Symbol:
Plk2
Name:
polo like kinase 2
RGD ID:
733048
MGI Page
MGI
Description:
Enables protein serine/threonine kinase activity. Involved in several processes, including negative regulation of apoptotic process in bone marrow cell; negative regulation of cellular senescence; and positive regulation of cell migration involved in sprouting angiogenesis. Acts upstream of or within mitotic cell cycle. Located in chromatin. Is expressed in several structures, including alimentary system; hindlimb interdigital region; integumental system; nervous system; and skeleton. Orthologous to human PLK2 (polo like kinase 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
PLK-2; polo-like kinase 2; S; serine/threonine-protein kinase PLK2; serine/threonine-protein kinase SNK; serum-inducible kinase; Snk
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PLK2 (polo like kinase 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Plk2 (polo-like kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Plk2 (polo like kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PLK2 (polo like kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PLK2 (polo like kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Plk2 (polo like kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PLK2 (polo like kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PLK2 (polo like kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Plk2 (polo like kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PLK3 (polo like kinase 3) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Plk2 (polo-like kinase 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PLK2 (polo like kinase 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
plk2b (polo-like kinase 2b (Drosophila))
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER|ZFIN)
Danio rerio (zebrafish):
plk2a (polo-like kinase 2a (Drosophila))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
CDC5
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
plk2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 110,531,578 - 110,537,378 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 110,531,580 - 110,537,378 (+) Ensembl GRCm39 Ensembl GRCm38 13 110,395,044 - 110,400,844 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 110,395,046 - 110,400,844 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 111,185,252 - 111,191,052 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 111,515,940 - 111,521,722 (+) NCBI MGSCv36 mm8 Celera 13 114,729,888 - 114,735,651 (+) NCBI Celera Cytogenetic Map 13 D2.1 NCBI cM Map 13 61.97 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Plk2 Mouse (+)-schisandrin B multiple interactions ISO Plk2 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PLK2 mRNA] CTD PMID:31150632 Plk2 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO PLK2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PLK2 mRNA CTD PMID:22079256 Plk2 Mouse (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of PLK2 mRNA CTD PMID:17456735 Plk2 Mouse 1,1-dichloroethene increases expression EXP 6480464 vinylidene chloride results in increased expression of PLK2 mRNA CTD PMID:26682919 Plk2 Mouse 1,2-dimethylhydrazine increases expression ISO Plk2 (Rattus norvegicus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PLK2 mRNA CTD PMID:27840820 Plk2 Mouse 1,3-dinitrobenzene increases expression ISO Plk2 (Rattus norvegicus) 6480464 3-dinitrobenzene results in increased expression of PLK2 mRNA CTD PMID:22841810 Plk2 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of PLK2 mRNA CTD PMID:17555576 Plk2 Mouse 17alpha-ethynylestradiol decreases expression ISO Plk2 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in decreased expression of PLK2 mRNA CTD PMID:16174780 Plk2 Mouse 17alpha-ethynylestradiol increases expression ISO Plk2 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of PLK2 mRNA CTD PMID:17351261 Plk2 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PLK2 mRNA CTD PMID:25210133 Plk2 Mouse 17beta-estradiol decreases expression ISO Plk2 (Rattus norvegicus) 6480464 Estradiol results in decreased expression of PLK2 mRNA CTD PMID:32145629 Plk2 Mouse 17beta-estradiol affects expression ISO PLK2 (Homo sapiens) 6480464 Estradiol affects the expression of PLK2 mRNA CTD PMID:14699072 and PMID:22574217 Plk2 Mouse 17beta-estradiol decreases expression ISO PLK2 (Homo sapiens) 6480464 Estradiol results in decreased expression of PLK2 mRNA CTD PMID:16202921 more ... Plk2 Mouse 17beta-estradiol multiple interactions ISO PLK2 (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of PLK2 mRNA more ... CTD PMID:20404318 more ... Plk2 Mouse 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of PLK2 mRNA CTD PMID:15598610 Plk2 Mouse 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO PLK2 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of PLK2 mRNA CTD PMID:29581250 Plk2 Mouse 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO PLK2 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Plk2 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin affects the methylation of PLK2 intron] which results in increased expression of PLK2 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to PLK2 promoter] CTD PMID:19654925 and PMID:33017471 Plk2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Plk2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PLK2 mRNA CTD PMID:33387578 and PMID:34747641 Plk2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLK2 mRNA CTD PMID:25975270 Plk2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PLK2 mRNA CTD PMID:16962184 and PMID:21570461 Plk2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Plk2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of PLK2 mRNA CTD PMID:22298810 Plk2 Mouse 2,4-dinitrotoluene affects expression ISO Plk2 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of PLK2 mRNA CTD PMID:21346803 Plk2 Mouse 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of PLK2 mRNA CTD PMID:21607683 Plk2 Mouse 2-butoxyethanol increases expression EXP 6480464 n-butoxyethanol results in increased expression of PLK2 mRNA CTD PMID:19812364 Plk2 Mouse 3,3',5,5'-tetrabromobisphenol A increases expression EXP 6480464 tetrabromobisphenol A results in increased expression of PLK2 mRNA CTD PMID:25172293 Plk2 Mouse 3,4-dichloroaniline decreases expression ISO PLK2 (Homo sapiens) 6480464 3 and 4-dichloroaniline results in decreased expression of PLK2 mRNA CTD PMID:24172598 Plk2 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of PLK2 mRNA CTD PMID:16054899 Plk2 Mouse 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression ISO Plk2 (Rattus norvegicus) 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of PLK2 mRNA CTD PMID:23052194 Plk2 Mouse 4-hydroxynon-2-enal increases expression EXP 6480464 4-hydroxy-2-nonenal results in increased expression of PLK2 mRNA CTD PMID:19191707 Plk2 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of PLK2 mRNA CTD PMID:28973697 Plk2 Mouse 5-aza-2'-deoxycytidine increases expression ISO PLK2 (Homo sapiens) 6480464 Decitabine results in increased expression of PLK2 mRNA CTD PMID:23300844 Plk2 Mouse 5-fluorouracil increases expression ISO PLK2 (Homo sapiens) 6480464 Fluorouracil results in increased expression of PLK2 mRNA CTD PMID:17982676 Plk2 Mouse 5-fluorouracil multiple interactions ISO PLK2 (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in increased expression of PLK2 mRNA] and TP53 protein promotes the reaction [Fluorouracil results in increased expression of PLK2 mRNA] CTD PMID:15016801 and PMID:17982676 Plk2 Mouse 6-O-methylguanine multiple interactions ISO PLK2 (Homo sapiens) 6480464 [O(6)-benzylguanine co-treated with O-(6)-methylguanine] results in decreased expression of PLK2 mRNA CTD PMID:29666243 Plk2 Mouse 7,12-dimethyltetraphene increases expression ISO Plk2 (Rattus norvegicus) 6480464 9 more ... CTD PMID:12376462 Plk2 Mouse 7,12-dimethyltetraphene increases expression ISO Plk2 (Rattus norvegicus) 2292404 DMBA increases expression of Plk2 mRNA and protein in rat mammary gland RGD Plk2 Mouse 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:32553695 Plk2 Mouse acetamide increases expression ISO Plk2 (Rattus norvegicus) 6480464 acetamide results in increased expression of PLK2 mRNA CTD PMID:31881176 Plk2 Mouse acrylamide decreases expression ISO Plk2 (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of PLK2 mRNA CTD PMID:28959563 Plk2 Mouse acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PLK2 mRNA CTD PMID:30807115 Plk2 Mouse aflatoxin B1 affects expression ISO PLK2 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of PLK2 protein CTD PMID:20106945 Plk2 Mouse aflatoxin B1 increases expression ISO PLK2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PLK2 mRNA CTD PMID:21632981 more ... Plk2 Mouse aflatoxin B1 increases expression ISO Plk2 (Rattus norvegicus) 6480464 Aflatoxin B1 results in increased expression of PLK2 mRNA CTD PMID:22484513 more ... Plk2 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PLK2 mRNA CTD PMID:19770486 Plk2 Mouse all-trans-retinoic acid increases expression ISO PLK2 (Homo sapiens) 6480464 Tretinoin results in increased expression of PLK2 mRNA CTD PMID:17431108 more ... Plk2 Mouse ammonium chloride affects expression ISO Plk2 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of PLK2 mRNA CTD PMID:16483693 Plk2 Mouse antirheumatic drug increases expression ISO PLK2 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PLK2 mRNA CTD PMID:24449571 Plk2 Mouse aristolochic acid A decreases expression ISO PLK2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PLK2 mRNA and aristolochic acid I results in decreased expression of PLK2 protein CTD PMID:33212167 Plk2 Mouse Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PLK2 mRNA CTD PMID:23650126 Plk2 Mouse azoxystrobin multiple interactions ISO Plk2 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of PLK2 mRNA CTD PMID:33854195 Plk2 Mouse benzalkonium chloride decreases expression ISO PLK2 (Homo sapiens) 6480464 Benzalkonium Compounds results in decreased expression of PLK2 mRNA CTD PMID:37149095 Plk2 Mouse benzene increases expression EXP 6480464 Benzene results in increased expression of PLK2 and Benzene results in increased expression of PLK2 mRNA CTD PMID:12928149 and PMID:15935813 Plk2 Mouse benzene increases expression ISO PLK2 (Homo sapiens) 6480464 Benzene results in increased expression of PLK2 mRNA CTD PMID:19162166 Plk2 Mouse benzene multiple interactions EXP 6480464 TRP53 protein promotes the reaction [Benzene results in increased expression of PLK2] CTD PMID:15935813 Plk2 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of PLK2 mRNA CTD PMID:19770486 more ... Plk2 Mouse benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PLK2 mRNA CTD PMID:27858113 Plk2 Mouse benzo[a]pyrene increases expression ISO PLK2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PLK2 mRNA CTD PMID:17879257 more ... Plk2 Mouse benzo[a]pyrene diol epoxide I increases expression ISO PLK2 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Plk2 Mouse benzo[b]fluoranthene increases expression EXP 6480464 benzo(b)fluoranthene results in increased expression of PLK2 mRNA CTD PMID:26377693 Plk2 Mouse benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PLK2 mRNA CTD PMID:27858113 Plk2 Mouse Benzo[k]fluoranthene increases expression EXP 6480464 benzo(k)fluoranthene results in increased expression of PLK2 mRNA CTD PMID:26377693 Plk2 Mouse bis(2-chloroethyl) sulfide affects expression ISO Plk2 (Rattus norvegicus) 6480464 Mustard Gas affects the expression of PLK2 mRNA CTD PMID:15651846 Plk2 Mouse bisphenol A increases expression ISO Plk2 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of PLK2 mRNA CTD PMID:25181051 and PMID:38750585 Plk2 Mouse bisphenol A decreases expression ISO Plk2 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of PLK2 mRNA CTD PMID:32145629 Plk2 Mouse bisphenol A increases expression ISO PLK2 (Homo sapiens) 6480464 bisphenol A results in increased expression of PLK2 mRNA CTD PMID:27685785 Plk2 Mouse butan-1-ol multiple interactions ISO PLK2 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of PLK2 mRNA CTD PMID:29432896 Plk2 Mouse butanal increases expression ISO PLK2 (Homo sapiens) 6480464 butyraldehyde results in increased expression of PLK2 mRNA CTD PMID:26079696 Plk2 Mouse cadmium dichloride increases expression ISO PLK2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PLK2 mRNA CTD PMID:26472689 Plk2 Mouse calciol increases expression EXP 6480464 Cholecalciferol results in increased expression of PLK2 mRNA CTD PMID:16508948 Plk2 Mouse cannabidiol increases expression EXP 6480464 Cannabidiol results in increased expression of PLK2 mRNA CTD PMID:21542829 Plk2 Mouse carbamazepine affects expression ISO PLK2 (Homo sapiens) 6480464 Carbamazepine affects the expression of PLK2 mRNA CTD PMID:25979313 Plk2 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes and Carbon results in decreased expression of PLK2 mRNA CTD PMID:25554681 Plk2 Mouse carbonyl sulfide decreases expression ISO Plk2 (Rattus norvegicus) 6480464 carbonyl sulfide results in decreased expression of PLK2 mRNA CTD PMID:19395590 Plk2 Mouse chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of PLK2 mRNA CTD PMID:23125180 Plk2 Mouse chlorpyrifos multiple interactions ISO Plk2 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of PLK2 mRNA CTD PMID:33854195 Plk2 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of PLK2 mRNA CTD PMID:37019170 Plk2 Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of PLK2 mRNA CTD PMID:28472532 Plk2 Mouse chromium(6+) multiple interactions ISO PLK2 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of PLK2 mRNA CTD PMID:38479592 Plk2 Mouse chromium(6+) affects expression ISO PLK2 (Homo sapiens) 6480464 chromium hexavalent ion affects the expression of PLK2 mRNA CTD PMID:30690063 Plk2 Mouse chrysene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PLK2 mRNA CTD PMID:27858113 Plk2 Mouse ciguatoxin CTX1B affects expression EXP 6480464 Ciguatoxins affects the expression of PLK2 mRNA CTD PMID:18353800 Plk2 Mouse cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of PLK2 mRNA and Cisplatin results in increased expression of PLK2 protein CTD PMID:25270620 and PMID:35842499 Plk2 Mouse cisplatin increases expression ISO Plk2 (Rattus norvegicus) 6480464 Cisplatin results in increased expression of PLK2 mRNA and Cisplatin results in increased expression of PLK2 protein CTD PMID:35842499 Plk2 Mouse cisplatin multiple interactions ISO Plk2 (Rattus norvegicus) 6480464 Cisplatin promotes the reaction [NFE2L2 protein modified form binds to PLK2 protein] more ... CTD PMID:35842499 Plk2 Mouse cisplatin affects localization ISO Plk2 (Rattus norvegicus) 6480464 Cisplatin affects the localization of PLK2 protein CTD PMID:35842499 Plk2 Mouse cisplatin multiple interactions EXP 6480464 NFE2L2 protein affects the reaction [Cisplatin results in increased expression of PLK2 mRNA] CTD PMID:35842499 Plk2 Mouse cisplatin increases expression ISO PLK2 (Homo sapiens) 6480464 Cisplatin results in increased expression of PLK2 mRNA CTD PMID:21532991 and PMID:23300844 Plk2 Mouse clobetasol increases expression EXP 6480464 Clobetasol results in increased expression of PLK2 mRNA CTD PMID:27462272 Plk2 Mouse clofibrate multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of PLK2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of PLK2 mRNA] CTD PMID:17585979 Plk2 Mouse cobalt dichloride decreases expression ISO PLK2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PLK2 mRNA CTD PMID:19320972 Plk2 Mouse copper atom decreases expression ISO Plk2 (Rattus norvegicus) 6480464 Copper results in decreased expression of PLK2 mRNA CTD PMID:30556269 Plk2 Mouse copper(0) decreases expression ISO Plk2 (Rattus norvegicus) 6480464 Copper results in decreased expression of PLK2 mRNA CTD PMID:30556269 Plk2 Mouse copper(II) sulfate increases expression ISO PLK2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PLK2 mRNA CTD PMID:19549813 Plk2 Mouse corticosterone decreases expression ISO Plk2 (Rattus norvegicus) 6480464 Corticosterone results in decreased expression of PLK2 mRNA CTD PMID:15755911 Plk2 Mouse coumarin decreases phosphorylation ISO PLK2 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of PLK2 protein CTD PMID:35688186 Plk2 Mouse CU-O LINKAGE decreases expression ISO PLK2 (Homo sapiens) 6480464 cupric oxide results in decreased expression of PLK2 mRNA CTD PMID:22077320 Plk2 Mouse Cuprizon decreases expression ISO Plk2 (Rattus norvegicus) 6480464 Cuprizone results in decreased expression of PLK2 mRNA CTD PMID:26577399 Plk2 Mouse curcumin increases expression ISO PLK2 (Homo sapiens) 6480464 Curcumin analog results in increased expression of PLK2 mRNA CTD PMID:26409325 Plk2 Mouse cyclosporin A increases expression ISO PLK2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PLK2 mRNA CTD PMID:25562108 Plk2 Mouse cyclosporin A decreases expression ISO PLK2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PLK2 mRNA CTD PMID:27989131 Plk2 Mouse cylindrospermopsin increases expression ISO PLK2 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of PLK2 mRNA CTD PMID:24921660 Plk2 Mouse dexamethasone multiple interactions EXP 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of PLK2 mRNA CTD PMID:16054899 Plk2 Mouse dexamethasone decreases expression ISO PLK2 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of PLK2 mRNA CTD PMID:25047013 Plk2 Mouse diazinon affects expression ISO Plk2 (Rattus norvegicus) 6480464 Diazinon affects the expression of PLK2 mRNA CTD PMID:22546817 Plk2 Mouse dibenz[a,h]anthracene increases expression EXP 6480464 1 more ... CTD PMID:26377693 Plk2 Mouse Dibutyl phosphate affects expression ISO PLK2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PLK2 mRNA CTD PMID:37042841 Plk2 Mouse dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of PLK2 mRNA CTD PMID:21266533 Plk2 Mouse dibutyl phthalate increases expression ISO Plk2 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of PLK2 mRNA CTD PMID:21266533 Plk2 Mouse dicrotophos decreases expression ISO PLK2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of PLK2 mRNA CTD PMID:28302478 Plk2 Mouse dieldrin affects expression ISO Plk2 (Rattus norvegicus) 6480464 Dieldrin affects the expression of PLK2 mRNA CTD PMID:22546817 Plk2 Mouse dinophysistoxin 1 increases expression ISO PLK2 (Homo sapiens) 6480464 dinophysistoxin 1 results in increased expression of PLK2 mRNA CTD PMID:28939011 Plk2 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PLK2 mRNA CTD PMID:30529165 Plk2 Mouse disodium selenite decreases expression ISO PLK2 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of PLK2 mRNA CTD PMID:18175754 Plk2 Mouse disodium selenite increases expression ISO PLK2 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of PLK2 mRNA CTD PMID:24383545 Plk2 Mouse diuron decreases expression ISO PLK2 (Homo sapiens) 6480464 Diuron metabolite results in decreased expression of PLK2 mRNA CTD PMID:24172598 Plk2 Mouse dorsomorphin multiple interactions ISO PLK2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Plk2 Mouse doxorubicin affects expression ISO PLK2 (Homo sapiens) 6480464 Doxorubicin affects the expression of PLK2 mRNA CTD PMID:29803840 Plk2 Mouse Echimidine multiple interactions ISO PLK2 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of echimidine] which affects the expression of PLK2 mRNA CTD PMID:33884520 Plk2 Mouse endosulfan decreases expression ISO Plk2 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of PLK2 mRNA CTD PMID:29391264 Plk2 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of PLK2 mRNA CTD PMID:30319688 Plk2 Mouse etoposide increases expression ISO PLK2 (Homo sapiens) 6480464 Etoposide results in increased expression of PLK2 mRNA CTD PMID:21527772 Plk2 Mouse ferric oxide increases expression EXP 6480464 ferric oxide analog results in increased expression of PLK2 mRNA CTD PMID:25086211 Plk2 Mouse ferroheme b increases expression EXP 6480464 Heme metabolite results in increased expression of PLK2 mRNA CTD PMID:19191707 Plk2 Mouse fluoranthene multiple interactions EXP 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of PLK2 mRNA CTD PMID:28329830 Plk2 Mouse fonofos increases methylation ISO PLK2 (Homo sapiens) 6480464 Fonofos results in increased methylation of PLK2 promoter CTD PMID:22847954 Plk2 Mouse formaldehyde increases expression ISO PLK2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of PLK2 mRNA CTD PMID:17938736 Plk2 Mouse genistein decreases expression ISO PLK2 (Homo sapiens) 6480464 Genistein results in decreased expression of PLK2 mRNA CTD PMID:23019147 Plk2 Mouse gentamycin increases expression ISO Plk2 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of PLK2 mRNA CTD PMID:22061828 and PMID:33387578 Plk2 Mouse glafenine decreases expression ISO Plk2 (Rattus norvegicus) 6480464 Glafenine results in decreased expression of PLK2 mRNA CTD PMID:24136188 Plk2 Mouse glyphosate multiple interactions ISO Plk2 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of PLK2 mRNA CTD PMID:33854195 Plk2 Mouse heme b increases expression EXP 6480464 Heme metabolite results in increased expression of PLK2 mRNA CTD PMID:19191707 Plk2 Mouse hydrogen cyanide decreases expression EXP 6480464 Hydrogen Cyanide results in decreased expression of PLK2 mRNA CTD PMID:33914522 Plk2 Mouse hydrogen peroxide affects expression ISO PLK2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PLK2 mRNA CTD PMID:20044591 Plk2 Mouse hydrogen peroxide multiple interactions ISO Plk2 (Rattus norvegicus) 6480464 PLK2 protein affects the reaction [Hydrogen Peroxide affects the expression of NFE2L2 protein] more ... CTD PMID:34047419 Plk2 Mouse hydrogen peroxide decreases response to substance ISO Plk2 (Rattus norvegicus) 6480464 PLK2 protein results in decreased susceptibility to Hydrogen Peroxide CTD PMID:34047419 Plk2 Mouse hydrogen peroxide increases expression ISO Plk2 (Rattus norvegicus) 6480464 Hydrogen Peroxide results in increased expression of PLK2 mRNA and Hydrogen Peroxide results in increased expression of PLK2 protein CTD PMID:34047419 Plk2 Mouse imidacloprid multiple interactions ISO Plk2 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of PLK2 mRNA CTD PMID:33854195 Plk2 Mouse indometacin decreases expression ISO PLK2 (Homo sapiens) 6480464 Indomethacin results in decreased expression of PLK2 mRNA CTD PMID:16984733 Plk2 Mouse irinotecan increases expression ISO PLK2 (Homo sapiens) 6480464 Irinotecan metabolite results in increased expression of PLK2 mRNA and Irinotecan results in increased expression of PLK2 mRNA CTD PMID:15956246 Plk2 Mouse iron(III) nitrilotriacetate increases expression ISO Plk2 (Rattus norvegicus) 6480464 ferric nitrilotriacetate results in increased expression of PLK2 mRNA CTD PMID:23208426 Plk2 Mouse isobutanol multiple interactions ISO PLK2 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of PLK2 mRNA CTD PMID:29432896 Plk2 Mouse L-ascorbic acid decreases expression ISO Plk2 (Rattus norvegicus) 6480464 Ascorbic Acid results in decreased expression of PLK2 mRNA CTD PMID:15372504 Plk2 Mouse Lasiocarpine multiple interactions ISO PLK2 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of lasiocarpine] which results in increased expression of PLK2 mRNA CTD PMID:33884520 Plk2 Mouse leflunomide increases expression ISO PLK2 (Homo sapiens) 6480464 leflunomide results in increased expression of PLK2 mRNA CTD PMID:28988120 Plk2 Mouse Licochalcone B increases expression ISO PLK2 (Homo sapiens) 6480464 licochalcone B results in increased expression of PLK2 mRNA CTD PMID:33647349 Plk2 Mouse lipopolysaccharide multiple interactions ISO PLK2 (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of PLK2 mRNA CTD PMID:35877022 Plk2 Mouse mercury dibromide increases expression ISO PLK2 (Homo sapiens) 6480464 mercuric bromide results in increased expression of PLK2 mRNA CTD PMID:26272509 Plk2 Mouse mercury dibromide multiple interactions ISO PLK2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLK2 mRNA CTD PMID:27188386 Plk2 Mouse mercury dichloride increases expression ISO Plk2 (Rattus norvegicus) 6480464 Mercuric Chloride results in increased expression of PLK2 mRNA CTD PMID:16507785 Plk2 Mouse metformin increases expression ISO Plk2 (Rattus norvegicus) 6480464 Metformin results in increased expression of PLK2 mRNA CTD PMID:31324951 Plk2 Mouse methapyrilene increases expression ISO Plk2 (Rattus norvegicus) 6480464 Methapyrilene results in increased expression of PLK2 mRNA CTD PMID:30467583 Plk2 Mouse methotrexate multiple interactions ISO Plk2 (Rattus norvegicus) 6480464 PLK2 protein affects the reaction [Methotrexate results in increased expression of NFE2L2 protein] CTD PMID:35842499 Plk2 Mouse methotrexate increases expression ISO Plk2 (Rattus norvegicus) 6480464 Methotrexate results in increased expression of PLK2 protein CTD PMID:35842499 Plk2 Mouse methoxyacetic acid increases expression ISO PLK2 (Homo sapiens) 6480464 methoxyacetic acid results in increased expression of PLK2 mRNA CTD PMID:15103026 Plk2 Mouse methylmercury chloride increases expression ISO PLK2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PLK2 mRNA CTD PMID:23179753 more ... Plk2 Mouse methylmercury chloride decreases expression ISO PLK2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PLK2 mRNA CTD PMID:34089799 Plk2 Mouse methylmercury chloride multiple interactions ISO PLK2 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLK2 mRNA CTD PMID:27188386 Plk2 Mouse monocrotaline multiple interactions ISO PLK2 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of Monocrotaline] which affects the expression of PLK2 mRNA CTD PMID:33884520 Plk2 Mouse N-ethyl-N-nitrosourea increases expression EXP 6480464 Ethylnitrosourea results in increased expression of PLK2 mRNA CTD PMID:19100860 Plk2 Mouse N-methyl-4-phenylpyridinium increases expression ISO Plk2 (Rattus norvegicus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PLK2 mRNA CTD PMID:16026605 Plk2 Mouse N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of PLK2 mRNA CTD PMID:19100860 and PMID:21607683 Plk2 Mouse N-Nitrosopyrrolidine increases expression ISO PLK2 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of PLK2 mRNA CTD PMID:32234424 Plk2 Mouse naphthalenes increases expression ISO Plk2 (Rattus norvegicus) 6480464 Naphthalenes results in increased expression of PLK2 protein CTD PMID:17337753 Plk2 Mouse nickel dichloride affects expression ISO Plk2 (Rattus norvegicus) 6480464 nickel chloride affects the expression of PLK2 mRNA CTD PMID:22546817 Plk2 Mouse nickel sulfate decreases expression ISO PLK2 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of PLK2 mRNA CTD PMID:22714537 Plk2 Mouse nicotine increases expression EXP 6480464 Nicotine results in increased expression of PLK2 mRNA CTD PMID:17456735 Plk2 Mouse ochratoxin A increases expression ISO Plk2 (Rattus norvegicus) 6480464 ochratoxin A results in increased expression of PLK2 mRNA CTD PMID:23208426 and PMID:23358140 Plk2 Mouse oxaliplatin increases expression ISO Plk2 (Rattus norvegicus) 6480464 oxaliplatin results in increased expression of PLK2 mRNA CTD PMID:25729387 Plk2 Mouse oxaliplatin multiple interactions ISO Plk2 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PLK2 mRNA CTD PMID:25729387 Plk2 Mouse ozone increases expression ISO Plk2 (Rattus norvegicus) 6480464 Ozone results in increased expression of PLK2 mRNA CTD PMID:28623178 Plk2 Mouse ozone increases expression ISO PLK2 (Homo sapiens) 6480464 Ozone results in increased expression of PLK2 mRNA CTD PMID:23033980 Plk2 Mouse p-chloromercuribenzoic acid increases expression ISO PLK2 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of PLK2 mRNA CTD PMID:26272509 Plk2 Mouse p-chloromercuribenzoic acid multiple interactions ISO PLK2 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLK2 mRNA CTD PMID:27188386 Plk2 Mouse paracetamol multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of PLK2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of PLK2 mRNA] CTD PMID:17585979 Plk2 Mouse paracetamol increases expression ISO Plk2 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of PLK2 mRNA CTD PMID:33387578 Plk2 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of PLK2 mRNA CTD PMID:17562736 Plk2 Mouse parathion increases methylation ISO PLK2 (Homo sapiens) 6480464 Parathion results in increased methylation of PLK2 promoter CTD PMID:22847954 Plk2 Mouse perfluorooctane-1-sulfonic acid decreases expression ISO Plk2 (Rattus norvegicus) 6480464 perfluorooctane sulfonic acid results in decreased expression of PLK2 mRNA CTD PMID:18692542 Plk2 Mouse perfluorooctane-1-sulfonic acid increases expression ISO PLK2 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of PLK2 mRNA CTD PMID:27153767 Plk2 Mouse phenobarbital affects expression ISO PLK2 (Homo sapiens) 6480464 Phenobarbital affects the expression of PLK2 mRNA CTD PMID:19159669 Plk2 Mouse phenylmercury acetate increases expression ISO PLK2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PLK2 mRNA CTD PMID:26272509 Plk2 Mouse phenylmercury acetate multiple interactions ISO PLK2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLK2 mRNA CTD PMID:27188386 Plk2 Mouse PhIP increases expression ISO Plk2 (Rattus norvegicus) 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of PLK2 mRNA CTD PMID:12376462 Plk2 Mouse PhIP increases expression ISO Plk2 (Rattus norvegicus) 2292404 PhIP increases expression of Plk2 mRNA and protein in rat mammary gland RGD Plk2 Mouse pirinixic acid multiple interactions ISO PLK2 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of PLK2 mRNA CTD PMID:19710929 Plk2 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PLK2 mRNA CTD PMID:18301758 Plk2 Mouse potassium chromate multiple interactions ISO PLK2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PLK2 mRNA CTD PMID:22079256 Plk2 Mouse potassium chromate increases expression ISO PLK2 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of PLK2 mRNA CTD PMID:22714537 Plk2 Mouse potassium chromate decreases expression ISO PLK2 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PLK2 mRNA CTD PMID:22079256 Plk2 Mouse potassium cyanide decreases expression EXP 6480464 Potassium Cyanide results in decreased expression of PLK2 mRNA CTD PMID:33914522 Plk2 Mouse pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of PLK2 mRNA CTD PMID:28903501 Plk2 Mouse progesterone multiple interactions ISO PLK2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of PLK2 mRNA CTD PMID:20660070 Plk2 Mouse progesterone decreases expression ISO Plk2 (Rattus norvegicus) 6480464 Progesterone results in decreased expression of PLK2 mRNA CTD PMID:20726854 Plk2 Mouse propan-2-ol decreases expression ISO PLK2 (Homo sapiens) 6480464 2-Propanol results in decreased expression of PLK2 mRNA CTD PMID:37149095 Plk2 Mouse propanal increases expression ISO PLK2 (Homo sapiens) 6480464 propionaldehyde results in increased expression of PLK2 mRNA CTD PMID:26079696 Plk2 Mouse propiconazole increases expression EXP 6480464 propiconazole results in increased expression of PLK2 mRNA CTD PMID:21278054 Plk2 Mouse quercetin increases expression ISO PLK2 (Homo sapiens) 6480464 Quercetin results in increased expression of PLK2 mRNA CTD PMID:21632981 Plk2 Mouse quinolin-8-ol increases expression ISO PLK2 (Homo sapiens) 6480464 Oxyquinoline results in increased expression of PLK2 mRNA CTD PMID:21632981 Plk2 Mouse riddelliine multiple interactions ISO PLK2 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of riddelliine] which results in increased expression of PLK2 mRNA CTD PMID:33884520 Plk2 Mouse Rutecarpine decreases expression ISO PLK2 (Homo sapiens) 6480464 rutecarpine results in decreased expression of PLK2 mRNA CTD PMID:34955744 Plk2 Mouse SB 431542 multiple interactions ISO PLK2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Plk2 Mouse silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of PLK2 mRNA CTD PMID:19073995 more ... Plk2 Mouse silicon dioxide increases expression ISO PLK2 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of PLK2 mRNA CTD PMID:25351596 Plk2 Mouse silver atom increases expression ISO PLK2 (Homo sapiens) 6480464 Silver results in increased expression of PLK2 mRNA CTD PMID:26014281 Plk2 Mouse silver(0) increases expression ISO PLK2 (Homo sapiens) 6480464 Silver results in increased expression of PLK2 mRNA CTD PMID:26014281 Plk2 Mouse simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of PLK2 mRNA CTD PMID:19262002 Plk2 Mouse sodium arsenite decreases expression ISO PLK2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PLK2 mRNA CTD PMID:22714537 Plk2 Mouse sodium arsenite increases expression ISO PLK2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PLK2 mRNA CTD PMID:12760830 more ... Plk2 Mouse Soman increases expression ISO Plk2 (Rattus norvegicus) 6480464 Soman results in increased expression of PLK2 mRNA CTD PMID:19281266 Plk2 Mouse sorafenib increases expression ISO PLK2 (Homo sapiens) 6480464 sorafenib results in increased expression of PLK2 mRNA CTD PMID:26409325 Plk2 Mouse succimer multiple interactions EXP 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of PLK2 mRNA CTD PMID:21641980 Plk2 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of PLK2 mRNA CTD PMID:17555576 and PMID:20937368 Plk2 Mouse temozolomide increases expression ISO PLK2 (Homo sapiens) 6480464 Temozolomide results in increased expression of PLK2 mRNA CTD PMID:31758290 Plk2 Mouse terbufos increases methylation ISO PLK2 (Homo sapiens) 6480464 terbufos results in increased methylation of PLK2 promoter CTD PMID:22847954 Plk2 Mouse tetrachloromethane increases expression ISO Plk2 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of PLK2 mRNA CTD PMID:31150632 Plk2 Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PLK2 mRNA CTD PMID:31919559 Plk2 Mouse tetrachloromethane multiple interactions ISO Plk2 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PLK2 mRNA] CTD PMID:31150632 Plk2 Mouse tetraphene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PLK2 mRNA CTD PMID:27858113 Plk2 Mouse thiabendazole multiple interactions ISO Plk2 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of PLK2 mRNA CTD PMID:33854195 Plk2 Mouse thimerosal increases expression ISO PLK2 (Homo sapiens) 6480464 Thimerosal results in increased expression of PLK2 mRNA CTD PMID:16870260 Plk2 Mouse thioacetamide increases expression ISO Plk2 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of PLK2 mRNA CTD PMID:23411599 and PMID:34492290 Plk2 Mouse thiram increases expression ISO PLK2 (Homo sapiens) 6480464 Thiram results in increased expression of PLK2 mRNA CTD PMID:38568856 Plk2 Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of PLK2 mRNA CTD PMID:23557971 Plk2 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of PLK2 gene and titanium dioxide results in decreased methylation of PLK2 promoter CTD PMID:35295148 Plk2 Mouse topotecan multiple interactions ISO Plk2 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PLK2 mRNA CTD PMID:25729387 Plk2 Mouse topotecan increases expression ISO Plk2 (Rattus norvegicus) 6480464 Topotecan results in increased expression of PLK2 mRNA CTD PMID:25729387 Plk2 Mouse torcetrapib increases expression ISO PLK2 (Homo sapiens) 6480464 torcetrapib results in increased expression of PLK2 mRNA CTD PMID:23228038 Plk2 Mouse trichloroethene increases expression ISO Plk2 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of PLK2 mRNA CTD PMID:33387578 Plk2 Mouse trichostatin A increases expression ISO PLK2 (Homo sapiens) 6480464 trichostatin A results in increased expression of PLK2 mRNA CTD PMID:24935251 and PMID:26272509 Plk2 Mouse trichostatin A multiple interactions ISO PLK2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLK2 mRNA CTD PMID:27188386 Plk2 Mouse triphenyl phosphate affects expression ISO PLK2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PLK2 mRNA CTD PMID:37042841 Plk2 Mouse Triptolide increases expression EXP 6480464 triptolide results in increased expression of PLK2 mRNA CTD PMID:32835833 Plk2 Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of PLK2 mRNA CTD PMID:33045310 Plk2 Mouse tris(2-butoxyethyl) phosphate affects expression ISO PLK2 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of PLK2 mRNA CTD PMID:29024780 Plk2 Mouse troglitazone decreases expression ISO PLK2 (Homo sapiens) 6480464 troglitazone results in decreased expression of PLK2 mRNA CTD PMID:19140230 and PMID:20846491 Plk2 Mouse trovafloxacin increases expression EXP 6480464 trovafloxacin results in increased expression of PLK2 mRNA CTD PMID:35537566 Plk2 Mouse urethane increases expression ISO PLK2 (Homo sapiens) 6480464 Urethane results in increased expression of PLK2 mRNA CTD PMID:28818685 Plk2 Mouse valproic acid decreases expression ISO PLK2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PLK2 mRNA CTD PMID:29154799 Plk2 Mouse valproic acid multiple interactions ISO PLK2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLK2 mRNA CTD PMID:27188386 Plk2 Mouse valproic acid increases expression ISO PLK2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PLK2 mRNA CTD PMID:23179753 more ... Plk2 Mouse vinclozolin decreases expression ISO Plk2 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of PLK2 mRNA CTD PMID:23034163 and PMID:23869203
(+)-schisandrin B (ISO) (-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (EXP) 1,1-dichloroethene (EXP) 1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2-acetamidofluorene (EXP) 2-butoxyethanol (EXP) 3,3',5,5'-tetrabromobisphenol A (EXP) 3,4-dichloroaniline (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO) 4-hydroxynon-2-enal (EXP) 4-hydroxyphenyl retinamide (EXP) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-O-methylguanine (ISO) 7,12-dimethyltetraphene (EXP,ISO) acetamide (ISO) acrylamide (EXP,ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) ammonium chloride (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP) azoxystrobin (ISO) benzalkonium chloride (ISO) benzene (EXP,ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (EXP) Benzo[k]fluoranthene (EXP) bis(2-chloroethyl) sulfide (ISO) bisphenol A (ISO) butan-1-ol (ISO) butanal (ISO) cadmium dichloride (ISO) calciol (EXP) cannabidiol (EXP) carbamazepine (ISO) carbon nanotube (EXP) carbonyl sulfide (ISO) chloroprene (EXP) chlorpyrifos (EXP,ISO) chromium(6+) (EXP,ISO) chrysene (EXP) ciguatoxin CTX1B (EXP) cisplatin (EXP,ISO) clobetasol (EXP) clofibrate (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) corticosterone (ISO) coumarin (ISO) CU-O LINKAGE (ISO) Cuprizon (ISO) curcumin (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) dexamethasone (EXP,ISO) diazinon (ISO) dibenz[a,h]anthracene (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) dieldrin (ISO) dinophysistoxin 1 (ISO) dioxygen (EXP) disodium selenite (ISO) diuron (ISO) dorsomorphin (ISO) doxorubicin (ISO) Echimidine (ISO) endosulfan (ISO) ethanol (EXP) etoposide (ISO) ferric oxide (EXP) ferroheme b (EXP) fluoranthene (EXP) fonofos (ISO) formaldehyde (ISO) genistein (ISO) gentamycin (ISO) glafenine (ISO) glyphosate (ISO) heme b (EXP) hydrogen cyanide (EXP) hydrogen peroxide (ISO) imidacloprid (ISO) indometacin (ISO) irinotecan (ISO) iron(III) nitrilotriacetate (ISO) isobutanol (ISO) L-ascorbic acid (ISO) Lasiocarpine (ISO) leflunomide (ISO) Licochalcone B (ISO) lipopolysaccharide (ISO) mercury dibromide (ISO) mercury dichloride (ISO) metformin (ISO) methapyrilene (ISO) methotrexate (ISO) methoxyacetic acid (ISO) methylmercury chloride (ISO) monocrotaline (ISO) N-ethyl-N-nitrosourea (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) N-Nitrosopyrrolidine (ISO) naphthalenes (ISO) nickel dichloride (ISO) nickel sulfate (ISO) nicotine (EXP) ochratoxin A (ISO) oxaliplatin (ISO) ozone (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (EXP,ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) PhIP (ISO) pirinixic acid (EXP,ISO) potassium chromate (ISO) potassium cyanide (EXP) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) propan-2-ol (ISO) propanal (ISO) propiconazole (EXP) quercetin (ISO) quinolin-8-ol (ISO) riddelliine (ISO) Rutecarpine (ISO) SB 431542 (ISO) silicon dioxide (EXP,ISO) silver atom (ISO) silver(0) (ISO) simvastatin (EXP) sodium arsenite (ISO) Soman (ISO) sorafenib (ISO) succimer (EXP) tamoxifen (EXP) temozolomide (ISO) terbufos (ISO) tetrachloromethane (EXP,ISO) tetraphene (EXP) thiabendazole (ISO) thimerosal (ISO) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) topotecan (ISO) torcetrapib (ISO) trichloroethene (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) Triptolide (EXP) triptonide (EXP) tris(2-butoxyethyl) phosphate (ISO) troglitazone (ISO) trovafloxacin (EXP) urethane (ISO) valproic acid (ISO) vinclozolin (ISO)
Biological Process
G1/S transition of mitotic cell cycle (IBA,ISO,ISS) long-term synaptic depression (ISO,ISS) long-term synaptic potentiation (ISO,ISS) memory (IMP) mitotic cell cycle (IMP) mitotic spindle organization (IBA,IMP,ISO,ISS) negative regulation of angiogenesis (IMP) negative regulation of apoptotic process (IMP) negative regulation of apoptotic process in bone marrow cell (IMP) negative regulation of cellular senescence (IMP) negative regulation of dendritic spine development (ISO) negative regulation of excitatory postsynaptic potential (ISO) negative regulation of protein binding (ISO) negative regulation of protein localization to cell surface (ISO) peptidyl-serine phosphorylation (ISO) positive regulation of autophagy (IEA,ISO) positive regulation of canonical NF-kappaB signal transduction (ISO) positive regulation of cell migration involved in sprouting angiogenesis (IMP) positive regulation of proteasomal ubiquitin-dependent protein catabolic process (ISO) positive regulation of protein binding (ISO) positive regulation of protein catabolic process (IEA,ISO) positive regulation of receptor internalization (ISO) protein phosphorylation (IDA,ISO) Rap protein signal transduction (ISO,ISS) Ras protein signal transduction (ISO,ISS) regulation of centriole replication (ISO,ISS) regulation of synaptic plasticity (IBA,IMP,ISO) regulation protein catabolic process at postsynapse (ISO)
Plk2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 110,531,578 - 110,537,378 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 110,531,580 - 110,537,378 (+) Ensembl GRCm39 Ensembl GRCm38 13 110,395,044 - 110,400,844 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 110,395,046 - 110,400,844 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 111,185,252 - 111,191,052 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 111,515,940 - 111,521,722 (+) NCBI MGSCv36 mm8 Celera 13 114,729,888 - 114,735,651 (+) NCBI Celera Cytogenetic Map 13 D2.1 NCBI cM Map 13 61.97 NCBI
PLK2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 58,453,982 - 58,460,086 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 58,453,982 - 58,460,139 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 57,749,809 - 57,755,913 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 57,785,566 - 57,791,670 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 57,785,569 - 57,791,844 NCBI Celera 5 54,688,300 - 54,694,404 (-) NCBI Celera Cytogenetic Map 5 q11.2 NCBI HuRef 5 54,706,921 - 54,713,078 (-) NCBI HuRef CHM1_1 5 57,749,420 - 57,755,577 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 59,272,431 - 59,278,533 (-) NCBI T2T-CHM13v2.0
Plk2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 43,702,536 - 43,708,305 (+) NCBI GRCr8 mRatBN7.2 2 41,969,176 - 41,974,945 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 41,969,176 - 41,974,947 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 49,090,164 - 49,095,930 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 47,148,897 - 47,154,663 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 42,001,899 - 42,007,665 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 41,911,143 - 41,916,901 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 41,911,131 - 41,916,901 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 60,970,300 - 60,976,058 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 41,800,745 - 41,806,503 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 41,721,113 - 41,726,872 (+) NCBI Celera 2 37,785,007 - 37,790,765 (+) NCBI Celera Cytogenetic Map 2 q14 NCBI
Plk2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955446 9,671,090 - 9,677,188 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955446 9,671,090 - 9,676,956 (+) NCBI ChiLan1.0 ChiLan1.0
PLK2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 55,454,341 - 55,461,398 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 53,607,973 - 53,614,939 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 55,543,828 - 55,550,116 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 57,178,503 - 57,184,793 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 57,177,836 - 57,184,793 (+) Ensembl panpan1.1 panPan2
PLK2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 45,359,865 - 45,365,496 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 45,360,374 - 45,367,441 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 42,431,127 - 42,436,818 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 45,844,932 - 45,850,642 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 45,844,939 - 45,850,697 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 42,914,745 - 42,920,462 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 43,720,594 - 43,726,300 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 44,541,169 - 44,546,873 (-) NCBI UU_Cfam_GSD_1.0
Plk2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 200,743,971 - 200,750,098 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936480 9,680,449 - 9,686,595 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936480 9,680,461 - 9,686,593 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PLK2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 37,299,119 - 37,305,114 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 37,299,116 - 37,305,114 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 40,067,358 - 40,073,357 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PLK2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 54,629,868 - 54,636,134 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 54,629,194 - 54,636,032 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 3,546,484 - 3,552,760 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Plk2
.
Predicted Target Of
Count of predictions: 192 Count of miRNA genes: 138 Interacting mature miRNAs: 165 Transcripts: ENSMUST00000022212 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142334 Svtms_m survival time modifier of Sod2 (mouse) Not determined 13 107613580 119476372 Mouse 1558741 Ses10_m salmonella enteritidis susceptibility 10 (mouse) Not determined 13 82739968 116740106 Mouse 10043997 Bw40_m body weight QTL 40 (mouse) Not determined 14 79239045 113239162 Mouse 1301142 Heal2_m wound healing/regeneration 2 (mouse) Not determined 13 93875267 120883175 Mouse 1357468 Rplag_m reduced platelet aggregation (mouse) Not determined 13 95502130 120883175 Mouse 1301530 Bglu2_m blood glucose level 2 (mouse) Not determined 13 108965303 110699911 Mouse 12879496 Fexq2_m fear expression QTL 2 (mouse) 13 100741519 120883175 Mouse 13824989 Pbsq1_m percent broken sperm QTL 1 (mouse) 13 102136508 112136534 Mouse 4141102 Sod1m_m superoxide dismutase 1, soluble, modifier (mouse) Not determined 99739968 110699911 Mouse 4142314 Tailaq3_m tail length adjusted QTL 3 (mouse) Not determined 55720354 112431103 Mouse 4141992 W6q16_m weight 6 weeks QTL 16 (mouse) Not determined 55720354 112431103 Mouse 1300939 Hrtfm6_m heart failure modifier 6 (mouse) Not determined 13 91383692 120883175 Mouse 12880414 V125Dq10_m vitamin D active form serum level QTL 10 (mouse) 13 78036508 112036508 Mouse 4142241 Tailq3_m tail length QTL 3 (mouse) Not determined 55720354 112431103 Mouse 4141728 Egaq4_m early growth adjusted QTL 4 (mouse) Not determined 87901985 112431103 Mouse 1300876 Tanidd2_m tally ho associated non-insulin dependednt diabetes mellitus 2 (mouse) Not determined 13 91965303 120883175 Mouse 4140959 W10q17_m weight 10 weeks QTL 17 (mouse) Not determined 55720354 112431103 Mouse 4141266 Mol3_m modifier of LPS-response 3 (mouse) Not determined 76132600 112431103 Mouse 10045623 Heal18_m wound healing regeneration 18 (mouse) Not determined 13 79239045 113239162 Mouse 14700691 Cisaq1_m coxsackieviral infection serum ALT QTL 1 (mouse) 13 86148119 120461536 Mouse 4141704 Hipq1_m hyperinsulin production QTL 1 (mouse) Not determined 110409487 119476372 Mouse 4142147 Mvwf4_m modifier of von Willebrand factor 4 (mouse) Not determined 20477612 112898424 Mouse 4140995 Fbtq6_m femoral bone trait QTL 6 (mouse) Not determined 13 86341617 120341758 Mouse 1558763 Gct9_m granulosa cell tumorigenesis 9 (mouse) Not determined 13 95036824 120883175 Mouse 4142338 Skmw18_m skeletal muscle weight 18 (mouse) Not determined 13 94528399 120883175 Mouse 4141826 Tbqt5_m tibia bone quality traits 5 (mouse) Not determined 13 103341617 117043216 Mouse 4142465 Pbwg17_m postnatal body weight growth 17 (mouse) Not determined 13 83876060 117876256 Mouse 14746974 Manh75_m mandible shape 75 (mouse) 13 99386647 120883175 Mouse 4142400 Tgq24_m triglyceride QTL 24 (mouse) Not determined 102602630 120883175 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000022212 ⟹ ENSMUSP00000022212
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 110,531,580 - 110,537,378 (+) Ensembl GRCm38.p6 Ensembl 13 110,395,046 - 110,400,844 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000223756
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 110,531,582 - 110,534,258 (+) Ensembl GRCm38.p6 Ensembl 13 110,395,048 - 110,397,724 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000224489
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 110,531,582 - 110,533,897 (+) Ensembl GRCm38.p6 Ensembl 13 110,395,048 - 110,397,363 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000225156
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 110,534,331 - 110,535,569 (+) Ensembl GRCm38.p6 Ensembl 13 110,397,797 - 110,399,035 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000225340
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 110,532,546 - 110,533,486 (+) Ensembl GRCm38.p6 Ensembl 13 110,396,012 - 110,396,952 (+) Ensembl
RefSeq Acc Id:
NM_152804 ⟹ NP_690017
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 110,531,578 - 110,537,378 (+) NCBI GRCm38 13 110,395,044 - 110,400,844 (+) ENTREZGENE MGSCv37 13 111,185,252 - 111,191,052 (+) RGD Celera 13 114,729,888 - 114,735,651 (+) RGD cM Map 13 ENTREZGENE
Sequence:
GCTCGCACAAGCGAAGCAGGACGTCAGACTAGAGAGTAGGGAGAGAGACTGGTGCTCGAGGGACAGGGCTAGCCCGGACGCTTGTCCGCGCCTCGGAGGTGGCAAGTAGGCAGTGTCGGGTGGCGAGG
hide sequence
RefSeq Acc Id:
NP_690017 ⟸ NM_152804
- UniProtKB:
P53351 (UniProtKB/Swiss-Prot), Q548A9 (UniProtKB/TrEMBL), Q8K226 (UniProtKB/TrEMBL)
- Sequence:
MELLRTITYQPAAGTKMCEQALGKACGGDSKKKRPQQPSEDGQPQAQVTPAAPHHHHHHSHSGPEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEI
hide sequence
Ensembl Acc Id:
ENSMUSP00000022212 ⟸ ENSMUST00000022212
RGD ID: 8681288 Promoter ID: EPDNEW_M18675 Type: multiple initiation site Name: Plk2_1 Description: Mus musculus polo like kinase 2 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 13 110,395,048 - 110,395,108 EPDNEW
RGD ID: 6824262 Promoter ID: MM_KWN:15237 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: NM_152804, UC007RVR.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 13 111,184,601 - 111,185,377 (+) MPROMDB
RGD ID: 6847054 Promoter ID: MM_ACW:14588 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, ES_Cell, Liver, Lung, MEF_B4, MEF_B6 Transcripts: PLK2.FSEP07-UNSPLICED Position: Mouse Assembly Chr Position (strand) Source MGSCv36 13 111,189,281 - 111,190,652 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-09-05
Plk2
polo like kinase 2
polo-like kinase 2
Symbol and/or name change
5135510 APPROVED
2012-07-05
Plk2
polo-like kinase 2
Plk2
polo-like kinase 2 (Drosophila)
Symbol and/or name change
5135510 APPROVED
