Advanced Search (OLGA)

Gene: Gabrg1 (gamma-aminobutyric acid type A receptor subunit gamma 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Gabrg1

Name:

gamma-aminobutyric acid type A receptor subunit gamma 1

RGD ID:

621732

Description:

Enables GABA receptor binding activity and GABA-A receptor activity. Predicted to be involved in several processes, including GABAergic synaptic transmission; chloride transmembrane transport; and inhibitory synapse assembly. Predicted to act upstream of or within chemical synaptic transmission. Part of receptor complex. Orthologous to human GABRG1 (gamma-aminobutyric acid type A receptor subunit gamma1); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

GABA(A) receptor subunit gamma-1; GABAAR subunit gamma-1; gamma-aminobutyric acid (GABA) A receptor, gamma 1; gamma-aminobutyric acid A receptor, gamma 1; gamma-aminobutyric acid receptor subunit gamma-1; gamma-aminobutyric acid type A receptor gamma 1 subunit

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	37,750,292 - 37,821,651 (+)	NCBI		GRCr8
mRatBN7.2	14	37,396,217 - 37,469,606 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	37,396,294 - 37,635,956 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	37,753,276 - 37,828,496 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	39,058,046 - 39,133,276 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	37,538,976 - 37,614,195 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	39,964,502 - 40,051,306 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	39,964,588 - 40,049,354 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	39,777,443 - 39,860,718 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	39,878,182 - 39,951,391 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	39,880,572 - 39,953,782 (+)	NCBI
Celera	14	36,610,452 - 36,681,348 (+)	NCBI		Celera
Cytogenetic Map	14	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gabrg1	Rat	prostate cancer		ISO	GABRG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Malignant tumor of prostate	ClinVar	PMID:23265383

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gabrg1	Rat	trigeminal neuralgia		ISS	Gabrg1 (Mus musculus)	13592920	OMIM:190400	MouseDO

