 CRP Human phosphatidylcholine affects binding EXP 6480464 CRP protein binds to Phosphatidylcholines CTD PMID:16962105 CRP Human pioglitazone affects expression ISO RGD:2411 6480464 pioglitazone affects the expression of CRP protein CTD PMID:28744220 CRP Human pioglitazone decreases expression EXP 6480464 Pioglitazone results in decreased expression of CRP protein CTD PMID:28705172 CRP Human pirinixic acid multiple interactions ISO RGD:10398 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:17321000|PMID:19710929 CRP Human pirinixic acid decreases expression ISO RGD:10398 6480464 pirinixic acid results in decreased expression of CRP mRNA CTD PMID:16221962|PMID:17321000|PMID:18445702|PMID:23811191 CRP Human pravastatin increases expression ISO RGD:2411 6480464 Pravastatin results in increased expression of CRP mRNA CTD PMID:27225895 CRP Human pravastatin decreases expression ISO RGD:10398 6480464 Pravastatin results in decreased expression of CRP mRNA CTD PMID:27225895 CRP Human pregnenolone 16alpha-carbonitrile increases expression ISO RGD:10398 6480464 Pregnenolone Carbonitrile results in increased expression of CRP mRNA CTD PMID:28903501 CRP Human propiconazole increases expression ISO RGD:10398 6480464 propiconazole results in increased expression of CRP mRNA CTD PMID:22334560 CRP Human pterostilbene multiple interactions EXP 6480464 [resveratrol co-treated with pterostilbene co-treated with Quercetin co-treated with tocotrienol, delta co-treated with Niacin] results more ... CTD PMID:24319627 CRP Human quercetin multiple interactions EXP 6480464 [resveratrol co-treated with pterostilbene co-treated with Quercetin co-treated with tocotrienol, delta co-treated with Niacin] results more ... CTD PMID:17388968|PMID:21601209|PMID:24319627 CRP Human quercetin multiple interactions ISO RGD:10398 6480464 Quercetin inhibits the reaction [perfluorooctanoic acid results in increased expression of CRP protein] CTD PMID:26054880 CRP Human quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of CRP mRNA; Quercetin results in decreased expression of CRP more ... CTD PMID:17184768 CRP Human resveratrol multiple interactions EXP 6480464 [Resveratrol co-treated with pterostilbene co-treated with Quercetin co-treated with tocotrienol, delta co-treated with Niacin] results more ... CTD PMID:17388968|PMID:24319627|PMID:31943712 CRP Human resveratrol decreases expression ISO RGD:2411 6480464 resveratrol results in decreased expression of CRP protein CTD PMID:24012391 CRP Human resveratrol multiple interactions ISO RGD:2411 6480464 resveratrol inhibits the reaction [Fructose results in increased expression of CRP protein] CTD PMID:25108154 CRP Human resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of CRP CTD PMID:23298135 CRP Human riboflavin multiple interactions EXP 6480464 [Folic Acid co-treated with Riboflavin co-treated with Vitamin B 6 co-treated with Vitamin B 12] more ... CTD PMID:16517955 CRP Human rifampicin multiple interactions EXP 6480464 [Floxacillin co-treated with Gentamicins co-treated with Rifampin] results in increased expression of CRP protein CTD PMID:16943303 CRP Human rifamycin SV affects expression EXP 6480464 rifamycin SV affects the expression of CRP protein CTD PMID:1568518 CRP Human rivastigmine multiple interactions ISO RGD:2411 6480464 Rivastigmine inhibits the reaction [Botulinum Toxins, Type A results in increased expression of CRP protein] CTD PMID:29739252 CRP Human rosmarinic acid multiple interactions ISO RGD:2411 6480464 2-chloro-5-nitrobenzanilide inhibits the reaction [Rosmarinic Acid affects the expression of CRP protein]; T 0070907 inhibits more ... CTD PMID:28744220 CRP Human rosmarinic acid affects expression ISO RGD:2411 6480464 Rosmarinic Acid affects the expression of CRP protein CTD PMID:28744220 CRP Human rosuvastatin calcium multiple interactions EXP 6480464 Rosuvastatin Calcium inhibits the reaction [CRP protein results in decreased expression of NOS3] CTD PMID:21562509 CRP Human rotenone multiple interactions ISO RGD:10398 6480464 [Curcumin co-treated with Niacin co-treated with ZM 241385] inhibits the reaction [Rotenone results in increased more ... CTD PMID:31820278 CRP Human rotenone increases expression ISO RGD:10398 6480464 Rotenone results in increased expression of CRP protein CTD PMID:31820278 CRP Human salvianolic acid B multiple interactions EXP 6480464 salvianolic acid B inhibits the reaction [Ethanol results in increased expression of CRP protein]; SIRT1 more ... CTD PMID:27989594 CRP Human salvianolic acid B multiple interactions ISO RGD:2411 6480464 salvianolic acid B inhibits the reaction [Ethanol results in increased expression of CRP mRNA]; salvianolic more ... CTD PMID:27989594 CRP Human salvianolic acid B decreases expression EXP 6480464 salvianolic acid B results in decreased expression of CRP protein CTD PMID:27989594 CRP Human SB 203580 multiple interactions EXP 6480464 SB 203580 inhibits the reaction [[IL1B protein co-treated with IL6 protein] results in increased expression more ... CTD PMID:17388968 CRP Human simvastatin multiple interactions EXP 6480464 [Ezetimibe co-treated with Simvastatin] results in decreased expression of CRP protein; [Simvastatin co-treated with Ezetimibe] more ... CTD PMID:15824212|PMID:17105841|PMID:18023360|PMID:18420099|PMID:20152243 CRP Human simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of CRP protein CTD PMID:15184351 CRP Human sodium arsenite decreases expression ISO RGD:10398 6480464 sodium arsenite results in decreased expression of CRP mRNA CTD PMID:21911445 CRP Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of CRP mRNA CTD PMID:29301061 CRP Human sodium arsenite multiple interactions ISO RGD:2411 6480464 Atorvastatin inhibits the reaction [sodium arsenite results in increased expression of CRP protein] CTD PMID:25058445 CRP Human sodium arsenite increases expression ISO RGD:10398 6480464 sodium arsenite results in increased expression of CRP protein CTD PMID:22521605 CRP Human sodium arsenite increases expression ISO RGD:2411 6480464 sodium arsenite results in increased expression of CRP protein CTD PMID:25058445 CRP Human sodium arsenite multiple interactions EXP 6480464 sodium arsenite results in increased expression of and results in increased secretion of CRP protein CTD PMID:22521605 CRP Human sodium nitrite increases expression ISO RGD:2411 6480464 Sodium Nitrite results in increased expression of CRP protein CTD PMID:28266762|PMID:28833918 CRP Human sodium nitrite multiple interactions ISO RGD:2411 6480464 Carnosine inhibits the reaction [Sodium Nitrite results in increased expression of CRP protein] CTD PMID:28266762|PMID:28833918 CRP Human sterigmatocystin increases expression ISO RGD:10398 6480464 Sterigmatocystin results in increased expression of CRP mRNA CTD PMID:19818335 CRP Human streptozocin multiple interactions ISO RGD:10398 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of CRP protein; Diethylhexyl Phthalate promotes more ... CTD PMID:33484791 CRP Human superoxide multiple interactions ISO RGD:2411 6480464 CRP protein inhibits the reaction [Tetradecanoylphorbol Acetate results in increased abundance of Superoxides] CTD PMID:9767445 CRP Human telmisartan decreases expression EXP 6480464 telmisartan results in decreased expression of CRP protein CTD PMID:20555330 CRP Human testosterone decreases expression EXP 6480464 Testosterone results in decreased expression of CRP mRNA CTD PMID:33359661 CRP Human tetrachloromethane decreases expression ISO RGD:2411 6480464 Carbon Tetrachloride results in decreased expression of CRP mRNA CTD PMID:31150632 CRP Human thalidomide decreases expression EXP 6480464 Thalidomide results in decreased expression of CRP protein CTD PMID:11339241 CRP Human thioacetamide multiple interactions ISO RGD:2411 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of