Bik (BCL2-interacting killer) - Rat Genome Database

Name: Bik
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Bik (BCL2-interacting killer) Rattus norvegicus

Analyze

Symbol:

Bik

Name:

BCL2-interacting killer

RGD ID:

621547

Description:

Enables BH domain binding activity. Predicted to be involved in several processes, including apoptotic mitochondrial changes; male gonad development; and positive regulation of cellular component organization. Predicted to act upstream of or within spermatogenesis. Predicted to be located in mitochondrial envelope. Predicted to be part of Bcl-2 family protein complex. Human ortholog(s) of this gene implicated in ataxia telangiectasia; breast cancer; colon cancer; and prostate cancer. Orthologous to human BIK (BCL2 interacting killer); PARTICIPATES IN intrinsic apoptotic pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1H-pyrazole; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

bcl-2-interacting killer; BCL2-interacting killer (apoptosis-inducing); Bcl2-interacting killer-like; Biklk; Blk

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BIK (BCL2 interacting killer)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Bik (BCL2-interacting killer)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Bik (BCL2 interacting killer)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BIK (BCL2 interacting killer)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BIK (BCL2 interacting killer)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Bik (BCL2 interacting killer)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BIK (BCL2 interacting killer)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Bik (BCL2 interacting killer)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Bik (BCL2-interacting killer)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	BIK (BCL2 interacting killer)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	116,552,303 - 116,571,317 (+)	NCBI		GRCr8
mRatBN7.2	7	114,672,277 - 114,691,296 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	114,672,277 - 114,691,296 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	116,427,023 - 116,446,032 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	118,652,801 - 118,671,639 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	118,622,267 - 118,641,107 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	124,390,924 - 124,410,449 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	124,391,432 - 124,410,447 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	124,379,878 - 124,399,142 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	121,377,004 - 121,396,609 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	121,411,233 - 121,430,839 (-)	NCBI
Celera	7	110,985,150 - 111,004,412 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

ataxia telangiectasia (ISO)

breast cancer (ISO)

colon cancer (ISO)

Developmental Delay with Variable Intellectual Impairment and Behavioral Abnormalities (ISO)

intellectual disability (ISO)

Lymphatic Metastasis (ISO)

Phelan-McDermid syndrome (ISO)

prostate cancer (ISO)

renal cell carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(Z)-3-butylidenephthalide (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

17beta-estradiol (ISO)

1H-pyrazole (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (ISO)

3-methyl-3H-imidazo[4,5-f]quinolin-2-amine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-azacytidine (EXP)

6-propyl-2-thiouracil (EXP)

afimoxifene (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (EXP,ISO)

benzidine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bleomycin A2 (ISO)

bortezomib (ISO)

butan-1-ol (ISO)

butanal (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

chlorambucil (ISO)

chlorpyrifos (ISO)

cholesterol (EXP)

cisplatin (ISO)

clozapine (ISO)

cocaine (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclophosphamide (ISO)

cyclosporin A (ISO)

DDE (EXP)

decabromodiphenyl ether (EXP)

depsipeptide (ISO)

diarsenic trioxide (EXP,ISO)

diazinon (EXP)

dibutyl phthalate (ISO)

dieldrin (EXP)

dinophysistoxin 1 (ISO)

disodium selenite (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (EXP,ISO)

ethanol (EXP,ISO)

etoposide (ISO)

flavonoids (EXP)

fonofos (ISO)

furan (EXP,ISO)

furosemide (EXP)

hydrogen peroxide (ISO)

hydroxyurea (ISO)

iron(III) nitrilotriacetate (EXP)

isobutanol (ISO)

leflunomide (ISO)

Licochalcone B (ISO)

maneb (ISO)

menadione (ISO)

methotrexate (ISO)

mono(2-ethylhexyl) phthalate (ISO)

Muraglitazar (EXP)

N,N-diethyl-m-toluamide (EXP)

N-acetyl-L-cysteine (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (ISO)

nickel dichloride (EXP)

ochratoxin A (EXP)

olanzapine (ISO)

p-chloromercuribenzoic acid (ISO)

p-menthan-3-ol (ISO)

pamidronate (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

parathion (ISO)

pentanal (ISO)

permethrin (EXP)

phenobarbital (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

propanal (ISO)

propiconazole (ISO)

propylparaben (ISO)

pyrethrins (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

sanguinarine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tamoxifen (ISO)

terbufos (ISO)

tert-butyl hydroperoxide (ISO)

