Wnt7a (Wnt family member 7A) - Rat Genome Database

Name: Wnt7a
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Wnt7a (Wnt family member 7A) Rattus norvegicus

Analyze

Symbol:

Wnt7a

Name:

Wnt family member 7A

RGD ID:

69079

Description:

Enables frizzled binding activity. Involved in several processes, including canonical Wnt signaling pathway; positive regulation of JNK cascade; and response to estradiol. Predicted to be located in cell surface and extracellular matrix. Predicted to be active in Schaffer collateral - CA1 synapse; extracellular space; and glutamatergic synapse. Human ortholog(s) of this gene implicated in Fuhrmann syndrome and Schinzel type phocomelia. Orthologous to human WNT7A (Wnt family member 7A); PARTICIPATES IN Wnt signaling, canonical pathway; Wnt signaling, non-canonical pathway; Wnt signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

wingless-related MMTV integration site 7A; wingless-type MMTV integration site 7A; wingless-type MMTV integration site family, member 7A

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	WNT7A (Wnt family member 7A)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Wnt7a (wingless-type MMTV integration site family, member 7A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Wnt7a (Wnt family member 7A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	WNT7A (Wnt family member 7A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	WNT7A (Wnt family member 7A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Wnt7a (Wnt family member 7A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	WNT7A (Wnt family member 7A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	WNT7A (Wnt family member 7A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Wnt7a (Wnt family member 7A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	WNT7B (Wnt family member 7B)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	WNT7A (Wnt family member 7A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Wnt7a (wingless-type MMTV integration site family, member 7A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wnt7aa (wingless-type MMTV integration site family, member 7Aa)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Wnt2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	123,863,108 - 123,908,981 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	123,863,108 - 123,908,981 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	129,329,923 - 129,375,873 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	125,104,358 - 125,150,304 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	123,728,903 - 123,774,853 (-)	NCBI	Rnor_WKY
Rnor_6.0	4	122,994,425 - 123,040,609 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	122,994,425 - 123,040,609 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	187,505,391 - 187,551,604 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	125,541,281 - 125,586,167 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	125,786,638 - 125,787,010 (-)	NCBI
Celera	4	112,782,267 - 112,828,322 (-)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

3p deletion syndrome (ISO)

amyotrophic lateral sclerosis type 1 (ISO)

bladder exstrophy-epispadias-cloacal exstrophy complex (ISO)

Experimental Mammary Neoplasms (ISO)

Female Urogenital Diseases (ISO)

Fuhrmann syndrome (ISO)

leiomyoma (ISO)

Ovarian Neoplasms (ISO)

Schinzel type phocomelia (ISO)

syndromic microphthalmia 5 (ISO)

Urogenital Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antimycin A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

C60 fullerene (EXP)

cadmium dichloride (ISO)

capsaicin (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroprene (ISO)

clobetasol (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

cyfluthrin (ISO)

cypermethrin (ISO)

Di-n-hexyl phthalate (EXP)

dibutyl phthalate (EXP)

dieldrin (EXP)

diethylstilbestrol (ISO)

Diisodecyl phthalate (EXP)

dipentyl phthalate (EXP)

endosulfan (EXP)

ethanol (ISO)

fenvalerate (EXP)

folic acid (ISO)

fulvestrant (ISO)

genistein (ISO)

glyphosate (EXP,ISO)

lead diacetate (EXP,ISO)

methylseleninic acid (ISO)

nickel subsulfide (EXP)

niclosamide (ISO)

ozone (ISO)

pirinixic acid (ISO)

progesterone (ISO)

pyrvinium (ISO)

rotenone (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (EXP)

Soman (EXP)

testosterone (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

XAV939 (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (ISO)

apoptotic process (ISO)

asymmetric protein localization involved in cell fate determination (ISO)

canonical Wnt signaling pathway (IBA,IMP,ISO)

cartilage condensation (ISO)

cartilage development (ISO)

cell fate commitment (IBA)

cell proliferation in forebrain (ISO)

cellular response to transforming growth factor beta stimulus (ISO)

central nervous system vasculogenesis (ISO)

cerebellar granule cell differentiation (ISO)

chondrocyte differentiation (ISO)

dendritic spine morphogenesis (ISO)

dorsal/ventral pattern formation (ISO)

embryonic axis specification (ISO)

embryonic digit morphogenesis (ISO)

embryonic forelimb morphogenesis (ISO)

embryonic hindlimb morphogenesis (ISO)

embryonic limb morphogenesis (ISO)

establishment of blood-brain barrier (ISO)

establishment of cell polarity (ISO)

forelimb morphogenesis (ISO)

hindlimb morphogenesis (ISO)

limb development (ISO)

negative regulation of apoptotic process (ISO)

negative regulation of neurogenesis (ISO)

neuron differentiation (IBA)

neurotransmitter secretion (ISO)

non-canonical Wnt signaling pathway (ISO)

oviduct development (ISO)

positive regulation of cell population proliferation (IMP)

positive regulation of DNA-templated transcription (ISO)

positive regulation of endothelial cell migration (ISO)

positive regulation of epithelial cell proliferation involved in wound healing (ISO)

positive regulation of excitatory postsynaptic potential (ISO)

positive regulation of excitatory synapse assembly (ISO)

positive regulation of gene expression (ISO)

positive regulation of JNK cascade (IBA,IMP)

positive regulation of protein metabolic process (ISO)

positive regulation of synapse assembly (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of axon diameter (ISO)

regulation of axonogenesis (ISO)

regulation of cell population proliferation (ISO)

regulation of epithelial cell proliferation (ISO)

regulation of postsynapse organization (ISO)

regulation of presynapse assembly (ISO)

regulation of synaptic vesicle exocytosis (ISO)

reproductive structure development (ISO)

response to estradiol (IEP)

response to estrogen (ISO)

secondary palate development (ISO)

skeletal muscle satellite cell activation (ISO)

skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration (ISO)

skeletal system morphogenesis (ISO)

skin morphogenesis (ISO)

somatic stem cell division (ISO)

somatic stem cell population maintenance (ISO)

stem cell development (ISO)

synapse assembly (ISO)

synapse organization (ISO)

uterus development (ISO)

uterus morphogenesis (ISO)

Wnt signaling pathway (ISO)

Wnt signaling pathway, planar cell polarity pathway (ISO)

wound healing (IEP)

wound healing, spreading of epidermal cells (ISO)

Cellular Component

cell surface (ISO)

cellular_component (ND)

extracellular matrix (ISO)

extracellular space (IBA)

glutamatergic synapse (ISO)

presynapse (IEA)

Schaffer collateral - CA1 synapse (ISO)

Molecular Function

cytokine activity (IBA,ISO)

frizzled binding (IBA,IPI,ISO)

protein binding (IPI,ISO)

receptor ligand activity (ISO)

signaling receptor binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

basal cell carcinoma pathway (IEA)

Hedgehog signaling pathway (IEA)

Wnt signaling pathway (IEA,ISO)

Wnt signaling, canonical pathway (IGI,ISO)

Wnt signaling, non-canonical pathway (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Functional characterization of WNT7A signaling in PC12 cells: interaction with A FZD5 x LRP6 receptor complex and modulation by Dickkopf proteins.	Caricasole A, etal., J Biol Chem 2003 Sep 26;278(39):37024-31.
2.	Secreted frizzled-related protein 4 regulates two Wnt7a signaling pathways and inhibits proliferation in endometrial cancer cells.	Carmon KS and Loose DS, Mol Cancer Res. 2008 Jun;6(6):1017-28.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Differential expression patterns of Wnt and beta-catenin/TCF target genes in the uterus of immature female rats exposed to 17alpha-ethynyl estradiol.	Katayama S, etal., Toxicol Sci. 2006 Jun;91(2):419-30. Epub 2006 Mar 21.
6.	Decreased expression of Wnt7a mRNA is inversely associated with the expression of estrogen receptor-alpha in human uterine leiomyoma.	Li S, etal., J Clin Endocrinol Metab. 2001 Jan;86(1):454-7.
7.	Expression of Wnt and MMP in epithelial cells during corneal wound healing.	Lyu J and Joo CK, Cornea. 2006 Dec;25(10 Suppl 1):S24-8.
8.	Pax6 is required for production and maintenance of progenitor cells in postnatal hippocampal neurogenesis.	Maekawa M, etal., Genes Cells. 2005 Oct;10(10):1001-14.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Comprehensive gene review and curation	RGD comprehensive gene curation
16.	The Wnt Homepage	Roel Nusse - Howard Hughes Medical Institute and the Department of Developmental Biology at Stanford University, California, USA
17.	Transformation by Wnt family proteins correlates with regulation of beta-catenin.	Shimizu H, etal., Cell Growth Differ. 1997 Dec;8(12):1349-58.
18.	Localization of 54 rat genes, and definition of new synteny groups conserved in the human and the rat.	Szpirer C, etal., Mamm Genome 2000 Sep;11(9):729-35
19.	Alternative wnt signaling is initiated by distinct receptors.	van Amerongen R, etal., Sci Signal. 2008 Sep 2;1(35):re9.
20.	Differential transformation of mammary epithelial cells by Wnt genes.	Wong GT, etal., Mol Cell Biol. 1994 Sep;14(9):6278-86.

Additional References at PubMed

PMID:7885472	PMID:8167409	PMID:9362463	PMID:9405095	PMID:12399112	PMID:12843296	PMID:12937339	PMID:14695376	PMID:15040835	PMID:15070830	PMID:15073149	PMID:15242796
PMID:15756457	PMID:15802269	PMID:15880584	PMID:16805831	PMID:16818724	PMID:16826533	PMID:17202865	PMID:17507554	PMID:17988238	PMID:18096705	PMID:18413325	PMID:18986540
PMID:19023080	PMID:19129494	PMID:19497282	PMID:20530549	PMID:21670302	PMID:24502851	PMID:26400647	PMID:28733458	PMID:31852613	PMID:32949181

Genomics

Comparative Map Data

Wnt7a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	123,863,108 - 123,908,981 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	123,863,108 - 123,908,981 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	129,329,923 - 129,375,873 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	125,104,358 - 125,150,304 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	123,728,903 - 123,774,853 (-)	NCBI	Rnor_WKY
Rnor_6.0	4	122,994,425 - 123,040,609 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	122,994,425 - 123,040,609 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	187,505,391 - 187,551,604 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	125,541,281 - 125,586,167 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	125,786,638 - 125,787,010 (-)	NCBI
Celera	4	112,782,267 - 112,828,322 (-)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

WNT7A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	13,816,258 - 13,880,071 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	3	13,816,258 - 13,880,071 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	13,857,755 - 13,921,568 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	13,835,083 - 13,896,619 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	13,835,082 - 13,896,619	NCBI
Celera	3	13,798,391 - 13,859,925 (-)	NCBI		Celera
Cytogenetic Map	3	p25.1	NCBI
HuRef	3	13,793,735 - 13,855,835 (-)	NCBI		HuRef
CHM1_1	3	13,810,090 - 13,871,973 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	13,816,895 - 13,880,668 (-)	NCBI		T2T-CHM13v2.0

Wnt7a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	91,340,963 - 91,388,335 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	91,340,963 - 91,388,345 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	91,363,981 - 91,411,353 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	91,363,981 - 91,411,363 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	91,313,977 - 91,361,363 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	91,329,487 - 91,376,873 (-)	NCBI		MGSCv36	mm8
Celera	6	93,257,779 - 93,305,821 (-)	NCBI		Celera
Cytogenetic Map	6	D1	NCBI
cM Map	6	40.45	NCBI

Wnt7a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955429	12,647,993 - 12,694,895 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955429	12,647,993 - 12,693,998 (+)	NCBI	ChiLan1.0	ChiLan1.0

WNT7A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	3	14,075,359 - 14,138,386 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	14,077,839 - 14,138,386 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	3	13,733,487 - 13,797,189 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

WNT7A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	4,072,010 - 4,139,521 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	4,073,929 - 4,139,436 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	4,112,838 - 4,179,523 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	4,096,079 - 4,162,950 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	4,096,088 - 4,163,110 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	3,815,330 - 3,882,330 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	4,137,783 - 4,204,657 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	4,102,223 - 4,168,959 (-)	NCBI		UU_Cfam_GSD_1.0

Wnt7a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	19,620,674 - 19,645,097 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936898	45,115 - 70,326 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936898	45,903 - 70,313 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WNT7A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	70,538,894 - 70,602,454 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	70,538,802 - 70,602,464 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	77,997,741 - 78,061,325 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

WNT7A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	49,805,415 - 49,863,115 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	49,805,463 - 49,862,830 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	116,634,304 - 116,694,158 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wnt7a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624796	12,431,959 - 12,472,303 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624796	12,431,310 - 12,472,303 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Wnt7a
195 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	323
Count of miRNA genes:	175
Interacting mature miRNAs:	242
Transcripts:	ENSRNOT00000070832
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	78878504	123878504	Rat
738015	Pia9	Pristane induced arthritis QTL 9	4.5	0.048	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	80694870	125694870	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	81192555	126192555	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	84728680	129854654	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	86730991	131730991	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	87327165	132327165	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	87327165	132327165	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	90850165	135850165	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	95174120	140174120	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	116179486	151161268	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
12798527	Anxrr58	Anxiety related response QTL 58	4.11	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	119463257	147278687	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	120260281	147278687	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	120926564	148090731	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat

Markers in Region

RH132187

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	123,863,233 - 123,864,186 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	122,994,551 - 122,995,503	NCBI	Rnor6.0
Rnor_5.0	4	187,550,526 - 187,551,478	UniSTS	Rnor5.0
RGSC_v3.4	4	125,540,371 - 125,541,323	UniSTS	RGSC3.4
Celera	4	112,782,393 - 112,783,345	UniSTS
RH 3.4 Map	4	735.73	UniSTS
Cytogenetic Map	4	q34	UniSTS

BE106651

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	123,864,606 - 123,864,766 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	122,995,924 - 122,996,083	NCBI	Rnor6.0
Rnor_5.0	4	187,549,946 - 187,550,105	UniSTS	Rnor5.0
RGSC_v3.4	4	125,541,744 - 125,541,903	UniSTS	RGSC3.4
Celera	4	112,783,766 - 112,783,925	UniSTS
RH 3.4 Map	4	736.63	UniSTS
Cytogenetic Map	4	q34	UniSTS

Wnt7a

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	123,863,936 - 123,864,483 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	122,995,254 - 122,995,800	NCBI	Rnor6.0
Rnor_5.0	4	187,550,229 - 187,550,775	UniSTS	Rnor5.0
RGSC_v3.4	4	125,541,074 - 125,541,620	UniSTS	RGSC3.4
Celera	4	112,783,096 - 112,783,642	UniSTS
Cytogenetic Map	4	q34	UniSTS

UNH1042

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	123,870,702 - 123,871,013 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	123,002,020 - 123,002,330	NCBI	Rnor6.0
Rnor_5.0	4	187,543,698 - 187,544,009	NCBI	Rnor5.0
RGSC_v3.4	4	125,547,840 - 125,548,150	UniSTS	RGSC3.4
Celera	4	112,789,809 - 112,790,119	UniSTS
Cytogenetic Map	4	q34	UniSTS

Wnt7a

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	123,865,107 - 123,865,314 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	122,996,425 - 122,996,631	NCBI	Rnor6.0
Rnor_5.0	4	187,549,398 - 187,549,604	UniSTS	Rnor5.0
RGSC_v3.4	4	125,542,245 - 125,542,451	UniSTS	RGSC3.4
Celera	4	112,784,267 - 112,784,473	UniSTS
Cytogenetic Map	4	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium								60		8	7
Low				9				14	1	22	4
Below cutoff	11	20	14	8	14	4	4		20	9		4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039106916	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039106917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AH012053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000070832 ⟹ ENSRNOP00000066101

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	123,863,108 - 123,908,981 (-)	Ensembl
Rnor_6.0 Ensembl	4	122,994,425 - 123,040,609 (-)	Ensembl

RefSeq Acc Id:

NM_001100473 ⟹ NP_001093943

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	123,863,108 - 123,908,981 (-)	NCBI
Rnor_6.0	4	122,994,425 - 123,040,609 (-)	NCBI
Rnor_5.0	4	187,505,391 - 187,551,604 (+)	NCBI
Celera	4	112,782,267 - 112,828,322 (-)	NCBI

Sequence:

show sequence

CCCGCGCCTCAAACACTTGCCGCGATCGCTGGCGCGCAGCGTCGCCCCGCGTTGCGCGCTCGTT
TCCCCTTCCTCCGGCTCCGCGGCTCCCGCGCTCTAGGACAGTCTCCAGTGCCCAGCGCGGACCG
ACGCACTGACGGACCGTCCAGGGAGCCTCGGCCCGCGCCCCCTGCGCAGGCTATGTGGATTGCC
CCGCCGGGCCCGGCTGGCGGGATCAGCACAGCCCGGCCCGCGGCACCCGCCACCAGCGGGGACT
ATGACCCGGAAAGCGCGGCGCTGCCTGGGCCACCTCTTTCTCAGCCTGGGCATAGTCTATCTCC
GGATCGGTGACTTCTCTTCGGTTGTGGCTCTGGGTGCGAGCATCATCTGTAACAAGATCCCAGG
CCTGGCTCCCAGACAGCGGGCAATCTGCCAGAGTCGGCCGGACGCCATCATCGTCATAGGAGAA
GGCTCCCAAATGGGCCTGGACGAGTGTCAGTTTCAGTTCCGCAATGGCCGTTGGAACTGTTCAG
CGCTGGGAGAGCGCACTGTCTTCGGGAAGGAGCTCAAAGTGGGGAGTCGGGAGGCCGCCTTCAC
CTATGCAATTATTGCTGCGGGTGTGGCCCATGCCATCACCGCTGCCTGCACCCAAGGCAACCTG
AGTGACTGTGGCTGCGACAAGGAGAAGCAAGGCCAGTACCACCGGGACGAGGGCTGGAAGTGGG
GTGGCTGCTCTGCCGACATCCGCTACGGCATCGGCTTCGCCAAGGTCTTCGTGGATGCCCGAGA
GATCAAGCAGAATGCCCGAACCCTCATGAACTTACACAATAACGAGGCAGGCCGGAAGATCCTG
GAGGAGAACATGAAACTGGAGTGTAAGTGCCATGGCGTGTCAGGATCCTGTACCACTAAGACGT
GCTGGACCACACTGCCACAATTCCGAGAGCTAGGCTACGTGCTCAAGGACAAATACAACGAGGC
CGTCCATGTGGAACCTGTCCGTGCCAGTCGGAACAAGCGGCCCACCTTTCTGAAGATCAAGAAG
CCCCTGTCCTACCGTAAGCCCATGGACACTGATCTGGTGTACATCGAGAAGTCACCCAATTACT
GTGAAGAGGACCCAGTGACAGGCAGCGTGGGCACACAGGGCCGTGCCTGCAATAAGACAGCCCC
TCAGGCTAGTGGCTGTGACCTCATGTGCTGCGGCCGTGGCTACAACACACACCAGTATGCCCGG
GTGTGGCAGTGCAACTGCAAATTCCACTGGTGCTGCTACGTCAAGTGTAACACATGCAGCGAGC
GCACAGAGATGTATACGTGCAAGTGAATGAGGTCACAGGTCAGATCACAGGCAGGATACCGTCT
CCCTGAAGGCCACTGCCAGGAGACCCACAGGGAACCACAGAAGCACTGTCCTCCCTGCAGGCCC
CTGCCTGGATACTCACAGGGAACCACAGAAGCACTGTCCTTGTCTTTTCTGCTGAGGGGGAAGG
GTATTCTGGGTTTCCCACAGACTCCTGTGGGAAGCATCTCTCAGAGGCCCACCCGTTCTACTCC
ACACAGATGCTGCTCAGCCACCTTCCCCCAGACACCGCCCGAGTCCCTCCATGGCTGGAACAAA
GTTTTCTACAGCAGGAGCTCTGGAGCCTCGGGCCTCGTCATAGCAATATTTAACAGTTTATTCT
GATAAGAAATAATATTAATTTATTTAATTAAAGAGAATTCTTCCACCTCGTCGGGATCCGTTTT
CTGCAATCAAAGTGGACTGCTTGAGGTCCTGGTGGGATGACTTGCTAGGACTGGGAGCTGAGAA
CAGCTGTACATAATTATTCTTCATGCAGATGGTTCTTCTAGTTGATTTTGCCTTCCGCAGTGCT
GGGTGTTAAGTACAAAGAGAAGACGGTCTTTATACACATATAGATATATATGCATACACATTTG
TATTTTTTTTGTTTTTGTTTTTGCTGTTTGCTGCTACCTATCCAGAATCTAAGCTGGTCCAGAT
CTGGAATTGTTTCTCTCCAGGACATGCCCCTATCCTTTTGCCCTCCAGTTCAAACCTCGCCATT
AGAAAAGTTCCATTGGGCATGGTGTGAATCACAAATTCCCAGCAATTCCCATCCCGGAAAGTGA
ACCACTGGATAAGAGGCTTTCTAAGAGACTATTTTTCTATGAATATTTTATTTATATGGAGTCT
GCCTGTGTTGCCCCATGGCCCATGCCTCTTCTTAACACTGGTACTCACTCAGGGGCAGGAGGAC
AAGGCCAGGTGTGTGCGCAGGTCCCCTGGAGTCTGGAGTTCCATTTGCCAAGGGGCCACAGCAG
TTACCAGATGCCTGGGCTGGGGTATCGTCTGTGTTAAATGAGAGGGAATCTTCCCCTGGCTTTA
GCCTGCTGAGCTCAGGTCTTGGAATGGGGTCACTGGATGGTTATCTTGGGAGGTGACCTCAGGA
CGAGCTACAGTGGCGGATCAGTCAGTGTCTTGCACGTTTTGAACAGGCAGAGGCCAGCTCCGGG
ATGCCAATGTCCCATCAGGACAGCCCAGGCACTGCCTATAGGTGAGCTGTAGTCCTAAGAGAAG
GGGTCAGAAAGGAGGGGGCAGGAGGAAGCCAAGGATTGTTGGCCAACCTCAGTGAAAGCATGGG
CGTGATCCCTCTGCAGCAGAGACCCTGCTCCACCTGCACCTCTCAACCAGGAAACCCCTTCAGG
AGGCTGCGAATATTTTTATGTGTGTCCACATGCATTTCTACCCATGTGCATGTAAGCACACGCA
CACACTCCTGTGCCAGCACTTTGAGGCACCTCCAGAGTGCTCACATGTGCATGTGCTTGCGTGT
AACTCTCTGCACTTGGGAGATCAGATCATGCGTGTGGAGCTGTGTGCCTGAGCATTTGTGGTCC
CAGGGGGTCTTTCCAGGTATCTGCATTTGTGGGTGGGGTGCAAGGTAGACAGCAGGGAACTAAT
TTGATTGCGTTGAGCCGCAAAGAGACTGCAACTTCTGAACTCTGTCTCCACAGCTGCTGGAGAA
ACTCAGATGCCTGTGACACCACAACCCTGAGCCTCGTGGCCTGCGTGCTGGGAGCCCCTCAGTG
CCTAGGTCATGTCCAGTCTCCCACCTGGGTCACAGCAGGACAAATAAACACGACTGTATGGCTG
ATTCCTTCCCTTGA

hide sequence

RefSeq Acc Id:

XM_039106916 ⟹ XP_038962844

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	123,863,114 - 123,907,174 (-)	NCBI

RefSeq Acc Id:

XM_039106917 ⟹ XP_038962845

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	123,863,114 - 123,907,177 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001093943	(Get FASTA)	NCBI Sequence Viewer
	XP_038962844	(Get FASTA)	NCBI Sequence Viewer
	XP_038962845	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAN51978	(Get FASTA)	NCBI Sequence Viewer
	AAN51979	(Get FASTA)	NCBI Sequence Viewer
	EDL91365	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001093943 ⟸ NM_001100473
- Peptide Label:	precursor
- UniProtKB:	M0R9D3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTRKARRCLGHLFLSLGIVYLRIGDFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGE GSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNL SDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKIL EENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKK PLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYAR VWQCNCKFHWCCYVKCNTCSERTEMYTCK hide sequence

RefSeq Acc Id:

ENSRNOP00000066101 ⟸ ENSRNOT00000070832

RefSeq Acc Id:	XP_038962845 ⟸ XM_039106917
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038962844 ⟸ XM_039106916
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0R9D3-F1-model_v2	AlphaFold	M0R9D3	1-349	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69079	AgrOrtholog
BioCyc Gene	G2FUF-43724	BioCyc
Ensembl Genes	ENSRNOG00000048782	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000066101	ENTREZGENE
	ENSRNOP00000066101.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000070832	ENTREZGENE
	ENSRNOT00000070832.2	UniProtKB/TrEMBL
Gene3D-CATH	3.30.2460.20	UniProtKB/TrEMBL
InterPro	Wnt	UniProtKB/TrEMBL
	Wnt7	UniProtKB/TrEMBL
	Wnt_C	UniProtKB/TrEMBL
	Wnt_CS	UniProtKB/TrEMBL
KEGG Report	rno:114850	UniProtKB/TrEMBL
NCBI Gene	114850	ENTREZGENE
PANTHER	PTHR12027	UniProtKB/TrEMBL
Pfam	wnt	UniProtKB/TrEMBL
PhenoGen	Wnt7a	PhenoGen
PRINTS	WNT7PROTEIN	UniProtKB/TrEMBL
	WNTPROTEIN	UniProtKB/TrEMBL
PROSITE	WNT1	UniProtKB/TrEMBL
SMART	WNT1	UniProtKB/TrEMBL
UniProt	M0R9D3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-29	Wnt7a	Wnt family member 7A	Wnt7a	wingless-type MMTV integration site family, member 7A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-14	Wnt7a	wingless-type MMTV integration site family, member 7A	Wnt7a	wingless-related MMTV integration site 7A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Wnt7a	wingless-type MMTV integration site 7A			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)