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gabrg1	Rat	17alpha-ethynylestradiol	affects expression	EXP		6480464	Ethinyl Estradiol affects the expression of GABRG1 mRNA	CTD	PMID:16079270
Gabrg1	Rat	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of GABRG1 mRNA	CTD	PMID:29097150
Gabrg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of GABRG1 mRNA	CTD	PMID:32109520
Gabrg1	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of GABRG1 mRNA	CTD	PMID:28522335
Gabrg1	Rat	8-Br-cAMP	increases expression	ISO	GABRG1 (Homo sapiens)	6480464	8-Bromo Cyclic Adenosine Monophosphate results in increased expression of GABRG1 mRNA	CTD	PMID:22079614
Gabrg1	Rat	aflatoxin B1	decreases methylation	ISO	GABRG1 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of GABRG1 gene	CTD	PMID:27153756
Gabrg1	Rat	alendronic acid	affects expression	EXP		6480464	Alendronate affects the expression of GABRG1 mRNA	CTD	PMID:16079270
Gabrg1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of GABRG1 mRNA	CTD	PMID:16483693
Gabrg1	Rat	benzo[a]pyrene	decreases methylation	ISO	GABRG1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of GABRG1 3' UTR more ...	CTD	PMID:27901495
Gabrg1	Rat	beta-naphthoflavone	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of GABRG1 mRNA	CTD	PMID:18164116
Gabrg1	Rat	bicuculline	decreases expression	EXP		6480464	Bicuculline results in decreased expression of GABRG1 mRNA	CTD	PMID:9600394
Gabrg1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of GABRG1 mRNA	CTD	PMID:25181051 more ...
Gabrg1	Rat	bisphenol A	decreases expression	ISO	Gabrg1 (Mus musculus)	6480464	bisphenol A results in decreased expression of GABRG1 mRNA	CTD	PMID:32156529
Gabrg1	Rat	bisphenol A	increases expression	ISO	Gabrg1 (Mus musculus)	6480464	bisphenol A results in increased expression of GABRG1 mRNA	CTD	PMID:30951980
Gabrg1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of GABRG1 mRNA	CTD	PMID:29097150
Gabrg1	Rat	CGP 52608	multiple interactions	ISO	GABRG1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to GABRG1 gene]	CTD	PMID:28238834
Gabrg1	Rat	clothianidin	increases expression	ISO	Gabrg1 (Mus musculus)	6480464	clothianidin results in increased expression of GABRG1 mRNA	CTD	PMID:35264496
Gabrg1	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of GABRG1 mRNA	CTD	PMID:27523638
Gabrg1	Rat	dieldrin	decreases expression	EXP		6480464	Dieldrin results in decreased expression of GABRG1 mRNA	CTD	PMID:9600394
Gabrg1	Rat	famotidine	multiple interactions	EXP		6480464	Famotidine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG1 protein]] and Famotidine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA3 protein binds to GABRB2 protein binds to GABRG1 protein]]	CTD	PMID:15363660
Gabrg1	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of GABRG1 mRNA	CTD	PMID:30307764
Gabrg1	Rat	flavonoids	increases expression	EXP		6480464	Flavonoids results in increased expression of GABRG1 mRNA	CTD	PMID:18035473
Gabrg1	Rat	gamma-aminobutyric acid	multiple interactions	EXP		6480464	Famotidine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG1 protein]] more ...	CTD	PMID:15363660
Gabrg1	Rat	gamma-aminobutyric acid	multiple interactions	ISO	GABRG1 (Homo sapiens)	6480464	gamma-Aminobutyric Acid results in increased activity of [GABRA6 protein binds to GABRB3 protein binds to GABRG1 protein]	CTD	PMID:29038840
Gabrg1	Rat	maneb	multiple interactions	ISO	Gabrg1 (Mus musculus)	6480464	[Maneb co-treated with Paraquat] results in decreased expression of GABRG1 mRNA	CTD	PMID:36117858
Gabrg1	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of GABRG1 mRNA	CTD	PMID:18164116
Gabrg1	Rat	paraquat	multiple interactions	ISO	Gabrg1 (Mus musculus)	6480464	[Maneb co-treated with Paraquat] results in decreased expression of GABRG1 mRNA	CTD	PMID:36117858
Gabrg1	Rat	pirinixic acid	increases expression	ISO	Gabrg1 (Mus musculus)	6480464	pirinixic acid results in increased expression of GABRG1 mRNA	CTD	PMID:23811191
Gabrg1	Rat	raloxifene	affects expression	EXP		6480464	Raloxifene Hydrochloride affects the expression of GABRG1 mRNA	CTD	PMID:16079270
Gabrg1	Rat	tetrachloromethane	affects expression	EXP		6480464	Carbon Tetrachloride affects the expression of GABRG1 mRNA	CTD	PMID:12734012
Gabrg1	Rat	trichloroethene	decreases methylation	EXP		6480464	Trichloroethylene results in decreased methylation of GABRG1 gene	CTD	PMID:27618143
Gabrg1	Rat	valproic acid	decreases methylation	ISO	GABRG1 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of GABRG1 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gabrg1	Rat	chemical synaptic transmission	acts_upstream_of_or_within	ISO	Gabrg1 (Mus musculus)	1624291	PMID:11891290	RGD	PMID:11891290