Tesaglitazar (EXP)

testosterone (ISO)

tetrachloromethane (EXP)

thiram (ISO)

titanium dioxide (ISO)

Tributyltin oxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

troglitazone (EXP,ISO)

urethane (EXP,ISO)

valproic acid (ISO)

Y-27632 (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic mitochondrial changes (IBA,ISO)

male gonad development (IBA,ISO)

positive regulation of protein-containing complex assembly (ISO)

positive regulation of release of cytochrome c from mitochondria (ISO)

regulation of apoptotic process (ISO)

spermatogenesis (ISO)

Cellular Component

Bcl-2 family protein complex (ISO)

mitochondrial envelope (ISO)

Molecular Function

BH domain binding (IPI)

protein binding (ISO)

protein-containing complex binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

intrinsic apoptotic pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Bok is a pro-apoptotic Bcl-2 protein with restricted expression in reproductive tissues and heterodimerizes with selective anti-apoptotic Bcl-2 family members.	Hsu SY, etal., Proc Natl Acad Sci U S A 1997 Nov 11;94(23):12401-6.
3.	BAK, BAX, and NBK/BIK proapoptotic gene alterations in Iranian patients with ataxia telangiectasia.	Isaian A, etal., J Clin Immunol. 2010 Jan;30(1):132-7. doi: 10.1007/s10875-009-9340-6. Epub 2009 Nov 7.
4.	Bcl-2-related protein family gene expression during oligodendroglial differentiation.	Itoh T, etal., J Neurochem 2003 Jun;85(6):1500-12.
5.	Mutant Bik gene transferred by cationic liposome inhibits peritoneal disseminated murine colon cancer.	Lan KL, etal., Clin Exp Metastasis. 2007;24(6):461-70. doi: 10.1007/s10585-007-9083-9. Epub 2007 Jul 18.
6.	Characterization of the antiapoptotic Bcl-2 family member myeloid cell leukemia-1 (Mcl-1) and the stimulation of its message by gonadotropins in the rat ovary.	Leo CP, etal., Endocrinology 1999 Dec;140(12):5469-77.
7.	Enhancement of Bik antitumor effect by Bik mutants.	Li YM, etal., Cancer Res. 2003 Nov 15;63(22):7630-3.
8.	BH3-only proteins in apoptosis and beyond: an overview.	Lomonosova E and Chinnadurai G, Oncogene. 2008 Dec;27 Suppl 1:S2-19.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Loss of the tissue-specific proapoptotic BH3-only protein Nbk/Bik is a unifying feature of renal cell carcinoma.	Sturm I, etal., Cell Death Differ. 2006 Apr;13(4):619-27. doi: 10.1038/sj.cdd.4401782.
13.	Amplification of D22S283 as a favorable prognostic indicator in liver fluke related cholangiocarcinoma.	Thanasai J, etal., World J Gastroenterol. 2006 Jul 21;12(27):4338-44.

Additional References at PubMed

PMID:9525867	PMID:16270031	PMID:21041309	PMID:27262843	PMID:34517787

Genomics

Comparative Map Data

Bik
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	116,552,303 - 116,571,317 (+)	NCBI		GRCr8
mRatBN7.2	7	114,672,277 - 114,691,296 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	114,672,277 - 114,691,296 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	116,427,023 - 116,446,032 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	118,652,801 - 118,671,639 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	118,622,267 - 118,641,107 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	124,390,924 - 124,410,449 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	124,391,432 - 124,410,447 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	124,379,878 - 124,399,142 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	121,377,004 - 121,396,609 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	121,411,233 - 121,430,839 (-)	NCBI
Celera	7	110,985,150 - 111,004,412 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

BIK
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	43,110,750 - 43,129,712 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	43,110,750 - 43,129,712 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	43,506,756 - 43,525,718 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	41,836,701 - 41,855,662 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	41,831,254 - 41,850,215	NCBI
Celera	22	27,417,143 - 27,436,106 (+)	NCBI		Celera
Cytogenetic Map	22	q13.2	NCBI
HuRef	22	26,465,060 - 26,484,115 (+)	NCBI		HuRef
CHM1_1	22	43,466,350 - 43,485,313 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	43,591,916 - 43,610,878 (+)	NCBI		T2T-CHM13v2.0