CRP mRNA CTD PMID:28943392 CRP Human thioacetamide decreases expression ISO RGD:2411 6480464 Thioacetamide results in decreased expression of CRP mRNA CTD PMID:34492290 CRP Human tibolone increases expression EXP 6480464 tibolone results in increased expression of CRP protein CTD PMID:17882670 CRP Human titanium dioxide increases expression ISO RGD:10398 6480464 titanium dioxide results in increased expression of CRP mRNA; titanium dioxide results in increased expression more ... CTD PMID:21259345|PMID:30626778 CRP Human titanium dioxide multiple interactions ISO RGD:10398 6480464 Vitamin E inhibits the reaction [titanium dioxide results in increased expression of CRP protein] CTD PMID:30626778 CRP Human TMC-120A decreases expression ISO RGD:10398 6480464 TMC 120A results in decreased expression of CRP mRNA CTD PMID:19818335 CRP Human triadimefon increases expression ISO RGD:10398 6480464 triadimefon results in increased expression of CRP mRNA CTD PMID:19363144 CRP Human trichloroethene decreases expression ISO RGD:2411 6480464 Trichloroethylene results in decreased expression of CRP mRNA CTD PMID:33387578 CRP Human Triptolide decreases expression ISO RGD:10398 6480464 triptolide results in decreased expression of CRP mRNA CTD PMID:32835833 CRP Human Triptolide increases expression ISO RGD:2411 6480464 triptolide results in increased expression of CRP protein CTD PMID:32519852 CRP Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of CRP mRNA CTD PMID:29154799 CRP Human valproic acid increases expression ISO RGD:2411 6480464 Valproic Acid results in increased expression of CRP mRNA CTD PMID:35594946 CRP Human vancomycin decreases expression EXP 6480464 Vancomycin results in decreased expression of CRP protein CTD PMID:12680319 CRP Human vitamin E decreases expression EXP 6480464 Vitamin E results in decreased expression of CRP protein CTD PMID:20370442 CRP Human vitamin E multiple interactions ISO RGD:10398 6480464 Vitamin E inhibits the reaction [titanium dioxide results in increased expression of CRP protein] CTD PMID:30626778 CRP Human vitamin E multiple interactions EXP 6480464 [Eicosapentaenoic Acid co-treated with Docosahexaenoic Acids co-treated with Oleic Acid co-treated with Folic Acid co-treated more ... CTD PMID:16517955|PMID:17237316 CRP Human withaferin A multiple interactions ISO RGD:2411 6480464 withaferin A inhibits the reaction [Cholesterol, Dietary results in increased expression of CRP protein] CTD PMID:35734936 CRP Human wortmannin multiple interactions EXP 6480464 wortmannin inhibits the reaction [Dust analog results in increased expression of CRP mRNA]; wortmannin inhibits more ... CTD PMID:16263508 CRP Human zaragozic acid A affects expression ISO RGD:10398 6480464 squalestatin 1 affects the expression of CRP mRNA CTD PMID:27225895 CRP Human zaragozic acid A increases expression ISO RGD:2411 6480464 squalestatin 1 results in increased expression of CRP mRNA CTD PMID:27225895 CRP Human zinc atom affects expression ISO RGD:10398 6480464 Zinc affects the expression of CRP protein CTD PMID:17018878 CRP Human zinc atom multiple interactions EXP 6480464 [Zinc co-treated with Aluminum] results in increased expression of CRP protein; [Zinc co-treated with Copper more ... CTD PMID:27816692 CRP Human zinc atom decreases expression EXP 6480464 Zinc results in decreased expression of CRP protein CTD PMID:20427734 CRP Human zinc dichloride increases expression EXP 6480464 zinc chloride results in increased expression of CRP mRNA CTD PMID:19428942 CRP Human zinc(0) affects expression ISO RGD:10398 6480464 Zinc affects the expression of CRP protein CTD PMID:17018878 CRP Human zinc(0) decreases expression EXP 6480464 Zinc results in decreased expression of CRP protein CTD PMID:20427734 CRP Human zinc(0) multiple interactions EXP 6480464 [Zinc co-treated with Aluminum] results in increased expression of CRP protein; [Zinc co-treated with Copper more ... CTD PMID:27816692
Imported Annotations - PID (archival)
abdominal aortic aneurysm (IEP) Acute Coronary Syndrome (EXP,IDA,IEP) acute kidney failure (IDA,ISO) acute stress disorder (IEP) Acute Uveitis (IEP,ISO) aggressive periodontitis (IEP) Albuminuria (IEP) alcoholic liver cirrhosis (IEP) Alzheimer's disease (ISO) ankylosing spondylitis (IEP) antiphospholipid syndrome (IDA) anxiety disorder (EXP,IEP) Arsenic Poisoning (EXP) arthritis (IAGP) aspergillosis (IEP) asthma (IEP) atherosclerosis (EXP,IEP) atrial fibrillation (IEP) autoimmune interstitial lung, joint, and kidney disease (IAGP) Bacteremia (IEP) bacterial infectious disease (IEP) bacterial meningitis (IEP) Behcet's disease (IEP) Brain Hypoxia-Ischemia (IDA) Brain Injuries (IEP) breast cancer (IEP) breast carcinoma (IEP) bronchiolitis (IEP) Burns (ISO) Cardiac Arrhythmias (IEP) cardiovascular system disease (EXP,IEP,TAS) cerebrovascular disease (EXP) Chemical and Drug Induced Liver Injury (EXP) Chronic Hepatitis C (IDA) chronic obstructive pulmonary disease (EXP,IEP) colon cancer (ISO) congestive heart failure (EXP) Contrast-Induced Nephropathy (IDA) coronary artery disease (EXP,IEP) COVID-19 (EXP,IEP) Crohn's disease (EXP,IEP) depressive disorder (IEP) Diabetic Foot (IEP) Diabetic Nephropathies (IDA,IEP) diabetic retinopathy (EXP,IEP) disease by infectious agent (EXP) disease of metabolism (EXP) Drug Hypersensitivity Syndrome (EXP) end stage renal disease (EXP,IEP) Experimental Arthritis (EXP) Experimental Diabetes Mellitus (ISO) Experimental Liver Cirrhosis (ISO) familial hyperlipidemia (ISO) Fever of Unknown Origin (IEP) gastrointestinal stromal tumor (IAGP) heart disease (EXP,IDA) hepatocellular carcinoma (EXP) human immunodeficiency virus infectious disease (IDA) Human Influenza (IEP) hypertension (EXP,IDA,IEP,ISO) hypertensive retinopathy (IEP) Hypertriglyceridemia (EXP) Hypoxia (IEP) Inflammation (EXP,IAGP,ISO) inflammatory bowel disease (IDA) intermediate coronary syndrome (IEP) interstitial cystitis (IEP) interstitial nephritis (EXP,IMP,ISO) Intestinal Reperfusion Injury (ISO) iron deficiency anemia (ISO) juvenile rheumatoid arthritis (IEP) Kawasaki disease (IAGP) kidney failure (IEP) Kuhnt-Junius degeneration (IAGP,IEP) Left Ventricular Hypertrophy (IEP) leishmaniasis (EXP) liver cirrhosis (IEP) low tension glaucoma (IEP) Lung Neoplasms (EXP) lupus nephritis (IAGP,IDA) Lymphatic Metastasis (IAGP) lymphopenia (IAGP) macular degeneration (IDA,IEP) malaria (EXP) mastoiditis (IEP) meningitis (EXP) metabolic dysfunction and alcohol associated liver disease (ISO) Metabolic Syndrome (EXP,IMP) mevalonic aciduria (IEP) middle cerebral artery infarction (IDA) mouth disease (ISO) Mycoplasma pneumoniae pneumonia (IEP) myocardial infarction (IEP,ISO) Myocardial Ischemia (EXP,ISO) Myocardial Reperfusion Injury (ISO) myocarditis (EXP) Neonatal Sepsis (ISO) non-arteritic anterior ischemic optic neuropathy (IEP) obesity (EXP,IEP,ISO) obstructive sleep apnea (IDA) opiate dependence (IEP) otitis externa (IEP) otitis media (IEP) overactive bladder syndrome (IEP) parathyroid carcinoma (IAGP) Parkinson's disease (IEP) Pasteurellaceae Infections (EXP) pelvic inflammatory disease (IEP) periodontitis (EXP) pharyngoconjunctival fever (IEP) Pneumococcal Pneumonia (IEP) pneumonia (IEP) polymyalgia rheumatica (IEP) Polypoidal Choroidal Vasculopathy (IEP) Postoperative Atrial Fibrillation (IEP) Pseudomonas Infections (IDA,ISO) psoriasis (EXP,IEP) pulmonary hypertension (IEP) pulmonary sarcoidosis (IEP) pulmonary tuberculosis (IEP) pyelonephritis (ISO) renal cell carcinoma (IEP) Renal Colic (IDA) renal fibrosis (IMP,ISO) renal hypertension (ISO) retinal vein occlusion (IEP) rheumatoid arthritis (EXP,IEP,ISO) secondary hyperparathyroidism (EXP) Sepsis (IEP,ISO) Serositis (IAGP) Sjogren's syndrome (IEP) Spinal Cord Injuries (ISO) status epilepticus (ISO) Stevens-Johnson syndrome (EXP) systemic lupus erythematosus (EXP,IDA) temporal arteritis (IEP) thrombosis (EXP) Tubulointerstitial Nephritis and Uveitis (IEP) type 1 diabetes mellitus (EXP,IEP) type 2 diabetes mellitus (IEP) urticaria (IEP) uveal melanoma (IEP) vestibular neuronitis (IEP) visceral leishmaniasis (EXP) withdrawal disorder (EXP)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) (4Z,7Z,10Z,13Z,16Z)-docosa-4,7,10,13,16-pentaenoic acid (EXP) (R)-lipoic acid (ISO) (R,R,R)-alpha-tocopherol (EXP) 1,1-dichloroethene (ISO) 1-O-palmitoyl-2-O-(5-oxovaleryl)-sn-glycero-3-phosphocholine (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine (EXP) 2-trans,6-trans,10-trans-geranylgeranyl diphosphate (EXP) 3',5'-cyclic AMP (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',4,4'-tetrachlorobiphenyl (EXP,ISO) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (ISO) 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (EXP) 7,12-dimethyltetraphene (ISO) abacavir (EXP) acalabrutinib (EXP) acetamide (ISO) acetic acid (ISO) acrylamide (ISO) aflatoxin B1 (EXP,ISO) alclofenac (EXP) aluminium atom (EXP) aluminium(0) (EXP) amiodarone (EXP) amlodipine (EXP) ammonium chloride (ISO) amphetamine (ISO) apigenin (ISO) arsane (EXP) arsenic atom (EXP) arsenous acid (ISO) atorvastatin calcium (EXP,ISO) benidipine (ISO) benzbromarone (EXP) benzene (EXP,ISO) benzo[a]pyrene (EXP,ISO) benzylpenicillin (ISO) bezafibrate (EXP) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bivalirudin (EXP) boron atom (ISO) Botulinum toxin type A (ISO) Bromperidol (EXP) Butylbenzyl phthalate (EXP,ISO) cadmium atom (EXP) calcitriol (EXP) candesartan (EXP) carbon monoxide (EXP) carbon nanotube (ISO) carnosine (ISO) carrageenan (ISO) carvedilol (EXP,ISO) celecoxib (EXP) chlorpyrifos (ISO) chromium(6+) (EXP) cisplatin (ISO) clofibric acid (ISO) clozapine (EXP) cobalt dichloride (ISO) cocaine (EXP) colesevelam hydrochloride (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (EXP,ISO) curcumin (ISO) cyanocob(III)alamin (EXP) cyclophosphamide (ISO) cyclosporin A (EXP,ISO) cyproconazole (ISO) cyproterone acetate (EXP) D-penicillamine (EXP) daidzein (EXP) delta-tocotrienol (EXP) deoxynivalenol (ISO) desferrioxamine B (ISO) desogestrel (EXP) dexamethasone (ISO) Diallyl sulfide (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) diclofenac (EXP,ISO) dienogest (EXP) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (EXP,ISO) dimethoate (ISO) disodium selenite (EXP,ISO) doxazosin (EXP) elemental boron (ISO) endosulfan (ISO) epoxiconazole (ISO) eptifibatide (EXP) erythromycin A (ISO) ethanol (EXP,ISO) ezetimibe (EXP) fenofibrate (EXP) flucloxacillin (EXP) flunitrazepam (EXP) flutamide (ISO) folic acid (EXP) fosfomycin (EXP) fructose (ISO) fumonisin B1 (ISO) furan (ISO) gamma-tocopherol (EXP) genistein (EXP,ISO) gentamycin (EXP,ISO) geraniol (ISO) gestodene (EXP) ginsenoside Re (ISO) gossypin (ISO) heparin (EXP) indinavir (EXP) indometacin (ISO) iron(2+) sulfate (anhydrous) (EXP) iron(III) citrate (EXP) isoprenaline (ISO) ivermectin (EXP) kaempferol (EXP) L-arginine (ISO) L-ascorbic acid (EXP) lead diacetate (ISO) lead nitrate (EXP) lead(0) (EXP) levonorgestrel (EXP) lipoic acid (ISO) lipopolysaccharide (EXP,ISO) losartan (ISO) lovastatin (ISO) lupeol (ISO) medroxyprogesterone acetate (EXP) mercury atom (EXP) mercury(0) (EXP) Mesaconitine (ISO) metformin (EXP,ISO) methotrexate (ISO) mevalonic acid (EXP) milrinone (EXP) mono(2-ethyl-5-hydroxyhexyl) phthalate (EXP) mono(2-ethyl-5-oxohexyl) phthalate (EXP) monobenzyl phthalate (EXP) Monobutylphthalate (EXP) morphine (EXP) myricitrin (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (ISO) N-Nitrosopyrrolidine (EXP) neoechinulin A (ISO) nickel atom (EXP) nickel dichloride (EXP) nicotinic acid (EXP,ISO) nitrofen (ISO) nitrogen dioxide (EXP) nomegestrol (EXP) nomegestrol acetate (EXP) Nonidet P-40 (EXP) norgestimate (EXP) O-methyleugenol (EXP) obeticholic acid (EXP) okadaic acid (EXP) oleic acid (EXP) olmesartan (EXP) Olmesartan medoxomil (ISO) ozone (ISO) p-menthan-3-ol (ISO) pamidronate (EXP) paracetamol (EXP,ISO) Pentoxifylline (EXP) perfluorobutanesulfonic acid (EXP) perfluorononanoic acid (EXP) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP,ISO) permethrin (ISO) phenethyl caffeate (ISO) phenobarbital (EXP) phorbol 13-acetate 12-myristate (ISO) phosphatidylcholine (EXP) pioglitazone (EXP,ISO) pirinixic acid (ISO) pravastatin (ISO) pregnenolone 16alpha-carbonitrile (ISO) propiconazole (ISO) pterostilbene (EXP) quercetin (EXP,ISO) resveratrol (EXP,ISO) riboflavin (EXP) rifampicin (EXP) rifamycin SV (EXP) rivastigmine (ISO) rosmarinic acid (ISO) rosuvastatin calcium (EXP) rotenone (ISO) salvianolic acid B (EXP,ISO) SB 203580 (EXP) simvastatin (EXP) sodium arsenite (EXP,ISO) sodium nitrite (ISO) sterigmatocystin (ISO) streptozocin (ISO) superoxide (ISO) telmisartan (EXP) testosterone (EXP) tetrachloromethane (ISO) thalidomide (EXP) thioacetamide (ISO) tibolone (EXP) titanium dioxide (ISO) TMC-120A (ISO) triadimefon (ISO) trichloroethene (ISO) Triptolide (ISO) valproic acid (EXP,ISO) vancomycin (EXP) vitamin E (EXP,ISO) withaferin A (ISO) wortmannin (EXP) zaragozic acid A (ISO) zinc atom (EXP,ISO) zinc dichloride (EXP) zinc(0) (EXP,ISO)
1.
Postoperative atrial fibrillation is not correlated to C-reactive protein.
Ahlsson AJ, etal., Ann Thorac Surg. 2007 Apr;83(4):1332-7.
2.
Hospitalised patients with Influenza A (H1N1) in the Royal Hospital, Oman: Experience of a tertiary care hospital, July-December 2009.
Al-Lawati J, etal., Sultan Qaboos Univ Med J. 2010 Dec;10(3):326-34. Epub 2010 Nov 14.
3.
Plasma oxidative and inflammatory markers in patients with idiopathic Parkinson's disease.
Andican G, etal., Acta Neurol Belg. 2012 Feb 9.
4.
The value of C-reactive protein determination in patients with renal colic to decide urgent urinary diversion.
Angulo JC, etal., Urology. 2010 Aug;76(2):301-6. Epub 2010 Mar 5.
5.
The effectiveness of Echinacea extract or composite glucosamine, chondroitin and methyl sulfonyl methane supplements on acute and chronic rheumatoid arthritis rat model.
Arafa NM, etal., Toxicol Ind Health. 2011 Dec 15.
6.
Atheroma plaque, metabolic syndrome and inflammation in patients with psoriasis.
Arias-Santiago S, etal., Eur J Dermatol. 2012 Apr 16.
7.
C-reactive protein (CRP): An important diagnostic and prognostic tool in nursing-home-associated pneumonia.
Arinzon Z, etal., Arch Gerontol Geriatr. 2011 Mar 23.
8.
Long-term outcome of tumor necrosis factor alpha antagonist's treatment in pediatric Crohn's disease.
Assa A, etal., J Crohns Colitis. 2012 Apr 4.
9.
Association between C-reactive protein and generalized anxiety disorder in stable coronary heart disease patients.
Bankier B, etal., Eur Heart J. 2008 Sep;29(18):2212-7. doi: 10.1093/eurheartj/ehn326. Epub 2008 Jul 4.
10.
The effects of melatonin on burn-induced inflammatory responses and coagulation disorders in rats.
Bekyarova G, etal., Methods Find Exp Clin Pharmacol. 2010 Jun;32(5):299-303.
11.
Promotion of beta-amyloid production by C-reactive protein and its implications in the early pathogenesis of Alzheimer's disease.
Bi BT, etal., Neurochem Int. 2012 Feb;60(3):257-66. Epub 2011 Dec 19.
12.
Platelet count, mean platelet volume and smoking status in stable chronic obstructive pulmonary disease.
Biljak VR, etal., Platelets. 2011 Apr 20.
13.
Relationship between inflammatory markers, oxidant-antioxidant status and intima-media thickness in prepubertal children with juvenile idiopathic arthritis.
Breda L, etal., Clin Res Cardiol. 2012 Aug 11.
14.
Effects of topical indomethacin, bromfenac and nepafenac on lipopolysaccharide-induced ocular inflammation.
Bucolo C, etal., J Pharm Pharmacol. 2014 Jul;66(7):954-60. doi: 10.1111/jphp.12224. Epub 2014 Feb 12.
15.
Synergistic effects of aminoglycosides and fosfomycin on Pseudomonas aeruginosa in vitro and biofilm infections in a rat model.
Cai Y, etal., J Antimicrob Chemother. 2009 Sep;64(3):563-6. Epub 2009 Jun 26.
16.
Accuracy of white blood cell count, C-reactive protein, interleukin-6 and tumor necrosis factor alpha for diagnosing late neonatal sepsis.
Caldas JP, etal., J Pediatr (Rio J). 2008 Nov-Dec;84(6):536-42. doi: doi:10.2223/JPED.1838.
17.
Lack of effect of a single injection of human C-reactive protein on murine lupus or nephrotoxic nephritis.
Carlucci F, etal., Arthritis Rheum. 2010 Jan;62(1):245-9.
18.
Early proinflammatory cytokines and C-reactive protein trends as predictors of outcome in invasive Aspergillosis.
Chai L, etal., J Infect Dis. 2010 Nov 1;202(9):1454-62. doi: 10.1086/656527.
19.
Significant elevation of plasma pentraxin 3 in patients with pelvic inflammatory disease.
Chang CC, etal., Clin Chem Lab Med. 2011 Oct;49(10):1655-60. doi: 10.1515/CCLM.2011.650. Epub 2011 Jun 17.
20.
Augmented nitric oxide generation in neutrophils: oxidative and pro-inflammatory implications in hypertension.
Chatterjee M, etal., Free Radic Res. 2009 Dec;43(12):1195-204.
21.
[Promoting effect of granulocyto-colony stimulating factor on neovascularization in rats with myocardial infarction].
Chen T, etal., Zhongguo Xiu Fu Chong Jian Wai Ke Za Zhi. 2010 Oct;24(10):1239-43.
22.
Molecular and clinical characteristics of adenoviral infections in Taiwanese children in 2004-2005.
Cheng CC, etal., Eur J Pediatr. 2008 Jun;167(6):633-40. Epub 2007 Sep 18.
23.
Inflammatory gene polymorphisms and susceptibility to kawasaki disease and its arterial sequelae.
Cheung YF, etal., Pediatrics. 2008 Sep;122(3):e608-14. doi: 10.1542/peds.2008-0646. Epub 2008 Aug 18.
24.
Mastoiditis diagnosed by clinical symptoms and imaging studies in children: disease spectrum and evolving diagnostic challenges.
Chien JH, etal., J Microbiol Immunol Infect. 2012 Oct;45(5):377-81. doi: 10.1016/j.jmii.2011.12.008. Epub 2012 May 9.
25.
Malignant otitis externa: an Australian case series.
Chin R, etal., Surgeon. 2012 Oct;10(5):273-7. doi: 10.1016/j.surge.2011.09.004. Epub 2011 Oct 26.
26.
C-reactive protein elevation in patients with atrial arrhythmias: inflammatory mechanisms and persistence of atrial fibrillation.
Chung MK, etal., Circulation. 2001 Dec 11;104(24):2886-91.
27.
Elevation of serum c-reactive protein in patients with OAB and IC/BPS implies chronic inflammation in the urinary bladder.
Chung SD, etal., Neurourol Urodyn. 2011 Mar;30(3):417-20. doi: 10.1002/nau.20938. Epub 2011 Jan 31.
28.
The association of low-grade systemic inflammation with hypertensive retinopathy.
Coban E, etal., Clin Exp Hypertens. 2010;32(8):528-31. doi: 10.3109/10641963.2010.496519.
29.
Inflammation reduces HDL protection against primary cardiac risk.
Corsetti JP, etal., Eur J Clin Invest. 2010 Jun;40(6):483-9. doi: 10.1111/j.1365-2362.2010.02287.x. Epub 2010 Apr 14.
30.
Role of thrombocytosis in diagnosis of giant cell arteritis and differentiation of arteritic from non-arteritic anterior ischemic optic neuropathy.
Costello F, etal., Eur J Ophthalmol. 2004 May-Jun;14(3):245-57.
31.
Complement activation in patients with COVID-19: A novel therapeutic target.
Cugno M, etal., J Allergy Clin Immunol. 2020 May 14. pii: S0091-6749(20)30650-3. doi: 10.1016/j.jaci.2020.05.006.
32.
[Assess the impact of concentrations of inflammatory markers IL-6, CRP in the presence of albuminuria in patients with type 2 diabetes].
Czyzewska J, etal., Pol Merkur Lekarski. 2012 Feb;32(188):98-102.
33.
C-reactive protein and atrial fibrillation in idiopathic dilated cardiomyopathy.
Dai S, etal., Clin Cardiol. 2009 Sep;32(9):E45-50. doi: 10.1002/clc.20430.
34.
Selection of Symptomatic Patients With Crohn's Disease for Abdominopelvic Computed Tomography: Role of Serum C-Reactive Protein.
Desmond AN, etal., Can Assoc Radiol J. 2012 Mar 14.
35.
Retinal vein occlusion: C-reactive protein and arterial hypertension.
Dodson PM and Shine B, Acta Ophthalmol (Copenh). 1984 Feb;62(1):123-30.
36.
Iron deficiency and renal development in the newborn rat.
Drake KA, etal., Pediatr Res. 2009 Dec;66(6):619-24.
37.
Cytokine activation during attacks of the hyperimmunoglobulinemia D and periodic fever syndrome.
Drenth JP, etal., Blood. 1995 Jun 15;85(12):3586-93.
38.
Decreased autoantibody levels and enhanced survival of (NZB x NZW) F1 mice treated with C-reactive protein.
Du Clos TW, etal., Clin Immunol Immunopathol. 1994 Jan;70(1):22-7.
39.
Risk factors for recurrence of diabetic foot ulcers: prospective follow-up analysis of a Eurodiale subgroup.
Dubsky M, etal., Int Wound J. 2012 Jun 19. doi: 10.1111/j.1742-481X.2012.01022.x.
40.
Periodontitis in humans and non-human primates: oral-systemic linkage inducing acute phase proteins.
Ebersole JL, etal., Ann Periodontol. 2002 Dec;7(1):102-11.
41.
Correlation of oxidative stress and inflammatory markers with the severity of sickle cell nephropathy.
Emokpae MA, etal., Ann Afr Med. 2010 Jul-Sep;9(3):141-6.
42.
Risk factors for contrast induced nephropathy: A study among Italian patients.
Evola S, etal., Indian Heart J. 2012 Sep-Oct;64(5):484-91. doi: 10.1016/j.ihj.2012.07.007. Epub 2012 Jul 27.
43.
Role of quercetin and arginine in ameliorating nano zinc oxide-induced nephrotoxicity in rats.
Faddah LM, etal., BMC Complement Altern Med. 2012 May 2;12:60.
44.
Complement factor H Y402H and C-reactive protein polymorphism and photodynamic therapy response in age-related macular degeneration.
Feng X, etal., Ophthalmology. 2009 Oct;116(10):1908-12.e1. doi: 10.1016/j.ophtha.2009.03.011. Epub 2009 Aug 18.
45.
Autoantibodies against C-reactive protein: clinical associations in systemic lupus erythematosus and primary antiphospholipid syndrome.
Figueredo MA, etal., J Rheumatol. 2006 Oct;33(10):1980-6.
46.
C-reactive protein is released in the coronary circulation and causes endothelial dysfunction in patients with acute coronary syndromes.
Forte L, etal., Int J Cardiol. 2011 Oct 6;152(1):7-12. doi: 10.1016/j.ijcard.2011.05.062. Epub 2011 Jul 26.
47.
Effect of antibacterial cathelicidin peptide CAP18/LL-37 on sepsis in neonatal rats.
Fukumoto K, etal., Pediatr Surg Int. 2005 Jan;21(1):20-4. doi: 10.1007/s00383-004-1256-x.
48.
Diagnostic utility of clinical laboratory data determinations for patients with the severe COVID-19.
Gao Y, etal., J Med Virol. 2020 Jul;92(7):791-796. doi: 10.1002/jmv.25770. Epub 2020 Apr 10.
49.
Serum markers of inflammation and oxidative stress in chronic opium (Taryak) smokers.
Ghazavi A, etal., Immunol Lett. 2013 Jun;153(1-2):22-6. doi: 10.1016/j.imlet.2013.07.001. Epub 2013 Jul 12.
50.
Effect of a high-fat diet on the hepatic expression of nuclear receptors and their target genes: relevance to drug disposition.
Ghoneim RH, etal., Br J Nutr. 2015 Feb 14;113(3):507-16. doi: 10.1017/S0007114514003717. Epub 2015 Jan 23.
51.
Human C-reactive protein increases cerebral infarct size after middle cerebral artery occlusion in adult rats.
Gill R, etal., J Cereb Blood Flow Metab. 2004 Nov;24(11):1214-8.
52.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
53.
C-reactive protein levels do not correlate with retinal artery occlusion but with atherosclerosis.
Goldenberg-Cohen N, etal., Eye (Lond). 2009 Apr;23(4):785-90. doi: 10.1038/eye.2008.159. Epub 2008 Jun 6.
54.
Adeno-associated virus-mediated human C-reactive protein gene delivery causes endothelial dysfunction and hypertension in rats.
Guan H, etal., Clin Chem. 2009 Feb;55(2):274-84. doi: 10.1373/clinchem.2008.115857. Epub 2008 Dec 4.
55.
Docosahexaenoic acid, but not eicosapentaenoic acid, reduces the early inflammatory response following compression spinal cord injury in the rat.
Hall JC, etal., J Neurochem. 2012 Jun;121(5):738-50. doi: 10.1111/j.1471-4159.2012.07726.x. Epub 2012 Apr 12.
56.
Inhibition of classical complement activation attenuates liver ischaemia and reperfusion injury in a rat model.
Heijnen BH, etal., Clin Exp Immunol. 2006 Jan;143(1):15-23.
57.
Blood plasma inflammation markers during epileptogenesis in post-status epilepticus rat model for temporal lobe epilepsy.
Holtman L, etal., Epilepsia. 2013 Apr;54(4):589-95. doi: 10.1111/epi.12112. Epub 2013 Feb 8.
58.
Using IL-2R/lymphocytes for predicting the clinical progression of patients with COVID-19.
Hou H, etal., Clin Exp Immunol. 2020 Jul;201(1):76-84. doi: 10.1111/cei.13450. Epub 2020 May 15.
59.
Systemic inflammation and innate immune response in patients with previous anterior uveitis.
Huhtinen M, etal., Br J Ophthalmol. 2002 Apr;86(4):412-7.
60.
C-reactive protein and uric Acid levels in patients with psoriasis.
Isha, etal., Indian J Clin Biochem. 2011 Jul;26(3):309-11. doi: 10.1007/s12291-011-0132-4. Epub 2011 May 4.
61.
[The relationship between inflammatory mediators and pulmonary hypertension in patients with chronic obstructive pulmonary disease].
Jiang YW, etal., Zhonghua Jie He He Hu Xi Za Zhi. 2011 Dec;34(12):904-8.
62.
Association of serum glycated albumin, C-reactive protein and ICAM-1 levels with diffuse coronary artery disease in patients with type 2 diabetes mellitus.
Jin C, etal., Clin Chim Acta. 2009 Oct;408(1-2):45-9. Epub 2009 Jul 15.
63.
Association between SLE nephritis and polymorphic variants of the CRP and FcgammaRIIIa genes.
Jonsen A, etal., Rheumatology (Oxford). 2007 Sep;46(9):1417-21. Epub 2007 Jun 27.
64.
Acute phase inflammatory markers in patients with non-steroidal anti-inflammatory drugs (NSAIDs)-induced acute urticaria/angioedema and after aspirin challenge.
Kasperska-Zajac A, etal., J Eur Acad Dermatol Venereol. 2012 Feb 21. doi: 10.1111/j.1468-3083.2012.04486.x.
65.
Elevated C-reactive protein levels in patients with polypoidal choroidal vasculopathy and patients with neovascular age-related macular degeneration.
Kikuchi M, etal., Ophthalmology. 2007 Sep;114(9):1722-7. Epub 2007 Apr 2.
66.
Human C-reactive protein enhances vulnerability of immature rats to hypoxic-ischemic brain damage: a preliminary study.
Kinugasa-Taniguchi Y, etal., Reprod Sci. 2010 May;17(5):419-25. doi: 10.1177/1933719110361379. Epub 2010 Mar 10.
67.
Value of serum C-reactive protein concentrations in febrile children without apparent focus.
Kohli V, etal., Ann Trop Paediatr. 1993;13(4):373-8.
68.
Long-term prognostic value of baseline C-reactive protein in predicting recurrence of atrial fibrillation after electrical cardioversion.
Korantzopoulos P, etal., Pacing Clin Electrophysiol. 2008 Oct;31(10):1272-6. doi: 10.1111/j.1540-8159.2008.01177.x.
69.
Lipid peroxidation and erythrocyte antioxidant enzymes in patients with Behcet's disease.
Kose K, etal., Tohoku J Exp Med. 2002 May;197(1):9-16.
70.
Value of procalcitonin, C-reactive protein, and neopterin in exacerbations of chronic obstructive pulmonary disease.
Lacoma A, etal., Int J Chron Obstruct Pulmon Dis. 2011;6:157-69. Epub 2011 Feb 28.
71.
Acute-phase proteins and serum immunoglobulins in ankylosing spondylitis.
Laurent MR and Panayi GS, Ann Rheum Dis. 1983 Oct;42(5):524-8.
72.
Microalbuminuria in non-diabetic stemi: An independent predictor for acute kidney injury.
Lazzeri C, etal., Scand Cardiovasc J. 2012 Jul 10.
73.
Pre-ART Levels of Inflammation and Coagulation Markers Are Strong Predictors of Death in a South African Cohort with Advanced HIV Disease.
Ledwaba L, etal., PLoS One. 2012;7(3):e24243. Epub 2012 Mar 20.
74.
Severity of obstructive sleep apnea syndrome and high-sensitivity C-reactive protein reduced after relocation pharyngoplasty.
Lee LA, etal., Otolaryngol Head Neck Surg. 2011 Apr;144(4):632-8. Epub 2011 Feb 10.
75.
Analysis of systemic endothelin-1, matrix metalloproteinase-9, macrophage chemoattractant protein-1, and high-sensitivity C-reactive protein in normal-tension glaucoma.
Lee NY, etal., Curr Eye Res. 2012 Dec;37(12):1121-6. doi: 10.3109/02713683.2012.725798. Epub 2012 Sep 11.
76.
C-reactive protein levels in normal tension glaucoma.
Leibovitch I, etal., J Glaucoma. 2005 Oct;14(5):384-6.
77.
Cardiovascular disease potentially contributes to the progression and poor prognosis of COVID-19.
Li M, etal., Nutr Metab Cardiovasc Dis. 2020 Jun 25;30(7):1061-1067. doi: 10.1016/j.numecd.2020.04.013. Epub 2020 Apr 18.
78.
Clinical and pathological investigation of severe COVID-19 patients.
Li S, etal., JCI Insight. 2020 May 19. pii: 138070. doi: 10.1172/jci.insight.138070.
79.
C-reactive protein promotes acute renal inflammation and fibrosis in unilateral ureteral obstructive nephropathy in mice.
Li ZI, etal., Lab Invest. 2011 Jun;91(6):837-51. Epub 2011 Mar 7.
80.
Discovery of serum biomarkers of alcoholic fatty liver in a rodent model: C-reactive protein.
Liu SL, etal., J Biomed Sci. 2011 Aug 1;18:52. doi: 10.1186/1423-0127-18-52.
81.
Cardiovascular disease in U.S. patients with metabolic syndrome, diabetes, and elevated C-reactive protein.
Malik S, etal., Diabetes Care. 2005 Mar;28(3):690-3.
82.
Serum C-reactive protein in polymyalgia rheumatica. A prospective serial study.
Mallya RK, etal., Arthritis Rheum. 1985 Apr;28(4):383-7.
83.
Iron-binding proteins and C-reactive protein in Nipple Aspirate Fluids: role of Iron-driven inflammation in breast cancer microenvironment?
Mannello F, etal., Am J Transl Res. 2010 Oct 30;3(1):100-13.
84.
Lipoprotein (a) and acute-phase response in patients with vestibular neuronitis.
Milionis HJ, etal., Eur J Clin Invest. 2003 Dec;33(12):1045-50.
85.
C-Reactive protein levels but not CRP dynamics predict mortality in patients with pneumococcal pneumonia.
Mooiweer E, etal., J Infect. 2011 Apr;62(4):314-6. Epub 2011 Jan 31.
86.
High-sensitivity C-reactive protein levels predict survival and are related to haemodynamics in alcoholic cirrhosis.
Mortensen C, etal., Eur J Gastroenterol Hepatol. 2012 Mar 20.
87.
Cardiorenal syndrome in hypertensive rats: microalbuminuria, inflammation and ventricular hypertrophy.
Moubarak M, etal., Physiol Res. 2012 Mar 6;61(1):13-24. Epub 2011 Dec 20.
88.
Diagnostic markers of serious bacterial infections in febrile infants younger than 90 days old.
Nosrati A, etal., Pediatr Int. 2014 Feb;56(1):47-52. doi: 10.1111/ped.12191.
89.
Is inflammation a new risk factor of depression in haemodialysis patients?
Nowak L, etal., Int Urol Nephrol. 2012 Sep 13.
90.
Antioxidant potential, paraoxonase 1, ceruloplasmin activity and C-reactive protein concentration in diabetic retinopathy.
Nowak M, etal., Clin Exp Med. 2010 Sep;10(3):185-92. doi: 10.1007/s10238-009-0084-7. Epub 2009 Dec 11.
91.
Serum amyloid A and C-reactive protein levels may predict microalbuminuria and macroalbuminuria in newly diagnosed type 1 diabetic patients.
Overgaard AJ, etal., J Diabetes Complications. 2012 Aug 10.
92.
C-reactive protein and natural IgM antibodies are activators of complement in a rat model of intestinal ischemia and reperfusion.
Padilla ND, etal., Surgery. 2007 Nov;142(5):722-33.
93.
Chronic infections & coronary artery disease with special reference to Chalmydia pneumoniae.
Padmavati S, etal., Indian J Med Res. 2012 Feb;135(2):228-32.
94.
Incidence and predisposing factors for severe disease in previously healthy term infants experiencing their first episode of bronchiolitis.
Papoff P, etal., Acta Paediatr. 2011 Feb 1. doi: 10.1111/j.1651-2227.2011.02181.x.
95.
Long-term dietary antioxidant cocktail supplementation effectively reduces renal inflammation in diabetic mice.
Park NY, etal., Br J Nutr. 2011 Nov;106(10):1514-21. Epub 2011 Jun 3.
96.
C-reactive protein levels are elevated in asthma and asthma-like conditions.
Pellizzaro AM and Heuertz RM, Clin Lab Sci. 2010 Fall;23(4):223-7.
97.
C-reactive protein for rapid monitoring of infections of the central nervous system.
Peltola HO Lancet. 1982 May 1;1(8279):980-2.
98.
Systemic exposure to Pseudomonal bacteria: a potential link between type 1 diabetes and chronic inflammation.
Peraneva L, etal., Acta Diabetol. 2012 Aug 5.
99.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
100.
Effects of human C-reactive protein on pathogenesis of features of the metabolic syndrome.
Pravenec M, etal., Hypertension. 2011 Apr;57(4):731-7. Epub 2011 Feb 28.
101.
Serum procalcitonin in pulmonary tuberculosis.
Rasmussen TA, etal., Int J Tuberc Lung Dis. 2011 Feb;15(2):251-6, i.
102.
Incremental prognostic value of serum levels of troponin T and C-reactive protein on admission in patients with unstable angina pectoris.
Rebuzzi AG, etal., Am J Cardiol. 1998 Sep 15;82(6):715-9.
103.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
104.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
105.
Experimental alveolitis in rats: microbiological, acute phase response and histometric characterization of delayed alveolar healing.
Rodrigues MT, etal., J Appl Oral Sci. 2011 May-Jun;19(3):260-8.
106.
Reversal of ongoing proteinuria in autoimmune mice by treatment with C-reactive protein.
Rodriguez W, etal., Arthritis Rheum. 2005 Feb;52(2):642-50.
107.
Clinical predictors of mortality due to COVID-19 based on an analysis of data of 150 patients from Wuhan, China.
Ruan Q, etal., Intensive Care Med. 2020 May;46(5):846-848. doi: 10.1007/s00134-020-05991-x. Epub 2020 Mar 3.
108.
Chemopreventive efficacy of green tea drinking against 1,2-dimethyl hydrazine-induced rat colon carcinogenesis.
Sadik NA Cell Biochem Funct. 2012 Sep 24. doi: 10.1002/cbf.2873.
109.
Pretherapeutic laboratory findings, extent of metastasis and choice of treatment as prognostic markers in ocular melanoma- a single centre experience.
Schicher N, etal., J Eur Acad Dermatol Venereol. 2013 Mar;27(3):e394-9. doi: 10.1111/jdv.12006. Epub 2012 Oct 12.
110.
C-reactive protein and CFH, ARMS2/HTRA1 gene variants are independently associated with risk of macular degeneration.
Seddon JM, etal., Ophthalmology. 2010 Aug;117(8):1560-6. doi: 10.1016/j.ophtha.2009.11.020. Epub 2010 Mar 26.
111.
Role of gender in the associations of microalbuminuria with inflammatory markers in hypertensive subjects: a cross-sectional study.
Shantha GP, etal., Kidney Blood Press Res. 2009;32(6):434-9. Epub 2009 Dec 17.
112.
C reactive protein (CRP) as a predictor for true bacteremia in children.
Shaoul R, etal., Med Sci Monit. 2008 May;14(5):CR255-261.
113.
Progressive Increase of Inflammatory Biomarkers in Chronic Kidney Disease and End-Stage Renal Disease.
Sharain K, etal., Clin Appl Thromb Hemost. 2012 Aug 3.
114.
Up-regulation of PPARgamma, heat shock protein-27 and -72 by naringin attenuates insulin resistance, beta-cell dysfunction, hepatic steatosis and kidney damage in a rat model of type 2 diabetes.
Sharma AK, etal., Br J Nutr. 2011 Dec;106(11):1713-23. Epub 2011 Jun 21.
115.
High-sensitivity C-reactive protein: an independent risk factor for left ventricular hypertrophy in patients with lupus nephritis.
Shi B, etal., J Biomed Biotechnol. 2010;2010:373426. Epub 2010 Nov 7.
116.
Serum levels of autoantibodies against monomeric C-reactive protein are correlated with disease activity in systemic lupus erythematosus.
Sjowall C, etal., Arthritis Res Ther. 2004;6(2):R87-94. Epub 2003 Dec 5.
117.
High prevalence of autoantibodies to C-reactive protein in patients with chronic hepatitis C infection: association with liver fibrosis and portal inflammation.
Sjowall C, etal., Hum Immunol. 2012 Apr;73(4):382-8. Epub 2012 Feb 1.
118.
Association of posttraumatic stress disorder with low-grade elevation of C-reactive protein: evidence from the general population.
Spitzer C, etal., J Psychiatr Res. 2010 Jan;44(1):15-21. doi: 10.1016/j.jpsychires.2009.06.002. Epub 2009 Jul 22.
119.
Validation of CRP as prognostic marker for renal cell carcinoma in a large series of patients.
Steffens S, etal., BMC Cancer. 2012 Sep 8;12(1):399.
120.
Elevated C-reactive protein levels may be a predictor of persistent unfavourable symptoms in patients with mild traumatic brain injury: a preliminary study.
Su SH, etal., Brain Behav Immun. 2014 May;38:111-7. doi: 10.1016/j.bbi.2014.01.009. Epub 2014 Jan 21.
121.
The effects of C-reactive protein, interleukin-6, and tumor necrosis factor-alpha in rat allograft adventitial inflammation and allograft arteriosclerosis.
Sun H, etal., Transplant Proc. 2009 Nov;41(9):3909-12.
122.
C-reactive protein predicts response to infliximab in patients with chronic sarcoidosis.
Sweiss NJ, etal., Sarcoidosis Vasc Diffuse Lung Dis. 2010 Jul;27(1):49-56.
123.
Association between baseline levels of C-reactive protein (CRP) and a dinucleotide repeat polymorphism in the intron of the CRP gene.
Szalai AJ, etal., Genes Immun. 2002 Feb;3(1):14-9.
124.
Modified C-reactive protein might be a target autoantigen of TINU syndrome.
Tan Y, etal., Clin J Am Soc Nephrol. 2011 Jan;6(1):93-100. Epub 2010 Sep 2.
125.
Autoantibodies against monomeric C-reactive protein in sera from patients with lupus nephritis are associated with disease activity and renal tubulointerstitial lesions.
Tan Y, etal., Hum Immunol. 2008 Dec;69(12):840-4. Epub 2008 Oct 11.
126.
A model of experimental acute hematogenous pyelonephritis in the rat.
Tancheva S, etal., Folia Med (Plovdiv). 2011 Apr-Jun;53(2):63-8.
127.
Ampicillin/sulbactam for children hospitalized with community-acquired pneumonia.
Tapisiz A, etal., J Infect Chemother. 2011 Jan 22.
128.
Use of C-reactive protein in differentiation between acute bacterial and viral otitis media.
Tejani NR, etal., Pediatrics. 1995 May;95(5):664-9.
129.
Evaluation of the potential for lymph node metastasis using CRP 1846C>T genetic polymorphism in invasive breast cancer.
Terata K, etal., Tumour Biol. 2014 Jun;35(6):5931-5. doi: 10.1007/s13277-014-1786-3. Epub 2014 Mar 16.
130.
The levels of soluble CD40 ligand and C-reactive protein in normal weight, overweight and obese people.
Unek IT, etal., Clin Med Res. 2010 Jul;8(2):89-95.
131.
Biomarkers of cardiovascular disease as risk factors for age-related macular degeneration.
Vine AK, etal., Ophthalmology. 2005 Dec;112(12):2076-80. Epub 2005 Oct 12.
132.
Clinical features and treatment of COVID-19 patients in northeast Chongqing.
Wan S, etal., J Med Virol. 2020 Jul;92(7):797-806. doi: 10.1002/jmv.25783. Epub 2020 Apr 1.
133.
Reduced serum levels of autoantibodies against monomeric C-reactive protein (CRP) in patients with acute coronary syndrome.
Wettero J, etal., Clin Chim Acta. 2009 Feb;400(1-2):128-31. Epub 2008 Oct 17.
134.
The time-averaged inflammatory disease activity estimates the progression of erosions in MRI of the sacroiliac joints in ankylosing spondylitis.
Wick MC, etal., Clin Rheumatol. 2012 Mar 16.
135.
Antiretroviral treatment-associated tuberculosis in a prospective cohort of HIV-infected patients starting ART.
Worodria W, etal., Clin Dev Immunol. 2011;2011:758350. Epub 2010 Dec 8.
136.
[Preliminary investigation of the changes and mechanism of Leptin after myocardial ischemia/reperfusion injury].
Xue H, etal., Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2010 Nov;22(11):680-3.
137.
Clinical characteristics and outcomes of patients with severe covid-19 with diabetes.
Yan Y, etal., BMJ Open Diabetes Res Care. 2020 Apr;8(1). pii: 8/1/e001343. doi: 10.1136/bmjdrc-2020-001343.
138.
[Effect of electroacupuncture intervention on blood-lipid, high-sensitivity C-reactive protein and adiponectin levels in hyperlipidemia rats].
Yan ZK, etal., Zhen Ci Yan Jiu. 2013 Oct;38(5):365-8, 385.
139.
Leptin, triglycerides, and interleukin 6 are independently associated with C-reactive protein in Japanese type 2 diabetic patients.
Yanagawa T, etal., Diabetes Res Clin Pract. 2007 Jan;75(1):2-6. Epub 2006 Jun 9.
140.
Factors Associated with Hypoxemia in Children Infected with Pandemic H1N1 2009 Influenza Virus.
Yeom JS, etal., Pediatr Int. 2010 Dec 30. doi: 10.1111/j.1442-200X.2010.03319.x.
141.
Proteomic analysis of aortic smooth muscle cell secretions reveals an association of myosin heavy chain 11 with abdominal aortic aneurysm.
Yokoyama U, etal., Am J Physiol Heart Circ Physiol. 2018 Jul 13. doi: 10.1152/ajpheart.00329.2018.
142.
Raised C-reactive protein response in rheumatoid arthritis patients with secondary Sjogren's syndrome.
Youinou P, etal., Rheumatol Int. 1990;10(1):39-41.
143.
The correlation between viral clearance and biochemical outcomes of 94 COVID-19 infected discharged patients.
Yuan J, etal., Inflamm Res. 2020 Jun;69(6):599-606. doi: 10.1007/s00011-020-01342-0. Epub 2020 Mar 29.
144.
[Assessment of changes in levels of interleukin 6 and C reactive protein in patients with breast tumors].
Zakrzewska I, etal., Pol Merkur Lekarski. 2003 Aug;15(86):115-7.
145.
Viral and host factors related to the clinical outcome of COVID-19.
Zhang X, etal., Nature. 2020 May 20. pii: 10.1038/s41586-020-2355-0. doi: 10.1038/s41586-020-2355-0.
146.
The clinical characteristics and outcomes of patients with diabetes and secondary hyperglycaemia with coronavirus disease 2019: A single-centre, retrospective, observational study in Wuhan.
Zhang Y, etal., Diabetes Obes Metab. 2020 May 14. doi: 10.1111/dom.14086.
147.
[Value of fluorescence quantitative PCR assay of bronchoalveolar lavage fluid samples in the diagnosis of Mycoplasma pneumoniae pneumonia in children.]
Zhong LL, etal., Zhongguo Dang Dai Er Ke Za Zhi. 2011 Mar;13(3):191-194.
CRP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 159,712,289 - 159,714,589 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 159,712,289 - 159,714,589 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 159,682,079 - 159,684,379 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 157,948,703 - 157,951,003 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 156,495,152 - 156,497,452 NCBI Celera 1 132,750,525 - 132,752,817 (-) NCBI Celera Cytogenetic Map 1 q23.2 NCBI HuRef 1 131,038,539 - 131,040,831 (-) NCBI HuRef CHM1_1 1 161,076,594 - 161,078,894 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 158,849,333 - 158,851,633 (-) NCBI T2T-CHM13v2.0
Crp Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 172,525,623 - 172,527,533 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 172,525,622 - 172,660,598 (+) Ensembl GRCm39 Ensembl GRCm38 1 172,698,056 - 172,699,966 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 172,698,055 - 172,833,031 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 174,628,187 - 174,630,097 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 174,534,741 - 174,536,635 (+) NCBI MGSCv36 mm8 Celera 1 175,548,254 - 175,550,142 (+) NCBI Celera Cytogenetic Map 1 H3 NCBI cM Map 1 80.13 NCBI
Crp Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 87,694,062 - 87,695,978 (+) NCBI GRCr8 mRatBN7.2 13 85,135,384 - 85,175,178 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 85,124,977 - 85,175,178 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 87,664,967 - 87,666,915 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 89,065,246 - 89,067,190 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 86,249,976 - 86,251,928 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 91,080,448 - 91,081,358 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 91,054,974 - 91,093,713 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 95,599,418 - 95,600,328 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 88,702,243 - 88,703,153 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 88,891,058 - 88,892,928 (+) NCBI Celera 13 84,770,843 - 84,771,753 (+) NCBI Celera Cytogenetic Map 13 q24 NCBI
CRP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 90,140,428 - 90,143,900 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 89,880,463 - 89,883,937 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 135,062,102 - 135,064,402 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 138,858,353 - 138,860,652 (-) NCBI panpan1.1 PanPan1.1 panPan2
CRP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 22,396,787 - 22,398,180 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 22,396,263 - 22,399,166 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 22,473,724 - 22,475,116 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 22,519,785 - 22,521,176 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 22,519,714 - 22,522,146 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 22,286,369 - 22,287,757 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 22,818,770 - 22,820,163 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 23,230,160 - 23,231,548 (+) NCBI UU_Cfam_GSD_1.0
Crp
CRP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 90,793,350 - 90,805,218 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 90,793,361 - 90,801,020 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 98,764,964 - 98,772,727 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CRP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 4,232,262 - 4,235,826 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 4,232,913 - 4,235,377 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 3,340,251 - 3,342,511 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Crp
.
Predicted Target Of
Count of predictions: 2538 Count of miRNA genes: 796 Interacting mature miRNAs: 901 Transcripts: ENST00000255030, ENST00000343919, ENST00000368110, ENST00000368111, ENST00000368112, ENST00000437342, ENST00000473196, ENST00000489317 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
596956916 GWAS1076435_H C-reactive protein measurement QTL GWAS1076435 (human) 1e-48 C-reactive protein measurement 1 159713648 159713649 Human 1357381 BW57_H Body weight QTL 57 (human) 1 0.0001 Body weight fat free mass after exercise training 1 140630236 166630236 Human 597099445 GWAS1195519_H C-reactive protein measurement QTL GWAS1195519 (human) 2e-157 C-reactive protein measurement blood C-reactive protein level (CMO:0003160) 1 159712443 159712444 Human 597116658 GWAS1212732_H C-reactive protein measurement QTL GWAS1212732 (human) 5e-23 C-reactive protein measurement blood C-reactive protein level (CMO:0003160) 1 159714026 159714027 Human 597147505 GWAS1243579_H low density lipoprotein cholesterol measurement QTL GWAS1243579 (human) 2e-205 low density lipoprotein cholesterol measurement blood low density lipoprotein cholesterol level (CMO:0000053) 1 159712443 159712444 Human 597115793 GWAS1211867_H C-reactive protein measurement QTL GWAS1211867 (human) 2e-200 C-reactive protein measurement blood C-reactive protein level (CMO:0003160) 1 159713648 159713649 Human 597116657 GWAS1212731_H C-reactive protein measurement QTL GWAS1212731 (human) 6e-09 C-reactive protein measurement blood C-reactive protein level (CMO:0003160) 1 159714007 159714008 Human 597222863 GWAS1318937_H C-reactive protein measurement QTL GWAS1318937 (human) 4e-287 C-reactive protein measurement blood C-reactive protein level (CMO:0003160) 1 159714024 159714025 Human 597232625 GWAS1328699_H erythropoetin measurement QTL GWAS1328699 (human) 4e-23 blood hormone amount (VT:0005418) 1 159713301 159713302 Human 597250608 GWAS1346682_H C-reactive protein measurement QTL GWAS1346682 (human) 1e-48 C-reactive protein measurement blood C-reactive protein level (CMO:0003160) 1 159713648 159713649 Human 597342150 GWAS1438224_H complex trait QTL GWAS1438224 (human) 1e-24 complex trait 1 159713648 159713649 Human 597341940 GWAS1438014_H complex trait QTL GWAS1438014 (human) 5e-35 complex trait 1 159712443 159712444 Human
D1S3335
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 159,682,085 - 159,682,407 UniSTS GRCh37 Build 36 1 157,948,709 - 157,949,031 RGD NCBI36 Celera 1 132,750,531 - 132,750,853 RGD Cytogenetic Map 1 q23.2 UniSTS HuRef 1 131,038,545 - 131,038,867 UniSTS GeneMap99-GB4 RH Map 1 587.74 UniSTS Whitehead-YAC Contig Map 1 UniSTS NCBI RH Map 1 1436.5 UniSTS
RH11610
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 159,682,143 - 159,682,280 UniSTS GRCh37 Build 36 1 157,948,767 - 157,948,904 RGD NCBI36 Celera 1 132,750,589 - 132,750,726 RGD Cytogenetic Map 1 q23.2 UniSTS HuRef 1 131,038,603 - 131,038,740 UniSTS GeneMap99-GB4 RH Map 1 574.66 UniSTS NCBI RH Map 1 1436.5 UniSTS
G54038
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 159,682,155 - 159,682,306 UniSTS GRCh37 Build 36 1 157,948,779 - 157,948,930 RGD NCBI36 Celera 1 132,750,601 - 132,750,752 RGD Cytogenetic Map 1 q23.2 UniSTS HuRef 1 131,038,615 - 131,038,766 UniSTS
PMC311069P8
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 159,682,194 - 159,682,273 UniSTS GRCh37 Build 36 1 157,948,818 - 157,948,897 RGD NCBI36 Celera 1 132,750,640 - 132,750,719 RGD Cytogenetic Map 1 q23.2 UniSTS HuRef 1 131,038,654 - 131,038,733 UniSTS
PMC98081P1
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 159,683,463 - 159,683,784 UniSTS GRCh37 Build 36 1 157,950,087 - 157,950,408 RGD NCBI36 Celera 1 132,751,909 - 132,752,230 RGD Cytogenetic Map 1 q23.2 UniSTS HuRef 1 131,039,923 - 131,040,244 UniSTS
PMC98081P3
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 159,683,329 - 159,683,922 UniSTS GRCh37 Build 36 1 157,949,953 - 157,950,546 RGD NCBI36 Celera 1 132,751,775 - 132,752,368 RGD Cytogenetic Map 1 q23.2 UniSTS HuRef 1 131,039,789 - 131,040,382 UniSTS
CRP_559
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 159,682,384 - 159,683,084 UniSTS GRCh37 Build 36 1 157,949,008 - 157,949,708 RGD NCBI36 Celera 1 132,750,830 - 132,751,530 RGD HuRef 1 131,038,844 - 131,039,544 UniSTS
GDB:190880
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 159,683,978 - 159,684,116 UniSTS GRCh37 Build 36 1 157,950,602 - 157,950,740 RGD NCBI36 Celera 1 132,752,424 - 132,752,554 RGD Cytogenetic Map 1 q23.2 UniSTS HuRef 1 131,040,438 - 131,040,568 UniSTS Marshfield Genetic Map 1 165.62 UniSTS
WIAF-2117
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 159,682,130 - 159,682,357 UniSTS GRCh37 Build 36 1 157,948,754 - 157,948,981 RGD NCBI36 Celera 1 132,750,576 - 132,750,803 RGD Cytogenetic Map 1 q23.2 UniSTS HuRef 1 131,038,590 - 131,038,817 UniSTS GeneMap99-GB4 RH Map 1 588.98 UniSTS
RH18109
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 159,682,514 - 159,682,748 UniSTS GRCh37 Build 36 1 157,949,138 - 157,949,372 RGD NCBI36 Celera 1 132,750,960 - 132,751,194 RGD Cytogenetic Map 1 q23.2 UniSTS HuRef 1 131,038,974 - 131,039,208 UniSTS GeneMap99-GB4 RH Map 1 574.66 UniSTS NCBI RH Map 1 1436.5 UniSTS
RH11065
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 159,683,281 - 159,683,541 UniSTS GRCh37 Build 36 1 157,949,905 - 157,950,165 RGD NCBI36 Celera 1 132,751,727 - 132,751,987 RGD Cytogenetic Map 1 q23.2 UniSTS HuRef 1 131,039,741 - 131,040,001 UniSTS GeneMap99-GB4 RH Map 1 587.43 UniSTS NCBI RH Map 1 1436.5 UniSTS
D1S2384
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 159,682,467 - 159,682,815 UniSTS GRCh37 Build 36 1 157,949,091 - 157,949,439 RGD NCBI36 Celera 1 132,750,913 - 132,751,261 RGD Cytogenetic Map 1 q23.2 UniSTS HuRef 1 131,038,927 - 131,039,275 UniSTS Whitehead-YAC Contig Map 1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1176
1952
2311
1795
3387
1517
1889
2
593
975
444
1713
5191
4908
1
2686
605
1377
1217
152
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000255030 ⟹ ENSP00000255030
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 159,712,289 - 159,714,589 (-) Ensembl
Ensembl Acc Id:
ENST00000368110 ⟹ ENSP00000357091
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 159,712,563 - 159,714,589 (-) Ensembl
Ensembl Acc Id:
ENST00000368111 ⟹ ENSP00000357092
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 159,712,504 - 159,714,589 (-) Ensembl
Ensembl Acc Id:
ENST00000368112 ⟹ ENSP00000357093
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 159,712,410 - 159,714,589 (-) Ensembl
Ensembl Acc Id:
ENST00000437342 ⟹ ENSP00000402788
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 159,712,293 - 159,714,589 (-) Ensembl
Ensembl Acc Id:
ENST00000473196
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 159,712,291 - 159,713,767 (-) Ensembl
Ensembl Acc Id:
ENST00000489317
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 159,712,535 - 159,714,080 (-) Ensembl
RefSeq Acc Id:
NM_000567 ⟹ NP_000558
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 159,712,289 - 159,714,589 (-) NCBI GRCh37 1 159,682,079 - 159,684,396 (-) NCBI Build 36 1 157,948,703 - 157,951,003 (-) NCBI Archive HuRef 1 131,038,539 - 131,040,831 (-) ENTREZGENE CHM1_1 1 161,076,594 - 161,078,894 (-) NCBI T2T-CHM13v2.0 1 158,849,333 - 158,851,633 (-) NCBI
Sequence:
AAGGCAAGAGATCTAGGACTTCTAGCCCCTGAACTTTCAGCCGAATACATCTTTTCCAAAGGAGTGAATTCAGGCCCTTGTATCACTGGCAGCAGGACGTGACCATGGAGAAGCTGTTGTGTTTCTTG
hide sequence
RefSeq Acc Id:
NM_001329057 ⟹ NP_001315986
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 159,712,289 - 159,714,589 (-) NCBI T2T-CHM13v2.0 1 158,849,333 - 158,851,633 (-) NCBI
Sequence:
AAGGCAAGAGATCTAGGACTTCTAGCCCCTGAACTTTCAGCCGAATACATCTTTTCCAAAGGAGTGAATTCAGGCCCTTGTATCACTGGCAGCAGGACGTGACCATGGAGAAGCTGTTGTGTTTCTTG
hide sequence
RefSeq Acc Id:
NM_001329058 ⟹ NP_001315987
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 159,712,289 - 159,714,589 (-) NCBI T2T-CHM13v2.0 1 158,849,333 - 158,851,633 (-) NCBI
Sequence:
AAGGCAAGAGATCTAGGACTTCTAGCCCCTGAACTTTCAGCCGAATACATCTTTTCCAAAGGAG
hide sequence
RefSeq Acc Id:
NM_001382703 ⟹ NP_001369632
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 159,712,289 - 159,714,589 (-) NCBI T2T-CHM13v2.0 1 158,849,333 - 158,851,633 (-) NCBI
Sequence:
AAGGCAAGAGATCTAGGACTTCTAGCCCCTGAACTTTCAGCCGAATACATCTTTTCCAAAGGAGTGAATTCAGGCCCTTGTATCACTGGCAGCAGGACGTGACCATGGAGAAGCTGTTGTGTTTCTTG
hide sequence
RefSeq Acc Id:
NP_000558 ⟸ NM_000567
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q08AK3 (UniProtKB/Swiss-Prot), D3DVE0 (UniProtKB/Swiss-Prot), D3DVD9 (UniProtKB/Swiss-Prot), A8K078 (UniProtKB/Swiss-Prot), Q8WW75 (UniProtKB/Swiss-Prot), P02741 (UniProtKB/Swiss-Prot)
- Sequence:
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFW
hide sequence
RefSeq Acc Id:
NP_001315987 ⟸ NM_001329058
- Peptide Label:
isoform 2 precursor
- UniProtKB:
P02741 (UniProtKB/Swiss-Prot)
- Sequence:
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP
hide sequence
RefSeq Acc Id:
NP_001315986 ⟸ NM_001329057
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q08AK3 (UniProtKB/Swiss-Prot), D3DVE0 (UniProtKB/Swiss-Prot), D3DVD9 (UniProtKB/Swiss-Prot), A8K078 (UniProtKB/Swiss-Prot), Q8WW75 (UniProtKB/Swiss-Prot), P02741 (UniProtKB/Swiss-Prot)
- Sequence:
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFW
hide sequence
RefSeq Acc Id:
NP_001369632 ⟸ NM_001382703
- Peptide Label:
isoform 3 precursor
- UniProtKB:
Q5VVP7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSP00000255030 ⟸ ENST00000255030
Ensembl Acc Id:
ENSP00000357091 ⟸ ENST00000368110
Ensembl Acc Id:
ENSP00000357093 ⟸ ENST00000368112
Ensembl Acc Id:
ENSP00000357092 ⟸ ENST00000368111
Ensembl Acc Id:
ENSP00000402788 ⟸ ENST00000437342
RGD ID: 6849600 Promoter ID: EP26029 Type: single initiation site Name: HS_CRP Description: C-reactive protein. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Primer extension; Primer extension; transgenic organisms Regulation: liver; (induced by or strongly expressed in) acute phase Position: Human Assembly Chr Position (strand) Source Build 36 1 157,951,003 - 157,951,063 EPD
RGD ID: 6857722 Promoter ID: EPDNEW_H2026 Type: multiple initiation site Name: CRP_1 Description: C-reactive protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 1 159,714,589 - 159,714,649 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-23
CRP
C-reactive protein
C-reactive protein, pentraxin-related
Symbol and/or name change
5135510 APPROVED