Gabrg1	Rat	chemical synaptic transmission	acts_upstream_of_or_within	IEA	UniProtKB:Q9R0Y8 and ensembl:ENSMUSP00000031119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gabrg1	Rat	chloride transmembrane transport	involved_in	IEA	GO:0005254	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Gabrg1	Rat	chloride transmembrane transport	involved_in	IBA	MGI:95623 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gabrg1	Rat	chloride transport	involved_in	IEA	UniProtKB-KW:KW-0869	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gabrg1	Rat	chloride transport	involved_in	IEA	InterPro:IPR005437 and InterPro:IPR005438	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gabrg1	Rat	gamma-aminobutyric acid signaling pathway	involved_in	IEA	InterPro:IPR005437 and InterPro:IPR005438	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gabrg1	Rat	gamma-aminobutyric acid signaling pathway	involved_in	IBA	MGI:95623 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gabrg1	Rat	inhibitory synapse assembly	involved_in	IBA	MGI:95613 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gabrg1	Rat	monoatomic ion transmembrane transport	involved_in	IEA	InterPro:IPR006028 and InterPro:IPR006201	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gabrg1	Rat	monoatomic ion transmembrane transport	involved_in	IEA	UniProtKB-KW:KW-0407	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gabrg1	Rat	monoatomic ion transport	involved_in	IEA	UniProtKB-KW:KW-0406	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gabrg1	Rat	monoatomic ion transport	involved_in	IEA	InterPro:IPR006029 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gabrg1	Rat	synaptic transmission, GABAergic	involved_in	IBA	PANTHER:PTN000436343 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gabrg1	Rat	chloride channel complex	part_of	IEA	UniProtKB-KW:KW-0869	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gabrg1	Rat	dendrite membrane	is_active_in	IBA	PANTHER:PTN000436343 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gabrg1	Rat	GABA-A receptor complex	part_of	IBA	MGI:95623 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gabrg1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gabrg1	Rat	membrane	located_in	IEA	InterPro:IPR005437 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gabrg1	Rat	plasma membrane	located_in	ISO	GABRG1 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Gabrg1	Rat	plasma membrane	located_in	IEA	UniProtKB:Q8N1C3 and ensembl:ENSP00000295452	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gabrg1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gabrg1	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gabrg1	Rat	postsynapse	is_active_in	IBA	MGI:95614 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gabrg1	Rat	postsynaptic membrane	located_in	IEA	UniProtKB-SubCell:SL-0219	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gabrg1	Rat	postsynaptic membrane	located_in	IEA	UniProtKB-KW:KW-0628	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gabrg1	Rat	receptor complex		IDA		6480233		RGD
Gabrg1	Rat	synapse	located_in	IEA	UniProtKB-KW:KW-0770	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gabrg1	Rat	benzodiazepine receptor activity	contributes_to	IBA	PANTHER:PTN001055383 and Gabra6 (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gabrg1	Rat	chloride channel activity	enables	IEA	UniProtKB-KW:KW-0869	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gabrg1	Rat	chloride channel activity	contributes_to	IBA	MGI:95613 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gabrg1	Rat	extracellular ligand-gated monoatomic ion channel activity	enables	IEA	InterPro:IPR006202 and InterPro:IPR036734	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gabrg1	Rat	GABA receptor binding		IPI	Gabrb1 (Rattus norvegicus)	6480233		RGD
Gabrg1	Rat	GABA receptor binding		IPI	Gabra5 (Rattus norvegicus)	6480233		RGD
Gabrg1	Rat	GABA-A receptor activity		IDA		728439		RGD
Gabrg1	Rat	GABA-A receptor activity	enables	IEA	InterPro:IPR005437 and InterPro:IPR005438	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gabrg1	Rat	GABA-gated chloride ion channel activity	enables	IBA	MGI:95617 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gabrg1	Rat	monoatomic ion channel activity	enables	IEA	InterPro:IPR006028 and InterPro:IPR006201	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gabrg1	Rat	protein binding	enables	ISO	GABRG1 (Homo sapiens)	1624291	UniProtKB:Q96CV9 and PMID:32814053	RGD	PMID:32814053
Gabrg1	Rat	transmembrane signaling receptor activity	enables	IEA	InterPro:IPR006028 and InterPro:IPR006201	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Identification, coassembly, and activity of gamma-aminobutyric acid receptor subunits in renal proximal tubular cells.	Sarang SS, etal., J Pharmacol Exp Ther. 2008 Jan;324(1):376-82. Epub 2007 Oct 24.
8.	Structural and functional characterization of the gamma 1 subunit of GABAA/benzodiazepine receptors.	Ymer S, etal., EMBO J 1990 Oct;9(10):3261-7.

PMID:10900017	PMID:11891290	PMID:18292084	PMID:24425869	PMID:33288547

Gabrg1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	37,750,292 - 37,821,651 (+)	NCBI		GRCr8
mRatBN7.2	14	37,396,217 - 37,469,606 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	37,396,294 - 37,635,956 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	37,753,276 - 37,828,496 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	39,058,046 - 39,133,276 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	37,538,976 - 37,614,195 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	39,964,502 - 40,051,306 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	39,964,588 - 40,049,354 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	39,777,443 - 39,860,718 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	39,878,182 - 39,951,391 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	39,880,572 - 39,953,782 (+)	NCBI
Celera	14	36,610,452 - 36,681,348 (+)	NCBI		Celera
Cytogenetic Map	14	p11	NCBI

GABRG1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	46,035,769 - 46,124,054 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	46,035,769 - 46,124,054 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	46,037,786 - 46,126,071 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	45,732,543 - 45,820,839 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	45,878,716 - 45,967,010	NCBI
Celera	4	46,488,013 - 46,574,168 (-)	NCBI		Celera
Cytogenetic Map	4	p12	NCBI
HuRef	4	45,360,145 - 45,446,265 (-)	NCBI		HuRef
CHM1_1	4	46,036,916 - 46,125,198 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	46,004,706 - 46,090,897 (-)	NCBI		T2T-CHM13v2.0

Gabrg1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	70,906,512 - 70,999,960 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	70,908,390 - 70,999,960 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	70,751,047 - 70,842,617 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	70,751,047 - 70,842,617 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	71,142,286 - 71,233,856 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	71,030,182 - 71,121,752 (-)	NCBI		MGSCv36	mm8
Celera	5	68,018,391 - 68,111,259 (-)	NCBI		Celera
Cytogenetic Map	5	C3.1	NCBI
cM Map	5	37.43	NCBI

Gabrg1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955443	2,276,555 - 2,347,983 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955443	2,276,592 - 2,353,312 (+)	NCBI	ChiLan1.0	ChiLan1.0

GABRG1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	81,746,482 - 81,833,268 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	82,010,545 - 82,097,452 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	76,034,539 - 76,121,797 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	86,762,932 - 86,850,033 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	86,762,417 - 86,850,033 (+)	Ensembl	panpan1.1		panPan2

GABRG1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	42,194,929 - 42,276,379 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	42,200,202 - 42,276,711 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	42,147,102 - 42,226,119 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	42,802,382 - 42,881,664 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	42,802,403 - 42,881,644 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	42,478,701 - 42,559,787 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	42,542,428 - 42,621,417 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	42,891,593 - 42,972,762 (-)	NCBI		UU_Cfam_GSD_1.0

Gabrg1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	33,824,202 - 33,908,100 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936482	12,392,248 - 12,474,056 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936482	12,390,328 - 12,473,904 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GABRG1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	36,198,060 - 36,262,430 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	36,198,056 - 36,262,492 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	38,019,051 - 38,061,900 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GABRG1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	4,133,320 - 4,224,366 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	4,133,161 - 4,219,122 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	50,208,763 - 50,323,326 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gabrg1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624761	20,964,276 - 21,040,418 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624761	20,964,359 - 21,045,151 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Gabrg1
370 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	116
Count of miRNA genes:	93
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000003240
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1581500	Renag1	Renal agenesis QTL 1			kidney development trait (VT:0000527)	percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940)	14	8170668	68298175	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9088978	39057237	Rat
10755459	Coatc15	Coat color QTL 15		0.01681	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	14	19836944	64836944	Rat
1300154	Bp189	Blood pressure QTL 189	3.04		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	14	30883777	68757901	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30320092	80829842	Rat
2324617	Coatc2	Coat color QTL 2		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	14	30767025	39153750	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8267090	53267090	Rat
71117	Niddm17	Non-insulin dependent diabetes mellitus QTL 17	2.35		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	17593761	42336881	Rat
61420	Pia6	Pristane induced arthritis QTL 6	4.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	14	18631345	42337007	Rat
7387267	Uae42	Urinary albumin excretion QTL 42		0.61	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	14	22167967	67167967	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
2313397	Coatc1	Coat color QTL1			coat/hair pigmentation trait (VT:0010463)	coat/hair color measurement (CMO:0001808)	14	18541332	63541332	Rat
631262	Tcas4	Tongue tumor susceptibility QTL 4	7.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	14	17622561	42337007	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41131407	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8267090	53267090	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
6	6	4	113	40	33	11	17	11	6	92	40	93	29	60	22


RefSeq Transcripts	NM_080586	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X57514	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000003240 ⟹ ENSRNOP00000003240

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	37,396,294 - 37,635,956 (+)	Ensembl
Rnor_6.0 Ensembl	14	39,964,588 - 40,049,354 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108194 ⟹ ENSRNOP00000086867

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	37,396,294 - 37,635,956 (+)	Ensembl

RefSeq Acc Id:

NM_080586 ⟹ NP_542153

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	37,750,292 - 37,821,651 (+)	NCBI
mRatBN7.2	14	37,396,294 - 37,467,654 (+)	NCBI
Rnor_6.0	14	39,964,588 - 40,049,354 (+)	NCBI
Rnor_5.0	14	39,777,443 - 39,860,718 (+)	NCBI
RGSC_v3.4	14	39,878,182 - 39,951,391 (+)	RGD
Celera	14	36,610,452 - 36,681,348 (+)	RGD