Bik
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	83,410,992 - 83,428,836 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	83,411,063 - 83,428,835 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	83,526,790 - 83,544,635 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	83,526,862 - 83,544,634 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	83,357,292 - 83,375,065 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	84,321,217 - 84,338,990 (+)	NCBI		MGSCv36	mm8
MGSCv36	15	83,354,628 - 83,372,401 (+)	NCBI		MGSCv36	mm8
Cytogenetic Map	15	E1	NCBI
cM Map	15	39.4	NCBI

Bik
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955413	28,277,727 - 28,294,032 (+)	NCBI	ChiLan1.0	ChiLan1.0

BIK
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	52,933,764 - 52,952,919 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	55,626,663 - 55,646,548 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	23,994,256 - 24,014,244 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	42,194,353 - 42,213,022 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	42,207,149 - 42,213,022 (+)	Ensembl	panpan1.1		panPan2

BIK
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	22,417,374 - 22,433,055 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	22,354,097 - 22,370,473 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	23,161,992 - 23,178,391 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	10	22,881,118 - 22,897,517 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	23,200,499 - 23,217,096 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	23,376,192 - 23,391,652 (-)	NCBI		UU_Cfam_GSD_1.0

Bik
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	6,050,452 - 6,065,650 (-)	NCBI		HiC_Itri_2

BIK
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	25,632,837 - 25,658,951 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	25,652,945 - 25,658,541 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	99,781,400 - 99,808,922 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bik
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624752	5,839,422 - 5,856,350 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Bik
142 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	46
Count of miRNA genes:	43
Interacting mature miRNAs:	46
Transcripts:	ENSRNOT00000013977
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	111182207	135012528	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	94811326	116294265	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
1357339	Stl14	Serum triglyceride level QTL 14	3.45	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	112729683	133492707	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
631663	Bw6	Body weight QTL 6	3.4		body mass (VT:0001259)	body weight (CMO:0000012)	7	111075573	134976056	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	112308254	133492884	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		18	6		6						8
Low	3	22	27	17	13	17	3	4	55	35	33	11	3
Below cutoff		3	22	22		22	5	7	17				5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053704	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006242048	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594568	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF372501	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225338	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013977 ⟹ ENSRNOP00000013977

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	114,672,277 - 114,691,296 (+)	Ensembl
Rnor_6.0 Ensembl	7	124,391,432 - 124,410,447 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113031 ⟹ ENSRNOP00000085980

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	114,672,671 - 114,691,296 (+)	Ensembl

RefSeq Acc Id:

NM_053704 ⟹ NP_446156

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	116,552,303 - 116,571,317 (+)	NCBI
mRatBN7.2	7	114,672,277 - 114,691,296 (+)	NCBI
Rnor_6.0	7	124,391,432 - 124,410,447 (+)	NCBI
Rnor_5.0	7	124,379,878 - 124,399,142 (+)	NCBI
RGSC_v3.4	7	121,377,004 - 121,396,609 (-)	RGD
Celera	7	110,985,150 - 111,004,412 (+)	RGD

Sequence:

show sequence

TAACCCGCCTCCAGCCAGCGCCCCCAACTCAGCCACCCGAGTCTGGGCCGAGAGGTGTTCGGGC
AGCTCGCCCGCCGCTACGCCAGCTTAGCCGGGCAGAAGACATGTCAGAGGCGAGACTAATGGCC
AGAGACATTATCAAGACTCTTCTACACGACCAGGTCCCCCAACCTGCAGTGGTCTCTGGGGCTC
CCAGCATGAAGGAGCCTGTGGGGGTTGAGGACGTCAGTCCTGTGAGAGACTTGGATTTCATGAG
GTGCCTGGAGAGCAGAAACCAGGTGGCCCTGAGGCTAGCCTGCATCGGCGATGAGATGGACCGG
TGTCTTCGGAGCCCCCGTCTGGTCCAGCTGCCTGGGATTGCTATGCACAGACTTGCTGCCACCT
ACAGCCAGACGGGTGTCAGAGGTATTTTCAGAAGCTTGATTGGAAGCCTCACCAACCTCAGGGA
AAATATCTGGTCCTGGAGAGTCTTCACTCCTGGCGCCTGGGTGTCACCTGACCAGGACCCTGGG
CAGCTGTTTCCCATGGTGCTGCTGGTCTTCTTGCTGCTGGGTGGGGCCTGGCATTTGCAGCTTC
AGTGAGGTGCAGCTGGGGCAGGGCTGGCCCCTGTCCCCCAACCCCTAGAGGTGCCGGCACCCTA
ACCGTGGTGTTTTCTGACTGTCCCTTTTTTTTTTTATATTTAACTCAGGATAGTGCTGAGATTT
CATACAGGTTTTCTGGGTTTTTGTAAGGTAAATGAATTCACTATACCTCAGGAGCGTTACTGGC
TAAATATCCCTGAGGCCTGGCTGGCCCTTCTCTCTTGACCCCTGCCACCTTCCTCTCTGCAGGC
TGGTCCTGTGGCCACCAGTGGGGGGAGTGCCGGCCACACCCCTGTCTGTGAAGCCTTGAGGCAC
GGAATCTACTGGACTAGATTCCTTTGGGGTGGAGAGTTCAATAAAGGGTTGTTTCCAGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_446156	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK53820	(Get FASTA)	NCBI Sequence Viewer
	EDM15624	(Get FASTA)	NCBI Sequence Viewer
	EDM15625	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013977.1
	ENSRNOP00000085980.1

RefSeq Acc Id:	NP_446156 ⟸ NM_053704
- UniProtKB:	Q925D2 (UniProtKB/TrEMBL), A6HT97 (UniProtKB/TrEMBL), A0A8I6GEH5 (UniProtKB/TrEMBL), A6HT98 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSEARLMARDIIKTLLHDQVPQPAVVSGAPSMKEPVGVEDVSPVRDLDFMRCLESRNQVALRLA CIGDEMDRCLRSPRLVQLPGIAMHRLAATYSQTGVRGIFRSLIGSLTNLRENIWSWRVFTPGAW VSPDQDPGQLFPMVLLVFLLLGGAWHLQLQ hide sequence

Ensembl Acc Id:

ENSRNOP00000013977 ⟸ ENSRNOT00000013977

Ensembl Acc Id:

ENSRNOP00000085980 ⟸ ENSRNOT00000113031

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q925D2-F1-model_v2	AlphaFold	Q925D2	1-158	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621547	AgrOrtholog
BioCyc Gene	G2FUF-32600	BioCyc
Ensembl Genes	ENSRNOG00000010359	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000013977.3	UniProtKB/TrEMBL
	ENSRNOT00000113031.1	UniProtKB/TrEMBL
InterPro	Bcl2-int_killer	UniProtKB/TrEMBL
KEGG Report	rno:114496	UniProtKB/TrEMBL
NCBI Gene	114496	ENTREZGENE
PANTHER	BCL-2-INTERACTING KILLER	UniProtKB/TrEMBL
	PTHR15018	UniProtKB/TrEMBL
Pfam	bcl-2I13	UniProtKB/TrEMBL
PhenoGen	Bik	PhenoGen
RatGTEx	ENSRNOG00000010359	RatGTEx
UniProt	A0A8I6GEH5	ENTREZGENE, UniProtKB/TrEMBL
	A6HT97	ENTREZGENE, UniProtKB/TrEMBL
	A6HT98	ENTREZGENE, UniProtKB/TrEMBL
	Q925D2	ENTREZGENE
UniProt Secondary	Q925D2	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-09	Bik	BCL2-interacting killer	Bik	BCL2-interacting killer (apoptosis-inducing)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Bik	BCL2-interacting killer (apoptosis-inducing)	Bik	Bcl2-interacting killer	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Bik	Bcl2-interacting killer	Biklk	Bcl2-interacting killer-like	Symbol and Name updated	1299863	APPROVED
2005-01-20	Biklk	Bcl2-interacting killer-like			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Biklk	Bcl2-interacting killer-like			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains a BH3 domain	631874

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations