Symbol:
SLC6A6
Name:
solute carrier family 6 member 6
RGD ID:
69004
HGNC Page
HGNC:11052
Description:
Enables alanine transmembrane transporter activity; amino acid:sodium symporter activity; and taurine:sodium symporter activity. Involved in alanine transport; amino acid import across plasma membrane; and taurine transmembrane transport. Located in apical plasma membrane; basolateral plasma membrane; and microvillus membrane. Biomarker of multiple system atrophy.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
HTRDC; MGC10619; MGC131729; sodium- and chloride-dependent taurine transporter; solute carrier family 6 (neurotransmitter transporter, taurine), member 6; solute carrier family 6, member 6; taurine transporter; TAUT
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Slc6a6 (solute carrier family 6 (neurotransmitter transporter, taurine), member 6) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Rattus norvegicus (Norway rat):
Slc6a6 (solute carrier family 6 member 6) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Chinchilla lanigera (long-tailed chinchilla):
Slc6a6 (solute carrier family 6 member 6) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
SLC6A6 (solute carrier family 6 member 6) NCBI
Ortholog
Canis lupus familiaris (dog):
SLC6A6 (solute carrier family 6 member 6) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc6a6 (solute carrier family 6 member 6) NCBI
Ortholog
Sus scrofa (pig):
SLC6A6 (solute carrier family 6 member 6) HGNC
Ensembl, NCBI, OMA, OrthoDB, Panther
Chlorocebus sabaeus (green monkey):
SLC6A6 (solute carrier family 6 member 6) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Slc6a6 (solute carrier family 6 member 6) NCBI
Ortholog
Other homologs 2
Mus musculus (house mouse):
Slc6a1 (solute carrier family 6 (neurotransmitter transporter, GABA), member 1) HGNC
OrthoMCL
Mus musculus (house mouse):
Slc6a12 (solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12) HGNC
OrthoMCL
Mus musculus (house mouse):
Slc6a8 (solute carrier family 6 (neurotransmitter transporter, creatine), member 8) HGNC
OrthoMCL
Mus musculus (house mouse):
Slc6a13 (solute carrier family 6 (neurotransmitter transporter, GABA), member 13) HGNC
OrthoMCL
Mus musculus (house mouse):
Slc6a11 (solute carrier family 6 (neurotransmitter transporter, GABA), member 11) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Slc6a6 (solute carrier family 6 member 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Slc6a6 (solute carrier family 6 (neurotransmitter transporter, taurine), member 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc6a6b (solute carrier family 6 member 6b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
slc6a6a (solute carrier family 6 member 6a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
CG13795
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
CG13796
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
CG33296
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
CG13793
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
CG13794
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
CG31904
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
slc6a6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
SLC6A6P1
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 14,402,576 - 14,489,349 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 14,402,576 - 14,489,349 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 14,444,076 - 14,530,857 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 14,419,110 - 14,505,861 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 14,419,109 - 14,503,973 NCBI Celera 3 14,382,349 - 14,469,089 (+) NCBI Celera Cytogenetic Map 3 p25.1 ENTREZGENE HuRef 3 14,380,198 - 14,466,798 (+) NCBI HuRef CHM1_1 3 14,395,197 - 14,481,943 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 14,405,068 - 14,491,755 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
SLC6A6 Human (+)-pilocarpine increases expression ISO Slc6a6 (Mus musculus) 6480464 Pilocarpine results in increased expression of SLC6A6 mRNA CTD PMID:21219332 SLC6A6 Human (-)-epigallocatechin 3-gallate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SLC6A6 mRNA CTD PMID:22079256 SLC6A6 Human 1-benzylpiperazine increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 N-benzylpiperazine results in increased expression of SLC6A6 mRNA CTD PMID:26821219 SLC6A6 Human 17alpha-ethynylestradiol affects expression ISO Slc6a6 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of SLC6A6 mRNA CTD PMID:17555576 SLC6A6 Human 17alpha-ethynylestradiol affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Ethinyl Estradiol affects the expression of SLC6A6 mRNA CTD PMID:26865667 SLC6A6 Human 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of SLC6A6 mRNA CTD PMID:26865667 SLC6A6 Human 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of SLC6A6 mRNA CTD PMID:18936297 SLC6A6 Human 17alpha-ethynylestradiol multiple interactions ISO Slc6a6 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of SLC6A6 mRNA CTD PMID:17942748 SLC6A6 Human 17alpha-ethynylestradiol decreases expression ISO Slc6a6 (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of SLC6A6 mRNA CTD PMID:17942748 SLC6A6 Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of SLC6A6 mRNA and Estradiol promotes the reaction [ESR2 protein affects the expression of SLC6A6 mRNA] CTD PMID:19619570 and PMID:20404318 SLC6A6 Human 17beta-estradiol increases expression ISO Slc6a6 (Mus musculus) 6480464 Estradiol results in increased expression of SLC6A6 mRNA CTD PMID:39298647 SLC6A6 Human 17beta-estradiol multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of SLC6A6 mRNA CTD PMID:32741896 SLC6A6 Human 17beta-estradiol affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Estradiol affects the expression of SLC6A6 mRNA CTD PMID:32145629 SLC6A6 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of SLC6A6 mRNA CTD PMID:15223131 more ... SLC6A6 Human 17beta-estradiol 3-benzoate multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of SLC6A6 mRNA CTD PMID:32741896 SLC6A6 Human 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [3 more ... CTD PMID:16984957 SLC6A6 Human 2,2',4,4',5,5'-hexachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:38568856 SLC6A6 Human 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Slc6a6 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 SLC6A6 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of SLC6A6 mRNA CTD PMID:19619570 SLC6A6 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC6A6 mRNA CTD PMID:19619570 more ... SLC6A6 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Slc6a6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SLC6A6 mRNA CTD PMID:21570461 SLC6A6 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Slc6a6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC6A6 mRNA CTD PMID:15328365 more ... SLC6A6 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC6A6 mRNA CTD PMID:21215274 and PMID:34747641 SLC6A6 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SLC6A6 mRNA CTD PMID:22298810 SLC6A6 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SLC6A6 mRNA CTD PMID:16984957 more ... SLC6A6 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Slc6a6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SLC6A6 mRNA CTD PMID:16984957 SLC6A6 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Slc6a6 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of SLC6A6 mRNA more ... CTD PMID:16984957 more ... SLC6A6 Human 2,3,7,8-Tetrachlorodibenzofuran increases expression ISO Slc6a6 (Mus musculus) 6480464 2 more ... CTD PMID:25768209 SLC6A6 Human 2,4-dinitrotoluene affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of SLC6A6 mRNA CTD PMID:21346803 SLC6A6 Human 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [3 more ... CTD PMID:16984957 SLC6A6 Human 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 3 more ... CTD PMID:16984957 more ... SLC6A6 Human 3,3',5,5'-tetrabromobisphenol A increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 tetrabromobisphenol A results in increased expression of SLC6A6 mRNA CTD PMID:28300664 SLC6A6 Human 3,4-methylenedioxymethamphetamine decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of SLC6A6 mRNA CTD PMID:30071829 SLC6A6 Human 3-chloropropane-1,2-diol increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in increased expression of SLC6A6 protein CTD PMID:34915118 SLC6A6 Human 4,4'-diaminodiphenylmethane increases expression ISO Slc6a6 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of SLC6A6 mRNA CTD PMID:18648102 SLC6A6 Human 4,4'-sulfonyldiphenol decreases expression ISO Slc6a6 (Mus musculus) 6480464 bisphenol S results in decreased expression of SLC6A6 mRNA CTD PMID:39298647 SLC6A6 Human 4,4'-sulfonyldiphenol decreases methylation EXP 6480464 bisphenol S results in decreased methylation of SLC6A6 gene CTD PMID:31601247 SLC6A6 Human 4-hydroxyphenyl retinamide increases expression ISO Slc6a6 (Mus musculus) 6480464 Fenretinide results in increased expression of SLC6A6 mRNA CTD PMID:28973697 SLC6A6 Human 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Omeprazole affects the expression of SLC6A6 mRNA CTD PMID:19483382 SLC6A6 Human 6-propyl-2-thiouracil affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Propylthiouracil affects the expression of SLC6A6 mRNA CTD PMID:19483382 SLC6A6 Human 6-propyl-2-thiouracil increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of SLC6A6 mRNA CTD PMID:24780913 SLC6A6 Human acetamide increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 acetamide results in increased expression of SLC6A6 mRNA CTD PMID:31881176 SLC6A6 Human acrolein multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SLC6A6 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of SLC6A6 mRNA CTD PMID:32699268 SLC6A6 Human acrylamide decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of SLC6A6 mRNA CTD PMID:28959563 SLC6A6 Human aflatoxin B1 affects expression EXP 6480464 Aflatoxin B1 affects the expression of SLC6A6 protein CTD PMID:20106945 SLC6A6 Human aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of SLC6A6 mRNA CTD PMID:32234424 SLC6A6 Human aflatoxin B1 increases methylation EXP 6480464 Aflatoxin B1 results in increased methylation of SLC6A6 intron CTD PMID:30157460 SLC6A6 Human aflatoxin B1 decreases expression ISO Slc6a6 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of SLC6A6 mRNA CTD PMID:19770486 SLC6A6 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of SLC6A6 mRNA CTD PMID:23830798 and PMID:33167477 SLC6A6 Human alpha-pinene multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SLC6A6 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of SLC6A6 mRNA CTD PMID:32699268 SLC6A6 Human alpha-Zearalanol multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of SLC6A6 mRNA CTD PMID:35163327 SLC6A6 Human amiodarone affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Amiodarone affects the expression of SLC6A6 mRNA CTD PMID:18355885 and PMID:19483382 SLC6A6 Human amitriptyline affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Amitriptyline affects the expression of SLC6A6 mRNA CTD PMID:18355885 SLC6A6 Human amitrole increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Amitrole results in increased expression of SLC6A6 mRNA CTD PMID:30047161 SLC6A6 Human ammonium chloride affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of SLC6A6 mRNA CTD PMID:16483693 SLC6A6 Human amphotericin B decreases expression EXP 6480464 Amphotericin B analog results in decreased expression of SLC6A6 mRNA CTD PMID:28534445 SLC6A6 Human aristolochic acid A decreases expression EXP 6480464 aristolochic acid I results in decreased expression of SLC6A6 mRNA CTD PMID:33212167 SLC6A6 Human arsane affects expression EXP 6480464 Arsenic affects the expression of SLC6A6 mRNA CTD PMID:18414638 SLC6A6 Human arsane multiple interactions EXP 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of SLC6A6 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SLC6A6 mRNA CTD PMID:32525701 and PMID:39836092 SLC6A6 Human arsane affects methylation EXP 6480464 Arsenic affects the methylation of SLC6A6 gene CTD PMID:25304211 SLC6A6 Human arsenic atom affects expression EXP 6480464 Arsenic affects the expression of SLC6A6 mRNA CTD PMID:18414638 SLC6A6 Human arsenic atom affects methylation EXP 6480464 Arsenic affects the methylation of SLC6A6 gene CTD PMID:25304211 SLC6A6 Human arsenic atom multiple interactions EXP 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of SLC6A6 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SLC6A6 mRNA CTD PMID:32525701 and PMID:39836092 SLC6A6 Human atrazine affects methylation ISO Slc6a6 (Rattus norvegicus) 6480464 Atrazine affects the methylation of SLC6A6 gene CTD PMID:28931070 SLC6A6 Human atrazine decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Atrazine results in decreased expression of SLC6A6 mRNA CTD PMID:36841081 SLC6A6 Human avobenzone increases expression EXP 6480464 avobenzone results in increased expression of SLC6A6 mRNA CTD PMID:31016361 SLC6A6 Human azathioprine increases expression EXP 6480464 Azathioprine results in increased expression of SLC6A6 mRNA CTD PMID:22623647 SLC6A6 Human Azoxymethane multiple interactions ISO Slc6a6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SLC6A6 mRNA CTD PMID:29950665 SLC6A6 Human benzbromarone affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Benzbromarone affects the expression of SLC6A6 mRNA CTD PMID:19483382 SLC6A6 Human benzene decreases expression ISO Slc6a6 (Mus musculus) 6480464 Benzene results in decreased expression of SLC6A6 mRNA CTD PMID:37084897 SLC6A6 Human benzo[a]pyrene decreases expression ISO Slc6a6 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SLC6A6 mRNA CTD PMID:19770486 SLC6A6 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of SLC6A6 5' UTR CTD PMID:27901495 SLC6A6 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of SLC6A6 3' UTR and Benzo(a)pyrene affects the methylation of SLC6A6 promoter CTD PMID:27901495 SLC6A6 Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SLC6A6 mRNA CTD PMID:20106945 more ... SLC6A6 Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7 more ... CTD PMID:19150397 SLC6A6 Human benzo[a]pyrene diol epoxide I increases expression EXP 6480464 7 more ... CTD PMID:20382639 SLC6A6 Human beta-lapachone decreases expression EXP 6480464 beta-lapachone results in decreased expression of SLC6A6 mRNA CTD PMID:38218311 SLC6A6 Human beta-lapachone increases expression EXP 6480464 beta-lapachone results in increased expression of SLC6A6 mRNA CTD PMID:38218311 SLC6A6 Human beta-naphthoflavone multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of SLC6A6 mRNA CTD PMID:18164116 SLC6A6 Human bexarotene increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 bexarotene results in increased expression of SLC6A6 mRNA CTD PMID:16648578 SLC6A6 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLC6A6 mRNA CTD PMID:23019147 and PMID:29275510 SLC6A6 Human bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of SLC6A6 gene CTD PMID:31601247 SLC6A6 Human bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of SLC6A6 gene CTD PMID:31601247 SLC6A6 Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLC6A6 protein CTD PMID:33376534 SLC6A6 Human bisphenol A affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 bisphenol A affects the expression of SLC6A6 mRNA CTD PMID:32145629 SLC6A6 Human bisphenol A increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of SLC6A6 mRNA CTD PMID:30816183 more ... SLC6A6 Human bisphenol F increases expression ISO Slc6a6 (Mus musculus) 6480464 bisphenol F results in increased expression of SLC6A6 mRNA CTD PMID:38685157 SLC6A6 Human bisphenol F multiple interactions EXP 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of SLC6A6 gene CTD PMID:31601247 SLC6A6 Human bromobenzene increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 bromobenzene results in increased expression of SLC6A6 mRNA CTD PMID:32479839 SLC6A6 Human butanal increases expression EXP 6480464 butyraldehyde results in increased expression of SLC6A6 mRNA CTD PMID:26079696 SLC6A6 Human cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SLC6A6 mRNA CTD PMID:29741670 SLC6A6 Human cadmium dichloride increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Cadmium Chloride results in increased expression of SLC6A6 mRNA CTD PMID:33453195 SLC6A6 Human cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SLC6A6 mRNA CTD PMID:29741670 SLC6A6 Human cadmium dichloride decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of SLC6A6 mRNA CTD PMID:25993096 SLC6A6 Human cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of SLC6A6 mRNA CTD PMID:25596134 SLC6A6 Human cadmium sulfate multiple interactions EXP 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of SLC6A6 mRNA CTD PMID:18654764 SLC6A6 Human carbon nanotube decreases expression ISO Slc6a6 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of SLC6A6 mRNA CTD PMID:25554681 and PMID:25620056 SLC6A6 Human chlordecone increases expression ISO Slc6a6 (Mus musculus) 6480464 Chlordecone results in increased expression of SLC6A6 mRNA CTD PMID:33711761 SLC6A6 Human chloroacetaldehyde affects expression EXP 6480464 chloroacetaldehyde affects the expression of SLC6A6 mRNA CTD PMID:25596134 SLC6A6 Human chloroprene increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Chloroprene results in increased expression of SLC6A6 mRNA CTD PMID:23125180 SLC6A6 Human chlorpromazine increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Chlorpromazine results in increased expression of SLC6A6 mRNA CTD PMID:25596134 SLC6A6 Human cidofovir anhydrous affects expression EXP 6480464 Cidofovir affects the expression of SLC6A6 mRNA CTD PMID:25596134 SLC6A6 Human cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of SLC6A6 mRNA CTD PMID:27594783 SLC6A6 Human cisplatin decreases response to substance ISO Slc6a6 (Mus musculus) 6480464 SLC6A6 protein results in decreased susceptibility to Cisplatin CTD PMID:21220912 SLC6A6 Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of SLC6A6 mRNA CTD PMID:27392435 SLC6A6 Human cisplatin multiple interactions EXP 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of SLC6A6 mRNA CTD PMID:27392435 SLC6A6 Human clofibrate affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Clofibrate affects the expression of SLC6A6 mRNA CTD PMID:19483382 SLC6A6 Human clomipramine affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Clomipramine affects the expression of SLC6A6 mRNA CTD PMID:18355885 SLC6A6 Human cobalt dichloride multiple interactions EXP 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of SLC6A6 mRNA CTD PMID:18654764 SLC6A6 Human copper(II) chloride increases expression EXP 6480464 cupric chloride results in increased expression of SLC6A6 mRNA CTD PMID:38568856 SLC6A6 Human copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of SLC6A6 mRNA CTD PMID:19549813 SLC6A6 Human crocidolite asbestos increases expression EXP 6480464 Asbestos and Crocidolite results in increased expression of SLC6A6 mRNA CTD PMID:25351596 SLC6A6 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of SLC6A6 mRNA CTD PMID:25596134 SLC6A6 Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of SLC6A6 mRNA CTD PMID:20106945 and PMID:25562108 SLC6A6 Human DDE decreases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of SLC6A6 mRNA CTD PMID:38568856 SLC6A6 Human decabromodiphenyl ether decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 decabromobiphenyl ether results in decreased expression of SLC6A6 mRNA CTD PMID:23640034 SLC6A6 Human dextran sulfate multiple interactions ISO Slc6a6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SLC6A6 mRNA CTD PMID:29950665 SLC6A6 Human diallyl disulfide increases expression EXP 6480464 diallyl disulfide results in increased expression of SLC6A6 mRNA CTD PMID:34887701 SLC6A6 Human diallyl trisulfide increases expression EXP 6480464 diallyl trisulfide results in increased expression of SLC6A6 mRNA CTD PMID:34887701 SLC6A6 Human Diallyltetrasulfane increases expression EXP 6480464 diallyl tetrasulfide results in increased expression of SLC6A6 mRNA CTD PMID:34887701 SLC6A6 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of SLC6A6 mRNA CTD PMID:37042841 SLC6A6 Human dibutyl phthalate increases expression ISO Slc6a6 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of SLC6A6 mRNA CTD PMID:21266533 SLC6A6 Human dibutyl phthalate decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of SLC6A6 mRNA CTD PMID:21266533 SLC6A6 Human diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of SLC6A6 mRNA CTD PMID:19371625 SLC6A6 Human dimethylarsinic acid increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Cacodylic Acid results in increased expression of SLC6A6 mRNA CTD PMID:17720352 SLC6A6 Human dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of SLC6A6 mRNA CTD PMID:25596134 and PMID:26516004 SLC6A6 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC6A6 mRNA CTD PMID:27188386 SLC6A6 Human doxorubicin decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Doxorubicin results in decreased expression of SLC6A6 mRNA CTD PMID:17105721 SLC6A6 Human endosulfan increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Endosulfan results in increased expression of SLC6A6 mRNA CTD PMID:29391264 SLC6A6 Human fenthion increases expression ISO Slc6a6 (Mus musculus) 6480464 Fenthion results in increased expression of SLC6A6 mRNA CTD PMID:34813904 SLC6A6 Human fulvestrant increases methylation EXP 6480464 Fulvestrant results in increased methylation of SLC6A6 gene CTD PMID:31601247 SLC6A6 Human fulvestrant multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of SLC6A6 gene and [bisphenol F co-treated with Fulvestrant] results in increased methylation of SLC6A6 gene CTD PMID:31601247 SLC6A6 Human genistein increases expression EXP 6480464 Genistein results in increased expression of SLC6A6 mRNA CTD PMID:19371625 and PMID:23019147 SLC6A6 Human genistein affects expression EXP 6480464 Genistein affects the expression of SLC6A6 mRNA CTD PMID:26865667 SLC6A6 Human gentamycin decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of SLC6A6 mRNA CTD PMID:33387578 SLC6A6 Human glycidyl methacrylate decreases expression EXP 6480464 glycidyl methacrylate results in decreased expression of SLC6A6 protein CTD PMID:36641056 SLC6A6 Human imipramine affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Imipramine affects the expression of SLC6A6 mRNA CTD PMID:18355885 SLC6A6 Human indole-3-methanol affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 indole-3-carbinol affects the expression of SLC6A6 mRNA CTD PMID:21396975 SLC6A6 Human indole-3-methanol multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of SLC6A6 mRNA CTD PMID:22129741 SLC6A6 Human ketoconazole affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Ketoconazole affects the expression of SLC6A6 mRNA CTD PMID:18355885 SLC6A6 Human L-ethionine affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Ethionine affects the expression of SLC6A6 mRNA CTD PMID:19483382 SLC6A6 Human lead diacetate decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 lead acetate results in decreased expression of SLC6A6 mRNA CTD PMID:11578147 SLC6A6 Human lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of SLC6A6 mRNA CTD PMID:38568856 SLC6A6 Human lead(II) chloride multiple interactions EXP 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of SLC6A6 mRNA CTD PMID:18654764 SLC6A6 Human manganese atom increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Manganese results in increased expression of SLC6A6 mRNA CTD PMID:20832424 SLC6A6 Human manganese(0) increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Manganese results in increased expression of SLC6A6 mRNA CTD PMID:20832424 SLC6A6 Human metformin increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Metformin results in increased expression of SLC6A6 mRNA CTD PMID:25596134 SLC6A6 Human methidathion increases expression ISO Slc6a6 (Mus musculus) 6480464 methidathion results in increased expression of SLC6A6 mRNA CTD PMID:34813904 SLC6A6 Human methimazole increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Methimazole results in increased expression of SLC6A6 mRNA CTD PMID:30047161 SLC6A6 Human N-acetyl-L-cysteine multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of SLC6A6 mRNA CTD PMID:22129741 SLC6A6 Human N-methyl-4-phenylpyridinium decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of SLC6A6 mRNA CTD PMID:28801915 SLC6A6 Human N-nitrosodiethylamine multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of SLC6A6 mRNA and [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of SLC6A6 mRNA CTD PMID:18164116 and PMID:22129741 SLC6A6 Human N-Nitrosopyrrolidine increases expression EXP 6480464 N-Nitrosopyrrolidine results in increased expression of SLC6A6 mRNA CTD PMID:32234424 SLC6A6 Human nefazodone decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 nefazodone results in decreased expression of SLC6A6 mRNA CTD PMID:24136188 SLC6A6 Human nickel atom increases expression EXP 6480464 Nickel results in increased expression of SLC6A6 mRNA CTD PMID:24768652 and PMID:25583101 SLC6A6 Human nickel sulfate increases expression EXP 6480464 nickel sulfate results in increased expression of SLC6A6 mRNA CTD PMID:22714537 SLC6A6 Human O-methyleugenol increases expression EXP 6480464 methyleugenol results in increased expression of SLC6A6 mRNA CTD PMID:32234424 SLC6A6 Human omeprazole affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Omeprazole affects the expression of SLC6A6 mRNA CTD PMID:19483382 SLC6A6 Human oxaliplatin multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SLC6A6 mRNA CTD PMID:25729387 SLC6A6 Human ozone multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SLC6A6 mRNA more ... CTD PMID:32699268 and PMID:35430440 SLC6A6 Human p-toluidine decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 4-toluidine results in decreased expression of SLC6A6 mRNA CTD PMID:27638505 SLC6A6 Human paracetamol decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of SLC6A6 mRNA CTD PMID:17202762 more ... SLC6A6 Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SLC6A6 mRNA CTD PMID:29067470 SLC6A6 Human paracetamol affects expression ISO Slc6a6 (Mus musculus) 6480464 Acetaminophen affects the expression of SLC6A6 mRNA CTD PMID:17562736 SLC6A6 Human parathion increases expression ISO Slc6a6 (Mus musculus) 6480464 Parathion results in increased expression of SLC6A6 mRNA CTD PMID:34813904 SLC6A6 Human pentachlorophenol increases expression ISO Slc6a6 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of SLC6A6 mRNA CTD PMID:23892564 SLC6A6 Human perfluorooctane-1-sulfonic acid decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 perfluorooctane sulfonic acid results in decreased expression of SLC6A6 mRNA CTD PMID:19162173 SLC6A6 Human perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of SLC6A6 mRNA CTD PMID:36864359 SLC6A6 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Slc6a6 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of SLC6A6 mRNA CTD PMID:36331819 SLC6A6 Human perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of SLC6A6 mRNA CTD PMID:32790152 SLC6A6 Human perfluorooctanoic acid decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 perfluorooctanoic acid results in decreased expression of SLC6A6 mRNA CTD PMID:19162173 SLC6A6 Human perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of SLC6A6 mRNA CTD PMID:36326898 SLC6A6 Human perfluorooctanoic acid multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of SLC6A6 mRNA CTD PMID:35163327 SLC6A6 Human phenformin increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Phenformin results in increased expression of SLC6A6 mRNA CTD PMID:31324951 SLC6A6 Human phenobarbital affects expression ISO Slc6a6 (Mus musculus) 6480464 Phenobarbital affects the expression of SLC6A6 mRNA CTD PMID:23091169 SLC6A6 Human pirinixic acid affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 pirinixic acid affects the expression of SLC6A6 mRNA CTD PMID:19483382 SLC6A6 Human pirinixic acid decreases expression ISO Slc6a6 (Mus musculus) 6480464 pirinixic acid results in decreased expression of SLC6A6 mRNA CTD PMID:23811191 SLC6A6 Human pirinixic acid decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 pirinixic acid results in decreased expression of SLC6A6 mRNA CTD PMID:19162173 SLC6A6 Human potassium chromate decreases expression EXP 6480464 potassium chromate(VI) results in decreased expression of SLC6A6 mRNA CTD PMID:22079256 SLC6A6 Human potassium chromate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SLC6A6 mRNA CTD PMID:22079256 SLC6A6 Human pregnenolone 16alpha-carbonitrile decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Pregnenolone Carbonitrile results in decreased expression of SLC6A6 mRNA CTD PMID:19162173 SLC6A6 Human pregnenolone 16alpha-carbonitrile decreases expression ISO Slc6a6 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of SLC6A6 mRNA CTD PMID:28903501 SLC6A6 Human resveratrol multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of SLC6A6 mRNA CTD PMID:25905778 SLC6A6 Human rotenone increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Rotenone results in increased expression of SLC6A6 mRNA CTD PMID:19013527 SLC6A6 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC6A6 mRNA CTD PMID:27188386 SLC6A6 Human serpentine asbestos decreases expression EXP 6480464 Asbestos and Serpentine results in decreased expression of SLC6A6 mRNA CTD PMID:21148743 SLC6A6 Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of SLC6A6 mRNA and Silicon Dioxide results in increased expression of SLC6A6 mRNA CTD PMID:25351596 and PMID:25895662 SLC6A6 Human sodium arsenate increases expression ISO Slc6a6 (Mus musculus) 6480464 sodium arsenate results in increased expression of SLC6A6 mRNA CTD PMID:21795629 SLC6A6 Human sodium arsenate multiple interactions EXP 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of SLC6A6 mRNA CTD PMID:32525701 SLC6A6 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of SLC6A6 mRNA CTD PMID:21281968 more ... SLC6A6 Human sodium arsenite decreases expression ISO Slc6a6 (Mus musculus) 6480464 sodium arsenite results in decreased expression of SLC6A6 mRNA CTD PMID:37682722 SLC6A6 Human sodium arsenite multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SLC6A6 mRNA CTD PMID:39836092 SLC6A6 Human sodium dichromate decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 sodium bichromate results in decreased expression of SLC6A6 mRNA CTD PMID:25993096 SLC6A6 Human streptozocin multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of SLC6A6 mRNA CTD PMID:25905778 SLC6A6 Human sulfadimethoxine increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of SLC6A6 mRNA CTD PMID:30047161 SLC6A6 Human sulforaphane increases expression EXP 6480464 sulforaphane results in increased expression of SLC6A6 mRNA CTD PMID:31838189 SLC6A6 Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of SLC6A6 mRNA CTD PMID:31533062 SLC6A6 Human tamoxifen affects expression ISO Slc6a6 (Mus musculus) 6480464 Tamoxifen affects the expression of SLC6A6 mRNA CTD PMID:17555576 SLC6A6 Human taurine increases expression ISO Slc6a6 (Mus musculus) 6480464 Taurine results in increased expression of SLC6A6 protein CTD PMID:32017914 SLC6A6 Human temozolomide decreases expression EXP 6480464 Temozolomide results in decreased expression of SLC6A6 mRNA CTD PMID:31758290 SLC6A6 Human testosterone multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of SLC6A6 mRNA CTD PMID:32741896 SLC6A6 Human tetrachloromethane decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of SLC6A6 protein CTD PMID:17544377 SLC6A6 Human tetrachloromethane increases expression ISO Slc6a6 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of SLC6A6 mRNA and Carbon Tetrachloride results in increased expression of SLC6A6 protein CTD PMID:36310519 SLC6A6 Human tetrachloromethane decreases expression ISO Slc6a6 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of SLC6A6 mRNA CTD PMID:31919559 SLC6A6 Human thioacetamide affects expression ISO Slc6a6 (Rattus norvegicus) 6480464 Thioacetamide affects the expression of SLC6A6 mRNA CTD PMID:19483382 SLC6A6 Human thioacetamide increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of SLC6A6 mRNA CTD PMID:34492290 SLC6A6 Human thioacetamide decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of SLC6A6 mRNA CTD PMID:23411599 SLC6A6 Human titanium dioxide multiple interactions ISO Slc6a6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of SLC6A6 mRNA CTD PMID:29950665 SLC6A6 Human topiramate decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 topiramate results in decreased expression of SLC6A6 mRNA CTD PMID:16979414 SLC6A6 Human topotecan multiple interactions ISO Slc6a6 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SLC6A6 mRNA CTD PMID:25729387 SLC6A6 Human topotecan increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Topotecan results in increased expression of SLC6A6 mRNA CTD PMID:25729387 SLC6A6 Human trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of SLC6A6 mRNA CTD PMID:24935251 and PMID:26272509 SLC6A6 Human trichostatin A multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC6A6 mRNA CTD PMID:27188386 SLC6A6 Human triphenyl phosphate decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 triphenyl phosphate results in decreased expression of SLC6A6 mRNA CTD PMID:30589522 SLC6A6 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of SLC6A6 mRNA CTD PMID:37042841 SLC6A6 Human triptonide affects expression ISO Slc6a6 (Mus musculus) 6480464 triptonide affects the expression of SLC6A6 mRNA CTD PMID:33045310 SLC6A6 Human valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of SLC6A6 gene CTD PMID:29154799 SLC6A6 Human valproic acid affects splicing ISO Slc6a6 (Rattus norvegicus) 6480464 Valproic Acid affects the splicing of SLC6A6 mRNA CTD PMID:29427782 SLC6A6 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of SLC6A6 mRNA CTD PMID:24383497 and PMID:24935251 SLC6A6 Human venlafaxine hydrochloride increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 Venlafaxine Hydrochloride results in increased expression of SLC6A6 mRNA CTD PMID:25423262 SLC6A6 Human vinclozolin decreases expression ISO Slc6a6 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of SLC6A6 mRNA CTD PMID:23034163 SLC6A6 Human vinclozolin increases expression ISO Slc6a6 (Rattus norvegicus) 6480464 vinclozolin results in increased expression of SLC6A6 mRNA CTD PMID:23034163 SLC6A6 Human vorinostat decreases expression EXP 6480464 vorinostat results in decreased expression of SLC6A6 mRNA CTD PMID:27188386 SLC6A6 Human zearalenone increases expression EXP 6480464 Zearalenone results in increased expression of SLC6A6 mRNA CTD PMID:19371625
(+)-pilocarpine (ISO) (-)-epigallocatechin 3-gallate (EXP) 1-benzylpiperazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dinitrotoluene (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO) 6-propyl-2-thiouracil (ISO) acetamide (ISO) acrolein (EXP) acrylamide (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (EXP) alpha-pinene (EXP) alpha-Zearalanol (ISO) amiodarone (ISO) amitriptyline (ISO) amitrole (ISO) ammonium chloride (ISO) amphotericin B (EXP) aristolochic acid A (EXP) arsane (EXP) arsenic atom (EXP) atrazine (ISO) avobenzone (EXP) azathioprine (EXP) Azoxymethane (ISO) benzbromarone (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) beta-lapachone (EXP) beta-naphthoflavone (ISO) bexarotene (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) bromobenzene (ISO) butanal (EXP) cadmium atom (EXP) cadmium dichloride (EXP,ISO) cadmium sulfate (EXP) carbon nanotube (ISO) chlordecone (ISO) chloroacetaldehyde (EXP) chloroprene (ISO) chlorpromazine (ISO) cidofovir anhydrous (EXP) cisplatin (EXP,ISO) clofibrate (ISO) clomipramine (ISO) cobalt dichloride (EXP) copper(II) chloride (EXP) copper(II) sulfate (EXP) crocidolite asbestos (EXP) cyclosporin A (EXP) DDE (EXP) decabromodiphenyl ether (ISO) dextran sulfate (ISO) diallyl disulfide (EXP) diallyl trisulfide (EXP) Diallyltetrasulfane (EXP) Dibutyl phosphate (EXP) dibutyl phthalate (ISO) diethylstilbestrol (EXP) dimethylarsinic acid (ISO) dioxygen (EXP) dorsomorphin (EXP) doxorubicin (ISO) endosulfan (ISO) fenthion (ISO) fulvestrant (EXP) genistein (EXP) gentamycin (ISO) glycidyl methacrylate (EXP) imipramine (ISO) indole-3-methanol (ISO) ketoconazole (ISO) L-ethionine (ISO) lead diacetate (EXP,ISO) lead(II) chloride (EXP) manganese atom (ISO) manganese(0) (ISO) metformin (ISO) methidathion (ISO) methimazole (ISO) N-acetyl-L-cysteine (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (ISO) N-Nitrosopyrrolidine (EXP) nefazodone (ISO) nickel atom (EXP) nickel sulfate (EXP) O-methyleugenol (EXP) omeprazole (ISO) oxaliplatin (ISO) ozone (EXP) p-toluidine (ISO) paracetamol (EXP,ISO) parathion (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP,ISO) phenformin (ISO) phenobarbital (ISO) pirinixic acid (ISO) potassium chromate (EXP) pregnenolone 16alpha-carbonitrile (ISO) resveratrol (ISO) rotenone (ISO) SB 431542 (EXP) serpentine asbestos (EXP) silicon dioxide (EXP) sodium arsenate (EXP,ISO) sodium arsenite (EXP,ISO) sodium dichromate (ISO) streptozocin (ISO) sulfadimethoxine (ISO) sulforaphane (EXP) sunitinib (EXP) tamoxifen (ISO) taurine (ISO) temozolomide (EXP) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (ISO) titanium dioxide (ISO) topiramate (ISO) topotecan (ISO) trichostatin A (EXP) triphenyl phosphate (EXP,ISO) triptonide (ISO) valproic acid (EXP,ISO) venlafaxine hydrochloride (ISO) vinclozolin (ISO) vorinostat (EXP) zearalenone (EXP)
SLC6A6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 14,402,576 - 14,489,349 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 14,402,576 - 14,489,349 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 14,444,076 - 14,530,857 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 14,419,110 - 14,505,861 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 14,419,109 - 14,503,973 NCBI Celera 3 14,382,349 - 14,469,089 (+) NCBI Celera Cytogenetic Map 3 p25.1 ENTREZGENE HuRef 3 14,380,198 - 14,466,798 (+) NCBI HuRef CHM1_1 3 14,395,197 - 14,481,943 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 14,405,068 - 14,491,755 (+) NCBI T2T-CHM13v2.0
Slc6a6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 91,661,031 - 91,736,044 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 91,661,034 - 91,736,047 (+) Ensembl GRCm39 Ensembl GRCm38 6 91,684,048 - 91,759,063 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 91,684,053 - 91,759,066 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 91,634,061 - 91,709,057 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 91,649,599 - 91,724,567 (+) NCBI MGSCv36 mm8 Celera 6 93,577,782 - 93,652,873 (+) NCBI Celera Cytogenetic Map 6 D1 NCBI cM Map 6 40.73 NCBI
Slc6a6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 125,752,340 - 125,826,033 (+) NCBI GRCr8 mRatBN7.2 4 124,195,186 - 124,268,880 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 124,195,218 - 124,268,875 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 129,662,156 - 129,732,221 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 125,436,590 - 125,506,651 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 124,061,127 - 124,131,197 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 123,638,619 - 123,713,469 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 123,642,210 - 123,713,464 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 188,172,660 - 188,246,142 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 125,875,817 - 125,945,795 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 126,120,297 - 126,190,631 (+) NCBI Celera 4 113,114,633 - 113,184,598 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
Slc6a6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955429 17,098,268 - 17,130,433 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955429 17,097,753 - 17,130,079 (+) NCBI ChiLan1.0 ChiLan1.0
SLC6A6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 14,383,728 - 14,471,476 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 14,384,213 - 14,476,238 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 14,323,251 - 14,411,949 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 14,663,949 - 14,752,326 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 14,663,955 - 14,752,326 (+) Ensembl panpan1.1 panPan2
SLC6A6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 4,544,739 - 4,616,797 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 4,531,771 - 4,620,605 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 4,569,550 - 4,653,981 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 4,553,241 - 4,637,965 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 4,553,024 - 4,638,198 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 4,272,086 - 4,356,526 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 4,594,760 - 4,679,179 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 4,605,361 - 4,690,391 (+) NCBI UU_Cfam_GSD_1.0
Slc6a6
SLC6A6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 70,094,079 - 70,173,582 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 70,094,073 - 70,173,581 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 77,572,736 - 77,608,407 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC6A6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 50,344,781 - 50,431,765 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 50,344,805 - 50,431,766 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 116,063,292 - 116,150,295 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc6a6
.
Predicted Target Of
Count of predictions: 8947 Count of miRNA genes: 1361 Interacting mature miRNAs: 1792 Transcripts: ENST00000360861, ENST00000416216, ENST00000427436, ENST00000428884, ENST00000435095, ENST00000452151, ENST00000452775, ENST00000454876, ENST00000458124, ENST00000484191, ENST00000490683 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
406965667 GWAS614643_H response to antineoplastic agent QTL GWAS614643 (human) 0.000001 response to antineoplastic agent 3 14439270 14439271 Human 597134973 GWAS1231047_H pulse pressure measurement QTL GWAS1231047 (human) 0.000002 pulse pressure measurement pulse pressure (CMO:0000292) 3 14441169 14441170 Human 597198706 GWAS1294780_H systolic blood pressure QTL GWAS1294780 (human) 0.000006 systolic blood pressure systolic blood pressure (CMO:0000004) 3 14441169 14441170 Human 597051864 GWAS1147938_H systolic blood pressure QTL GWAS1147938 (human) 5e-08 systolic blood pressure systolic blood pressure (CMO:0000004) 3 14441169 14441170 Human 597334601 GWAS1430675_H educational attainment QTL GWAS1430675 (human) 9e-12 educational attainment 3 14468934 14468935 Human 597294668 GWAS1390742_H revision of total joint arthroplasty QTL GWAS1390742 (human) 2e-10 revision of total joint arthroplasty 3 14464025 14464026 Human 406912758 GWAS561734_H disease recurrence, unipolar depression, bipolar disorder, schizophrenia, sex interaction measurement QTL GWAS561734 (human) 0.000009 disease recurrence, unipolar depression, bipolar disorder, schizophrenia, sex interaction measurement 3 14465290 14465291 Human 596973475 GWAS1092994_H disease recurrence, bipolar disorder, schizophrenia, sex interaction measurement, major depressive disorder QTL GWAS1092994 (human) 0.000009 disease recurrence, bipolar disorder, schizophrenia, sex interaction measurement, major depressive disorder 3 14465290 14465291 Human 597333004 GWAS1429078_H S-warfarin measurement QTL GWAS1429078 (human) 0.000003 S-warfarin measurement 3 14472862 14472863 Human 406898550 GWAS547526_H neuropsychological test QTL GWAS547526 (human) 0.000003 neuropsychological test 3 14489213 14489214 Human 597210607 GWAS1306681_H waist-hip ratio QTL GWAS1306681 (human) 0.0000005 waist-hip ratio waist to hip ratio (WHR) (CMO:0000020) 3 14425755 14425756 Human 2316345 GLUCO224_H Glucose level QTL 224 (human) 1.27 0.008 Glucose level 3 1 21543441 Human 597247587 GWAS1343661_H disease recurrence, bipolar disorder, schizophrenia, sex interaction measurement, major depressive disorder QTL GWAS1343661 (human) 0.000009 disease recurrence, bipolar disorder, schizophrenia, sex interaction measurement, major depressive disorder 3 14465290 14465291 Human 597294466 GWAS1390540_H revision of total knee arthroplasty QTL GWAS1390540 (human) 3e-08 revision of total knee arthroplasty 3 14466803 14466804 Human 597294471 GWAS1390545_H revision of total joint arthroplasty, aseptic loosening QTL GWAS1390545 (human) 2e-10 revision of total joint arthroplasty, aseptic loosening 3 14467207 14467208 Human 597036329 GWAS1132403_H gut microbiome measurement QTL GWAS1132403 (human) 0.0000004 gut microbiome measurement 3 14486520 14486521 Human
D3S3892
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 14,526,733 - 14,526,823 UniSTS GRCh37 Build 36 3 14,501,737 - 14,501,827 RGD NCBI36 Celera 3 14,464,965 - 14,465,055 RGD Cytogenetic Map 3 p25.1 UniSTS HuRef 3 14,462,798 - 14,462,888 UniSTS GeneMap99-G3 RH Map 3 704.0 UniSTS
STS-M78677
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 14,523,191 - 14,523,321 UniSTS GRCh37 Build 36 3 14,498,195 - 14,498,325 RGD NCBI36 Celera 3 14,461,423 - 14,461,553 RGD Cytogenetic Map 3 p25.1 UniSTS HuRef 3 14,459,252 - 14,459,382 UniSTS GeneMap99-GB4 RH Map 3 56.17 UniSTS
D3S1325E
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 14,523,203 - 14,523,321 UniSTS GRCh37 Build 36 3 14,498,207 - 14,498,325 RGD NCBI36 Celera 3 14,461,435 - 14,461,553 RGD Cytogenetic Map 3 p25.1 UniSTS HuRef 3 14,459,264 - 14,459,382 UniSTS
D3S2754E
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 14,530,647 - 14,530,729 UniSTS GRCh37 Build 36 3 14,505,651 - 14,505,733 RGD NCBI36 Celera 3 14,468,879 - 14,468,961 RGD Cytogenetic Map 3 p25.1 UniSTS Cytogenetic Map 3 p24-p23 UniSTS HuRef 3 14,466,588 - 14,466,670 UniSTS
G67701
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 14,526,438 - 14,526,776 UniSTS GRCh37 Build 36 3 14,501,442 - 14,501,780 RGD NCBI36 Celera 3 14,464,670 - 14,465,008 RGD Cytogenetic Map 3 p25.1 UniSTS HuRef 3 14,462,499 - 14,462,841 UniSTS
G67700
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 14,444,529 - 14,444,848 UniSTS GRCh37 Build 36 3 14,419,533 - 14,419,852 RGD NCBI36 Celera 3 14,382,764 - 14,383,083 RGD Cytogenetic Map 3 p25.1 UniSTS HuRef 3 14,380,643 - 14,380,966 UniSTS
D3S4548
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 14,526,562 - 14,526,721 UniSTS GRCh37 Build 36 3 14,501,566 - 14,501,725 RGD NCBI36 Celera 3 14,464,794 - 14,464,953 RGD Cytogenetic Map 3 p25.1 UniSTS HuRef 3 14,462,623 - 14,462,786 UniSTS
SHGC-31156
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 14,512,685 - 14,512,834 UniSTS GRCh37 Build 36 3 14,487,689 - 14,487,838 RGD NCBI36 Celera 3 14,450,917 - 14,451,066 RGD Cytogenetic Map 3 p25.1 UniSTS HuRef 3 14,448,746 - 14,448,895 UniSTS TNG Radiation Hybrid Map 3 7879.0 UniSTS Stanford-G3 RH Map 3 704.0 UniSTS GeneMap99-GB4 RH Map 3 56.69 UniSTS Whitehead-RH Map 3 62.1 UniSTS NCBI RH Map 3 179.9 UniSTS GeneMap99-G3 RH Map 3 704.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2433
2788
2245
4945
1723
2345
5
622
1949
464
2268
7285
6456
52
3711
847
1732
1612
171
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000452151 ⟹ ENSP00000399522
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 14,472,242 - 14,484,903 (+) Ensembl
Ensembl Acc Id:
ENST00000452775 ⟹ ENSP00000402059
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 14,432,670 - 14,445,816 (+) Ensembl
Ensembl Acc Id:
ENST00000610642 ⟹ ENSP00000482391
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 14,402,576 - 14,478,901 (+) Ensembl
Ensembl Acc Id:
ENST00000613060 ⟹ ENSP00000481625
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 14,402,576 - 14,489,349 (+) Ensembl
Ensembl Acc Id:
ENST00000613930
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 14,402,621 - 14,444,342 (+) Ensembl
Ensembl Acc Id:
ENST00000615188
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 14,402,648 - 14,458,026 (+) Ensembl
Ensembl Acc Id:
ENST00000618278 ⟹ ENSP00000481946
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 14,402,576 - 14,489,349 (+) Ensembl
Ensembl Acc Id:
ENST00000621751 ⟹ ENSP00000482560
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 14,402,620 - 14,448,188 (+) Ensembl
Ensembl Acc Id:
ENST00000622176 ⟹ ENSP00000482220
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 14,402,625 - 14,458,061 (+) Ensembl
Ensembl Acc Id:
ENST00000622186 ⟹ ENSP00000480890
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 14,402,606 - 14,489,349 (+) Ensembl
Ensembl Acc Id:
ENST00000622810
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 14,402,576 - 14,411,323 (+) Ensembl
Ensembl Acc Id:
ENST00000649500 ⟹ ENSP00000497250
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 14,402,584 - 14,489,307 (+) Ensembl
RefSeq Acc Id:
NM_001134367 ⟹ NP_001127839
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 14,402,576 - 14,489,349 (+) NCBI GRCh37 3 14,444,076 - 14,530,857 (+) NCBI HuRef 3 14,380,198 - 14,466,798 (+) NCBI CHM1_1 3 14,395,197 - 14,481,943 (+) NCBI T2T-CHM13v2.0 3 14,405,068 - 14,491,755 (+) NCBI
Sequence:
ATTTTTCCACCCAGCAGGATGGGTGATGCTGAGAGCTGCCTGCTCAGACAACAGACACGCGAGGTCAGGAAGAAGCCGCTTATAAATTACCGCTTCCTTCGCGCCGCCGCCAACGCCGAGCCCCGAGG
hide sequence
RefSeq Acc Id:
NM_001134368 ⟹ NP_001127840
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 14,402,606 - 14,448,188 (+) NCBI GRCh37 3 14,444,076 - 14,530,857 (+) NCBI HuRef 3 14,380,198 - 14,466,798 (+) NCBI CHM1_1 3 14,395,197 - 14,440,797 (+) NCBI T2T-CHM13v2.0 3 14,405,098 - 14,450,612 (+) NCBI
Sequence:
GAGAGCTGCCTGCTCAGACAACAGACACGCGAGGTCAGGAAGAAGCCGCTTATAAATTACCGCT
hide sequence
RefSeq Acc Id:
NM_003043 ⟹ NP_003034
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 14,402,606 - 14,489,349 (+) NCBI Build 36 3 14,419,110 - 14,505,861 (+) NCBI Archive HuRef 3 14,380,198 - 14,466,798 (+) NCBI CHM1_1 3 14,395,197 - 14,481,943 (+) NCBI T2T-CHM13v2.0 3 14,405,098 - 14,491,755 (+) NCBI
Sequence:
GAGAGCTGCCTGCTCAGACAACAGACACGCGAGGTCAGGAAGAAGCCGCTTATAAATTACCGCT
hide sequence
RefSeq Acc Id:
NR_103507
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 14,402,606 - 14,489,349 (+) NCBI HuRef 3 14,380,198 - 14,466,798 (+) NCBI CHM1_1 3 14,395,197 - 14,481,943 (+) NCBI T2T-CHM13v2.0 3 14,405,098 - 14,491,755 (+) NCBI
Sequence:
GAGAGCTGCCTGCTCAGACAACAGACACGCGAGGTCAGGAAGAAGCCGCTTATAAATTACCGCT
hide sequence
RefSeq Acc Id:
XM_006713307 ⟹ XP_006713370
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 14,432,416 - 14,489,349 (+) NCBI
Sequence:
AAGTCCAACAGTGCGCGACTCCCCAGGTCAGGAGAAGCCCCGATGTGTGCAGAATCTGCAGATG
hide sequence
RefSeq Acc Id:
XM_011534030 ⟹ XP_011532332
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 14,426,250 - 14,489,349 (+) NCBI
Sequence:
ACTTCCTGGCTGTGCAACCTCGGTCAAGTCGCTTATTGATTCTGAGCCGTAGTTCCTCATCTCCATTTGGGAAAGCAAGGAGATGGCCACCAAGGAGAAGCTGCAGTGTCTGAAAGATTTCCACAAGG
hide sequence
RefSeq Acc Id:
XM_047448762 ⟹ XP_047304718
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 14,443,775 - 14,489,349 (+) NCBI
RefSeq Acc Id:
XM_047448763 ⟹ XP_047304719
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 14,432,416 - 14,472,316 (+) NCBI
RefSeq Acc Id:
XM_054347618 ⟹ XP_054203593
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 14,434,554 - 14,491,755 (+) NCBI
RefSeq Acc Id:
XM_054347619 ⟹ XP_054203594
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 14,446,205 - 14,491,755 (+) NCBI
RefSeq Acc Id:
XM_054347620 ⟹ XP_054203595
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 14,432,509 - 14,474,722 (+) NCBI
RefSeq Acc Id:
XR_008486778
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 14,432,508 - 14,484,156 (+) NCBI
RefSeq Acc Id:
XR_940495
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 14,432,416 - 14,481,749 (+) NCBI
Sequence:
AAGTCCAACAGTGCGCGACTCCCCAGGTCAGGAGAAGCCCCGATGTGTGCAGAATCTGCAGATG
hide sequence
RefSeq Acc Id:
NP_003034 ⟸ NM_003043
- Peptide Label:
isoform a
- UniProtKB:
Q9BRI2 (UniProtKB/Swiss-Prot), B2RNU7 (UniProtKB/Swiss-Prot), Q9BXB0 (UniProtKB/Swiss-Prot), P31641 (UniProtKB/Swiss-Prot)
- Sequence:
MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEIIIGQYTSEGGITCWEKICPLFSGIGYASV
hide sequence
RefSeq Acc Id:
NP_001127839 ⟸ NM_001134367
- Peptide Label:
isoform c
- UniProtKB:
A0A087WY96 (UniProtKB/TrEMBL)
- Sequence:
MGDAESCLLRQQTREVRKKPLINYRFLRAAANAEPRGPQAQRTSCAKRECGAFTQRVRERAGRQPPAGGTRHSRAERGRRRSHPRSRTRTTALLRSSQTKEMATKEKLQCLKDFHKDILKPSPGKSPG
hide sequence
RefSeq Acc Id:
NP_001127840 ⟸ NM_001134368
- Peptide Label:
isoform b
- UniProtKB:
P31641 (UniProtKB/Swiss-Prot), B4E140 (UniProtKB/TrEMBL)
- Sequence:
MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEIIIGQYTSEGGITCWEKICPLFSGIGYASV
hide sequence
RefSeq Acc Id:
XP_006713370 ⟸ XM_006713307
- Peptide Label:
isoform X1
- Sequence:
MCAESADGAALGPASGCGNRPPSTQESKEMATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEI
hide sequence
RefSeq Acc Id:
XP_011532332 ⟸ XM_011534030
- Peptide Label:
isoform X2
- UniProtKB:
Q9BRI2 (UniProtKB/Swiss-Prot), B2RNU7 (UniProtKB/Swiss-Prot), Q9BXB0 (UniProtKB/Swiss-Prot), P31641 (UniProtKB/Swiss-Prot)
- Sequence:
MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVGLGNV
hide sequence
Ensembl Acc Id:
ENSP00000497250 ⟸ ENST00000649500
Ensembl Acc Id:
ENSP00000482560 ⟸ ENST00000621751
Ensembl Acc Id:
ENSP00000480890 ⟸ ENST00000622186
Ensembl Acc Id:
ENSP00000482220 ⟸ ENST00000622176
Ensembl Acc Id:
ENSP00000402059 ⟸ ENST00000452775
Ensembl Acc Id:
ENSP00000399522 ⟸ ENST00000452151
Ensembl Acc Id:
ENSP00000482391 ⟸ ENST00000610642
Ensembl Acc Id:
ENSP00000481625 ⟸ ENST00000613060
Ensembl Acc Id:
ENSP00000481946 ⟸ ENST00000618278
RefSeq Acc Id:
XP_047304719 ⟸ XM_047448763
- Peptide Label:
isoform X4
- UniProtKB:
Q59GD7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047304718 ⟸ XM_047448762
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_054203595 ⟸ XM_054347620
- Peptide Label:
isoform X4
- UniProtKB:
Q59GD7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054203593 ⟸ XM_054347618
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_054203594 ⟸ XM_054347619
- Peptide Label:
isoform X3
RGD ID: 6863666 Promoter ID: EPDNEW_H4998 Type: initiation region Name: SLC6A6_1 Description: solute carrier family 6 member 6 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 3 14,402,621 - 14,402,681 EPDNEW
RGD ID: 6801700 Promoter ID: HG_KWN:43869 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: NM_003043, OTTHUMT00000340507, OTTHUMT00000340508, OTTHUMT00000340509, OTTHUMT00000340510, OTTHUMT00000340512, OTTHUMT00000340513, OTTHUMT00000340514, UC003BYR.1, UC010HEE.1, UC010HEF.1 Position: Human Assembly Chr Position (strand) Source Build 36 3 14,418,726 - 14,419,357 (+) MPROMDB
RGD ID: 6801702 Promoter ID: HG_KWN:43870 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000340515 Position: Human Assembly Chr Position (strand) Source Build 36 3 14,448,371 - 14,449,592 (+) MPROMDB
RGD ID: 6801701 Promoter ID: HG_KWN:43871 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, K562 Transcripts: OTTHUMT00000340516 Position: Human Assembly Chr Position (strand) Source Build 36 3 14,488,841 - 14,489,341 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-08
SLC6A6
solute carrier family 6 member 6
solute carrier family 6 (neurotransmitter transporter), member 6
Symbol and/or name change
5135510 APPROVED
2013-07-23
SLC6A6
solute carrier family 6 (neurotransmitter transporter), member 6
solute carrier family 6 (neurotransmitter transporter, taurine), member 6
Symbol and/or name change
5135510 APPROVED
