Symbol:
Mptx1
Name:
mucosal pentraxin 1
RGD ID:
1614365
MGI Page
MGI
Description:
Predicted to enable complement component C1q complex binding activity. Predicted to be involved in innate immune response. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human MPTX1 (mucosal pentraxin 1 (pseudogene)).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1810030J14Rik; AV054416; MGC35753; Mptx; mucosal pentraxin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 174,158,085 - 174,160,443 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 174,158,084 - 174,160,439 (+) Ensembl GRCm39 Ensembl GRCm38 1 174,330,518 - 174,332,877 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 174,330,518 - 174,332,873 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 176,260,649 - 176,263,008 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 176,167,194 - 176,169,548 (+) NCBI MGSCv36 mm8 Celera 1 180,288,255 - 180,290,613 (+) NCBI Celera Cytogenetic Map 1 H3 NCBI cM Map 1 81.01 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mptx1 Mouse 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Mptx1 Mouse 1,2-dimethylhydrazine decreases expression ISO Mptx1 (Rattus norvegicus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MPTX1 mRNA CTD PMID:27840820 Mptx1 Mouse 1,2-dimethylhydrazine multiple interactions ISO Mptx1 (Rattus norvegicus) 6480464 APC protein affects the reaction [1 and 2-Dimethylhydrazine results in decreased expression of MPTX1 mRNA] CTD PMID:27840820 Mptx1 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Mptx1 Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Mptx1 Mouse 2,4,4'-trichlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Mptx1 Mouse cadmium dichloride increases expression ISO MPTX1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MPTX1 protein CTD PMID:26220685 Mptx1 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of MPTX1 mRNA CTD PMID:32715474 Mptx1 Mouse epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of MPTX1 mRNA CTD PMID:35436446 Mptx1 Mouse ferroheme b decreases expression ISO Mptx1 (Rattus norvegicus) 6480464 Heme results in decreased expression of MPTX1 mRNA CTD PMID:15539406 Mptx1 Mouse ferroheme b multiple interactions ISO Mptx1 (Rattus norvegicus) 6480464 Calcium and Dietary inhibits the reaction [Heme results in decreased expression of MPTX1 mRNA] CTD PMID:15539406 Mptx1 Mouse heme b decreases expression ISO Mptx1 (Rattus norvegicus) 6480464 Heme results in decreased expression of MPTX1 mRNA CTD PMID:15539406 Mptx1 Mouse heme b multiple interactions ISO Mptx1 (Rattus norvegicus) 6480464 Calcium and Dietary inhibits the reaction [Heme results in decreased expression of MPTX1 mRNA] CTD PMID:15539406 Mptx1 Mouse PCB138 multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Mptx1 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of MPTX1 mRNA CTD PMID:35295148
1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (EXP) 1,2-dimethylhydrazine (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,4,4'-trichlorobiphenyl (EXP) cadmium dichloride (ISO) chlorpyrifos (EXP) epoxiconazole (EXP) ferroheme b (ISO) heme b (ISO) PCB138 (EXP) titanium dioxide (EXP)
Mptx1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 174,158,085 - 174,160,443 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 174,158,084 - 174,160,439 (+) Ensembl GRCm39 Ensembl GRCm38 1 174,330,518 - 174,332,877 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 174,330,518 - 174,332,873 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 176,260,649 - 176,263,008 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 176,167,194 - 176,169,548 (+) NCBI MGSCv36 mm8 Celera 1 180,288,255 - 180,290,613 (+) NCBI Celera Cytogenetic Map 1 H3 NCBI cM Map 1 81.01 NCBI
MPTX1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 159,276,507 - 159,277,182 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 159,268,623 - 159,277,111 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 159,246,297 - 159,246,972 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 157,502,757 - 157,513,525 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 132,306,376 - 132,317,144 (+) NCBI Celera Cytogenetic Map 1 q23.2 NCBI HuRef 1 130,603,448 - 130,604,123 (+) NCBI HuRef CHM1_1 1 160,641,726 - 160,642,401 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 158,413,540 - 158,414,215 (+) NCBI T2T-CHM13v2.0
Mptx1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 88,260,335 - 88,263,869 (-) NCBI GRCr8 mRatBN7.2 13 85,727,989 - 85,731,523 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 85,728,076 - 85,731,469 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 88,226,136 - 88,229,530 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 89,626,452 - 89,629,846 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 86,811,128 - 86,814,522 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 91,772,927 - 91,827,231 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 91,773,004 - 91,776,397 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 96,287,420 - 96,290,813 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 13 85,332,123 - 85,335,516 (-) NCBI Celera Cytogenetic Map 13 q24 NCBI
.
Predicted Target Of
Count of predictions: 31 Count of miRNA genes: 31 Interacting mature miRNAs: 31 Transcripts: ENSMUST00000027816 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1558802 Skmw6_m skeletal muscle weight 6 (mouse) Not determined 1 167954584 195154279 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 4141878 Qrr1_m QTL rich region on chromosome 1 (mouse) Not determined 170878743 175320066 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 1357854 Sle16_m systematic lupus erythematosus susceptibility 16 (mouse) Not determined 1 169038741 177377587 Mouse 4142389 Scfr1_m stem cell frequency regulator 1 (mouse) Not determined 171632048 189303617 Mouse 12790984 Pcho7_m plasma cholesterol 7 (mouse) 1 147219390 181219390 Mouse 1301016 Szs1_m seizure susceptibility 1 (mouse) Not determined 1 170878743 174456436 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 1301251 Scc3_m colon tumor susceptibility 3 (mouse) Not determined 1 168213823 195154279 Mouse 12790996 Aath2_m aortic arch atherosclerosis 2 (mouse) 1 145077630 179077630 Mouse 12791001 Aath6_m aortic arch atherosclerosis 6 (mouse) 1 147219390 181219390 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 4141346 Skmw12_m skeletal muscle weight 12 (mouse) Not determined 150756737 184756922 Mouse 1357618 Splq5_m spleen weight QTL 5 (mouse) Not determined 1 150193673 188359312 Mouse 1301301 Sle1_m systemic lupus erythmatosus susceptibility 1 (mouse) Not determined 1 152038741 186038913 Mouse 10045887 Cplaq13_m circadian period of locomotor activity 13 (mouse) Not determined 1 172831765 181400659 Mouse 12904936 Edlmmq1_m extensor digitorum longus muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 1301309 Emo1_m emotionality 1 (mouse) Not determined 1 162977097 185994196 Mouse 1301025 Lbw7_m lupus NZB x NZW 7 (mouse) Not determined 1 152038741 186038913 Mouse 10412205 Bbaa30_m B.burgdorferi-associated arthritis 30 (mouse) Not determined 1 169038741 174456436 Mouse 12904944 Tammq1_m tibialis anterior muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 12904957 Gmmq1_m gastrocnemius muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1300777 Chol10_m cholesterol 10 (mouse) Not determined 9 147875502 181875616 Mouse 1302098 Eila1_m ethanol induced locomotor activity 1 (mouse) Not determined 1 112008822 175468938 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1301333 Mop3_m morphine preference 3 (mouse) Not determined 1 167756737 189303617 Mouse 1300571 Opfa_m open field activity (mouse) Not determined 1 144531347 178531592 Mouse 1301339 Hdlq15_m HDL QTL 15 (mouse) Not determined 1 165873675 195154279 Mouse 10043863 Swrl5_m SWR lupus locus 5 (mouse) Not determined 1 172303451 195154279 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 4141165 Bglu3_m blood glucose level 3 (mouse) Not determined 155831765 189831892 Mouse 12792983 Liq1_m limb inflammation QTL 1 (mouse) 1 167586086 191225397 Mouse 1357889 Lprq3_m lipoprotein QTL 3 (mouse) Not determined 1 152038741 186038913 Mouse 4142182 Shali5_m survival time to hyperoxic acute lung injury 5 (mouse) Not determined 155582237 185994196 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1301619 Cafq1_m caffeine metabolism QTL 1 (mouse) Not determined 1 155716221 189716369 Mouse 4141149 Hbnr4_m Heligmosomoides bakeri nematode resistance 4 (mouse) Not determined 147125258 188983224 Mouse 10043899 Hdlq99_m HDL QTL 99 (mouse) Not determined 1 147875502 181875616 Mouse 11537365 Cnes4_m C. neoformans susceptibility locus 4 (mouse) 1 144449142 178449142 Mouse 11081167 Tir8_m trypanosome infection response 8 (mouse) 1 155716221 189716369 Mouse 1302132 Pbw1_m pentobarbital withdrawal QTL 1 (mouse) Not determined 1 155831765 189831892 Mouse 4142159 Nba2_m New Zealand Black autoimmunity 2 (mouse) Not determined 151835111 185835280 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301866 Cplaq3_m circadian period of locomotor activity 3 (mouse) Not determined 1 155721528 189722608 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse 4142149 Ctex_m Ctla4 expression QTL (mouse) Not determined 1 153557406 175468938 Mouse 1301614 Cgnz1_m chronic glomerulonephritis in NZM 1 (mouse) Not determined 1 152038741 186038913 Mouse 12910521 Scgq1_m spontaneous crescentic glomerulonephritis QTL 1 (mouse) 1 156602037 176262693 Mouse 11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4142014 Wbcq5_m white blood cell quantitative locus 5 (mouse) Not determined 1 141095010 175095156 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 4141244 Bmd5c_m bone mineral density 5c (mouse) Not determined 155526796 189526897 Mouse 13464138 Hdlq107_m HDL QTL 107 (mouse) 1 152132744 186132744 Mouse 1301652 Cpfd2_m cerebellum pattern fissures (mouse) Not determined 1 172303451 195154279 Mouse 1300888 Berr1_m berghei resistance locus 1 (mouse) Not determined 1 164143227 190534272 Mouse 1301151 Hdlq14_m HDL QTL 14 (mouse) Not determined 1 142489543 176489734 Mouse 4141233 Femwf12_m femur work to failure 12 (mouse) Not determined 141233173 175233272 Mouse 1301122 Cd8mts1_m CD8 T memory cell subset 1 (mouse) Not determined 1 155831765 189831892 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 4141483 Femwf7_m femur work to failure 7 (mouse) Not determined 167462514 195154279 Mouse 1301385 Radpf2_m radiation pulmonary fibrosis 2 (mouse) Not determined 1 147125258 182873798 Mouse 1301134 Bmd1_m bone mineral density 1 (mouse) Not determined 1 156602037 189303617 Mouse 1302158 Fembrs5_m femur breaking strength 5 (mouse) Not determined 1 167462514 195154279 Mouse 1301132 Mors1_m modifier of obesity related sterility 1 (mouse) Not determined 1 170379500 195154279 Mouse 1357493 Lgaq3_m late growth adjusted QTL 3 (mouse) Not determined 1 150193673 188359312 Mouse 11251722 Ewc1_m ethanol withdrawal and consumption 1 (mouse) 1 152132744 186132744 Mouse 10043963 Obq25_m obesity QTL 25 (mouse) Not determined 1 154410512 188410512 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 1357732 Tbbmd1_m total body bone mineral density 1 (mouse) Not determined 1 171983110 195154279 Mouse 10412074 Nhdlt1_m non-HDL cholesterol and triglyceride levels 1 (mouse) Not determined 1 153675990 187676105 Mouse 1357485 Lgq4_m late growth QTL 4 (mouse) Not determined 1 150193673 188359312 Mouse 1301932 Ssta2_m susceptibility to Salmonella typhimurium antigens 2 (mouse) Not determined 1 155716221 189716369 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 10054490 Opefa_m open field activity (mouse) Not determined 1 153712853 187712853 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301467 Pcir1_m periosteal circumference 1 (mouse) Not determined 1 141233173 175233272 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 4141554 Cfmq1_m cystic fibrosis modifier QTL 1 (mouse) Not determined 1 152038741 186038913 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 11049575 Lmr8b_m leishmaniasis resistance 8b (mouse) 1 172303451 195154279 Mouse 1301191 Stia1_m serum transfer induced arthritis 1 (mouse) Not determined 1 141233173 175233272 Mouse 1300934 Cfbw1_m cystic fibrosis body weight 1 (mouse) Not determined 1 145145207 179145325 Mouse 1301189 Lmr8_m leishmaniasis resistance 8 (mouse) Not determined 1 156602037 189303617 Mouse 1558720 Bpq8_m blood pressure QTL 8 (mouse) Not determined 1 143284665 177284803 Mouse 13207571 Tcq11_m total cholesterol QTL 11 (mouse) 1 169137569 179647565 Mouse 10766456 Sle21_m systematic lupus erythematosus susceptibility 21 (mouse) 1 155831765 189831892 Mouse 27095935 Ulnl5_m ulna length 5, 10 week (mouse) 1 128727737 181327565 Mouse 1300727 Mptp1_m MPTP sensitivity 1 (mouse) Not determined 1 171632048 192681050 Mouse 10054271 Nba9_m New Zealand Black autoimmunity 9 (mouse) Not determined 1 155525623 189527533 Mouse 10054270 Nba10_m New Zealand Black autoimmunity 10 (mouse) Not determined 1 152794822 186438620 Mouse 1559024 Zit1_m zinc induced tolerance 1 (mouse) Not determined 1 167462514 195154279 Mouse 12880429 V25Dq1_m vitamin D inactive form serum level QTL 1 (mouse) 1 172632197 195154279 Mouse 4142291 Aec2_m autoimmune exocrinopathy 2 (mouse) Not determined 52457737 182250592 Mouse 12880426 V25Dq2_m vitamin D inactive form serum level QTL 2 (mouse) 1 172532197 195154279 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 27095915 Scvln13_m sacral vertebrae length 2, 16 week (mouse) 1 117527730 179827565 Mouse 11533913 Rd6m1_m retinal degeneration 6 modifier 1 (mouse) 1 141233173 175233272 Mouse 26884448 Sklq1_m skull length QTL 1, 5 week (mouse) 1 75976637 181327565 Mouse 1300969 Sluc5_m susceptibility to lung cancer 5 (mouse) Not determined 1 151186243 185186402 Mouse
AV054416
Mouse Assembly Chr Position (strand) Source JBrowse MGSCv37 1 176,262,769 - 176,262,914 UniSTS GRCm37 MGSCv37 1 175,204,598 - 175,204,743 UniSTS GRCm37 Celera 1 181,425,565 - 181,425,710 UniSTS Celera 1 180,290,374 - 180,290,519 UniSTS Celera 1 176,122,084 - 176,122,229 UniSTS Cytogenetic Map 1 H3 UniSTS Whitehead/MRC_RH 1 2191.93 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000027816 ⟹ ENSMUSP00000027816
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 174,158,084 - 174,160,439 (+) Ensembl GRCm38.p6 Ensembl 1 174,330,518 - 174,332,873 (+) Ensembl
RefSeq Acc Id:
NM_025470 ⟹ NP_079746
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 174,158,085 - 174,160,443 (+) NCBI GRCm38 1 174,330,518 - 174,332,877 (+) ENTREZGENE MGSCv37 1 176,260,649 - 176,263,008 (+) RGD Celera 1 180,288,255 - 180,290,613 (+) NCBI Celera 1 181,422,551 - 181,425,804 (+) ENTREZGENE cM Map 1 ENTREZGENE
Sequence:
CACAGAGATGAGGGTTGCTGATCTCCCACTACTGGAATTGTCCAAGAAGAGCACAATGGAGAAGCTTATTGTGGGCATCCTGTTTCTCTCTGTTCTTTCAGGAAGTGTAGCAGAAACAGACATGAAGG GAAAGGCATTTATTTTCCCTCAAGAATCATCCACTGCCTATGTGTCCCTGATACCGAAGGTGAGGAAGTCACTGCAGAACTTCACTCTGTGTATGAAGACCTTCACAGACTTGACGCGCCCTTACAGC ATCTTCTCCTACAACACAAGAAACCAGGACAATGAGATTCTTCTCTTTGTGGAAAATATAGGAGAATACATGTTCTATGTTGGGAATATGGTAGCCACTTTCAAAGCACCCACAAATCTTCCTGATCC GGCCCGTATCTGTGTGAACTGGGAGTCTGGCTCTGGGATTGCAGAATTCTGGCTGAATGGAAAACCACTGGGGAGGAAAGGCTTGAAGAAGGGATACACTGTGGGGGGTGATGCAATGATCACTCTAG GACAAGAGCAGGATTCCTATGGGGGAAATTTTGATGCAAAGCAATCCTTTGTTGGGGAGATATGGGATGTTTCCTTGTGGGACCATGTGGTCCCCCTAGAAAAGGTATCAGACAGCTGTAACAATGGC AACCTTATAAACTGGCAAGCTCTTAATTATGAAGACAATGGCTATGTGGTGACTAAGCCCAAACTGTGGCCTTAAGCTAATTGCTCTATGAAATATAAGTCTGCTTTTGGTTCTGTTAAAATGATAAT GTGCATTGCATTAAAAAAGCAAAGAAATGAGCATC
hide sequence
RefSeq Acc Id:
NP_079746 ⟸ NM_025470
- Peptide Label:
precursor
- UniProtKB:
Q9D8J8 (UniProtKB/Swiss-Prot), Q8R1M8 (UniProtKB/Swiss-Prot), A0A0R4J077 (UniProtKB/TrEMBL)
- Sequence:
MEKLIVGILFLSVLSGSVAETDMKGKAFIFPQESSTAYVSLIPKVRKSLQNFTLCMKTFTDLTRPYSIFSYNTRNQDNEILLFVENIGEYMFYVGNMVATFKAPTNLPDPARICVNWESGSGIAEFWL NGKPLGRKGLKKGYTVGGDAMITLGQEQDSYGGNFDAKQSFVGEIWDVSLWDHVVPLEKVSDSCNNGNLINWQALNYEDNGYVVTKPKLWP
hide sequence
Ensembl Acc Id:
ENSMUSP00000027816 ⟸ ENSMUST00000027816
RGD ID: 6875830
Promoter ID: EPDNEW_M1366
Type: single initiation site
Name: Mptx1_1
Description: Mus musculus mucosal pentraxin 1 , mRNA.
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 174,330,519 - 174,330,579 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-02-20
Mptx1
mucosal pentraxin 1
1810030J14Rik
RIKEN cDNA 1810030J14 gene
Symbol and/or name change
5135510
APPROVED