Sequence:

show sequence

CTATGCACATTCCTTGTACTCACTGTGCTGCTGCTGAGGTGTGAGGCAAACTCCGCTTGGGGACTGAGCTAGTGGAGAAAGGATCTTAAAAGCGACCTGATGGGTTCTGGGAAAGTCTTCCTTTTCTC
TCCTTCCCTCCTGTGGAGTCAAACTAGAGGAGTGAGGTTGATATTCTTGTTACTAACCCTGCATCTGGGAAACTGCATTGATAAAGCAGATGATGAAGATGATGAAGATTTAACTATGAACAAAACAT
GGGTCTTGGCACCTAAAATTCATGAAGGAGATATCACACAGATTCTCAACTCTTTACTTCAAGGCTATGATAACAAACTTCGTCCAGATATAGGCGTGAGACCCACAGTAATTGAAACTGATGTTTAT
GTAAACAGCATTGGACCTGTTGATCCCATAAACATGGAGTACACGATAGACATCATTTTTGCCCAGACTTGGTTCGATAGCCGTTTAAAGTTCAACAGCACCATGAAAGTCCTTATGCTTAACAGCAA
CATGGTGGGAAAAATTTGGATCCCTGACACGTTCTTCAGGAACTCAAGGAAATCTGATGCGCACTGGATAACAACGCCCAATCGCCTGCTGCGGATATGGAGTGATGGAAGGGTTCTCTACACTCTGA
GATTAACAATTAATGCAGAATGCTACCTTCAACTCCATAACTTTCCTATGGATGAACATTCCTGTCCACTGGAATTTTCAAGCTATGGATACCCTAAAAATGAAATTGAGTACAAGTGGAAAAAGCCC
TCAGTGGAAGTGGCTGATCCTAAGTACTGGAGATTGTATCAGTTTGCCTTTGTAGGGTTAAGAAATTCAACCGAAATCTCTCACACAATCTCCGGAGATTATATTATCATGACTATCTTTTTTGACCT
GAGCAGACGGATGGGCTATTTCACAATTCAGACCTACATTCCGTGCATTCTAACAGTTGTTCTTTCCTGGGTGTCTTTTTGGATCAACAAAGATGCTGTACCTGCTAGAACATCCCTGGGTATCACTA
CGGTTTTGACTATGACAACCCTCAGTACAATCGCTAGAAAATCTTTACCTAAGGTTTCTTACGTGACAGCAATGGATCTCTTTGTCTCTGTGTGTTTCATTTTTGTGTTTGCAGCACTCATGGAGTAT
GGAACCTTGCATTATTTTACTAGTAACAATAAAGGAAAAACCACCAGAGACAGGAAGCTGAAAAGCAAAACTTCGGTATCCCCAGGTCTCCATGCTGGATCTACTCTGATTCCCATGAACAACATTTC
TATGCCTCAAGGGGAAGATGATTATGGTTACCAGTGCTTGGAGGGCAAAGACTGTGCTACCTTTTTCTGTTGCTTTGAAGACTGCAGAACTGGGTCCTGGAGAGAAGGGCGAATACACATACGCATTG
CCAAAATCGACTCCTACTCCAGGATCTTTTTCCCAACAGCTTTTGCCTTGTTCAATCTGGTTTACTGGGTTGGATATCTATACTTATAAGTTCTGCCAATAGATAAAAAAATTCATAAAAATCTGGCT
TAGTCCAATATAATCACTTCGATTTCATAACAGGAAGTTAGAATTTAAAATGAAAGTCTACCAGTTAAAATCTGAATCATTTGGTCATATGATTAAGGCTTTCATAAATAAATAAGAAAGAATTATTC
AGGTTAATTTACCTAACTAAACATGAAATTCATGTCCAATATAGCACATTTAAANCAGTAAACTTAATAATTTTT

hide sequence


Protein RefSeqs	NP_542153	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA40739	(Get FASTA)	NCBI Sequence Viewer
	EDL90009	(Get FASTA)	NCBI Sequence Viewer
	EDL90010	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000003240.4
	ENSRNOP00000098270
GenBank Protein	P23574	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_542153 ⟸ NM_080586
- Peptide Label:	precursor
- UniProtKB:	P23574 (UniProtKB/Swiss-Prot), A6JD87 (UniProtKB/TrEMBL), A0A8I6A4K4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGSGKVFLFSPSLLWSQTRGVRLIFLLLTLHLGNCIDKADDEDDEDLTMNKTWVLAPKIHEGDITQILNSLLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSRLKFNS TMKVLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWSDGRVLYTLRLTINAECYLQLHNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGLRNSTEISHTISGD YIIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSNNKGKTTRDRKLKSKTSVSPGLHAG STLIPMNNISMPQGEDDYGYQCLEGKDCATFFCCFEDCRTGSWREGRIHIRIAKIDSYSRIFFPTAFALFNLVYWVGYLYL hide sequence

Ensembl Acc Id:

ENSRNOP00000003240 ⟸ ENSRNOT00000003240

Ensembl Acc Id:

ENSRNOP00000086867 ⟸ ENSRNOT00000108194

Protein Domains

Neurotransmitter-gated ion-channel ligand-binding Neurotransmitter-gated ion-channel transmembrane

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P23574-F1-model_v2	AlphaFold	P23574	1-465	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-15831	BioCyc
Ensembl Genes	ENSRNOG00000002360	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000003240.7	UniProtKB/Swiss-Prot
	ENSRNOT00000120635	ENTREZGENE
Gene3D-CATH	1.20.58.390	UniProtKB/Swiss-Prot
	2.70.170.10	UniProtKB/Swiss-Prot
InterPro	GABAA/Glycine_rcpt	UniProtKB/Swiss-Prot
	GABBAg1_rcpt	UniProtKB/Swiss-Prot
	GABBAg_rcpt	UniProtKB/Swiss-Prot
	Neur_chan_lig-bd	UniProtKB/Swiss-Prot
	Neur_chan_lig-bd_sf	UniProtKB/Swiss-Prot
	Neur_channel	UniProtKB/Swiss-Prot
	Neuro-gated_channel_TM_sf	UniProtKB/Swiss-Prot
	Neuro_actylchol_rec	UniProtKB/Swiss-Prot
	Neurotrans-gated_channel_TM	UniProtKB/Swiss-Prot
	Neurotransmitter_ion_chnl_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:140674	UniProtKB/Swiss-Prot
NCBI Gene	140674	ENTREZGENE
PANTHER	PTHR18945	UniProtKB/Swiss-Prot
Pfam	Neur_chan_LBD	UniProtKB/Swiss-Prot
	Neur_chan_memb	UniProtKB/Swiss-Prot
PhenoGen	Gabrg1	PhenoGen
PRINTS	GABAARECEPTR	UniProtKB/Swiss-Prot
	GABAARGAMMA	UniProtKB/Swiss-Prot
	GABAARGAMMA1	UniProtKB/Swiss-Prot
	NRIONCHANNEL	UniProtKB/Swiss-Prot
PROSITE	NEUROTR_ION_CHANNEL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002360	RatGTEx
Superfamily-SCOP	SSF63712	UniProtKB/Swiss-Prot
	SSF90112	UniProtKB/Swiss-Prot
UniProt	A0A8I6A4K4	ENTREZGENE, UniProtKB/TrEMBL
	A6JD87	ENTREZGENE, UniProtKB/TrEMBL
	A6JD88_RAT	UniProtKB/TrEMBL
	GBRG1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-12-06	Gabrg1	gamma-aminobutyric acid type A receptor subunit gamma 1	Gabrg1	gamma-aminobutyric acid type A receptor gamma 1 subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-11	Gabrg1	gamma-aminobutyric acid type A receptor gamma 1 subunit	Gabrg1	gamma-aminobutyric acid (GABA) A receptor, gamma 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-25	Gabrg1	gamma-aminobutyric acid (GABA) A receptor, gamma 1	Gabrg1	gamma-aminobutyric acid A receptor, gamma 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	Gabrg1	gamma-aminobutyric acid A receptor, gamma 1		gamma-aminobutyric acid (GABA) A receptor, gamma 1	Name updated	1299863	APPROVED
2004-12-14	Gabrg1	gamma-aminobutyric acid (GABA) A receptor, gamma 1			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Gabrg1	gamma-aminobutyric acid (GABA) A receptor, gamma 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI