Bcl2a1 (BCL2-related protein A1) - Rat Genome Database

Name: Bcl2a1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Bcl2a1 (BCL2-related protein A1) Rattus norvegicus

Analyze

Symbol:

Bcl2a1

Name:

BCL2-related protein A1

RGD ID:

620621

Description:

Enables BH domain binding activity. Involved in aging and cerebral cortex development. Predicted to be located in cytoplasm. Predicted to be active in mitochondrial outer membrane. Orthologous to human BCL2A1 (BCL2 related protein A1); PARTICIPATES IN intrinsic apoptotic pathway; INTERACTS WITH (+)-pilocarpine; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

B-cell leukemia/lymphoma 2 related protein A1; B-cell leukemia/lymphoma 2 related protein A1d; bcl-2-related protein A1; BCL2-related protein A1d; Bcl2a1d

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	89,716,914 - 89,724,998 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	89,716,914 - 89,724,998 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	95,382,133 - 95,390,252 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	93,581,342 - 93,589,461 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	91,445,125 - 91,453,238 (+)	NCBI	Rnor_WKY
Rnor_6.0	8	96,551,424 - 96,559,527 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	96,551,245 - 96,559,483 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	96,059,040 - 96,067,299 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	94,045,109 - 94,053,777 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	94,064,563 - 94,073,232 (+)	NCBI
Celera	8	89,278,398 - 89,286,468 (+)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

allergic disease (ISO)

Bloom syndrome (ISO)

Breast Neoplasms (ISO)

colorectal cancer (ISO)

COVID-19 (ISO)

Esophageal Neoplasms (ISO)

genetic disease (ISO)

rheumatoid arthritis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (EXP)

(-)-demecolcine (ISO)

(S)-naringenin (ISO)

(S)-nicotine (ISO)

1'-acetoxychavicol acetate (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,2-dimethylhydrazine (ISO)

1-nitropyrene (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2-hydroxypropanoic acid (ISO)

2-naphthylamine (ISO)

3,3',5-triiodo-L-thyronine (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

4-nitroquinoline N-oxide (ISO)

6alpha-methylprednisolone (ISO)

acetamide (EXP)

actinomycin D (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

azathioprine (ISO)

bathocuproine disulfonic acid (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bortezomib (ISO)

butanal (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon monoxide (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cholesterol (EXP)

choline (ISO)

chromium(6+) (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

CU-O LINKAGE (ISO)

curcumin (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dichloromethane (ISO)

diclofenac (ISO)

diethyl maleate (EXP)

diosgenin (ISO)

dioxygen (ISO)

doxorubicin (ISO)

endosulfan (EXP)

eriodictyol (ISO)

ethyl methanesulfonate (ISO)

ethylbenzene (ISO)

Evodiamine (ISO)

fenofibrate (ISO)

flavonoids (EXP)

folic acid (ISO)

furan (EXP)

Fusarenone X (ISO)

gentamycin (EXP)

glycochenodeoxycholic acid (EXP)

glyphosate (ISO)

guggulsterone (ISO)

imidazopyrazole (ISO)

indole-3-methanol (ISO)

indometacin (ISO)

ionomycin (ISO)

iron(2+) sulfate (anhydrous) (ISO)

isoflurane (EXP)

kaempferol (ISO)

kojic acid (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

lonafarnib (ISO)

LY294002 (ISO)

maneb (ISO)

melphalan (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylisothiazolinone (ISO)

methylseleninic acid (ISO)

Mitotane (EXP)

Muraglitazar (EXP)

N-(6-acetamidohexyl)acetamide (ISO)

naphthalenes (EXP)

nickel atom (ISO)

nickel dichloride (ISO)

nickel sulfate (ISO)

nicotine (ISO)

o-xylene (ISO)

ochratoxin A (EXP)

oxycodone (EXP)

paracetamol (ISO)

paraquat (ISO)

pentanal (ISO)

peptidoglycan (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

poly(I:C) (EXP)

prednisolone (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propanal (ISO)

protein kinase inhibitor (ISO)

pyridaben (ISO)

pyrrolidine dithiocarbamate (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

reactive oxygen species (ISO)

resveratrol (EXP,ISO)

romidepsin (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (EXP,ISO)

simazine (ISO)

sodium arsenite (ISO)

sodium aurothiomalate (ISO)

sodium dichromate (EXP)

streptozocin (EXP)

sulforaphane (ISO)

tamibarotene (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene (ISO)

topotecan (EXP)

Tributyltin oxide (ISO)

trichloroethene (EXP,ISO)

trichostatin A (ISO)

triphenyl phosphate (EXP)

troglitazone (EXP)

undecane (EXP)

vincristine (ISO)

vorinostat (ISO)

withaferin A (ISO)

zerumbone (ISO)

zinc atom (ISO)

zinc dichloride (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aging (IEP)

apoptotic process (IC)

cerebral cortex development (IEP)

extrinsic apoptotic signaling pathway in absence of ligand (IBA)

intrinsic apoptotic signaling pathway in response to DNA damage (IBA)

mitochondrial fusion (IBA)

negative regulation of apoptotic process (IEA)

positive regulation of apoptotic process (IBA)

release of cytochrome c from mitochondria (IBA)

transmembrane transport (IEA)

Cellular Component

cellular_component (ND)

cytoplasm (ISO)

mitochondrial outer membrane (IBA)

Molecular Function

BH domain binding (IPI)

channel activity (IBA)

protein binding (ISO)

protein heterodimerization activity (IBA)

protein homodimerization activity (IBA)

protein-containing complex binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

intrinsic apoptotic pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The Bcl-2 apoptotic switch in cancer development and therapy.	Adams JM and Cory S, Oncogene. 2007 Feb 26;26(9):1324-37.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	BOD (Bcl-2-related ovarian death gene) is an ovarian BH3 domain-containing proapoptotic Bcl-2 protein capable of dimerization with diverse antiapoptotic Bcl-2 members.	Hsu SY, etal., Mol Endocrinol 1998 Sep;12(9):1432-40.
5.	Bok is a pro-apoptotic Bcl-2 protein with restricted expression in reproductive tissues and heterodimerizes with selective anti-apoptotic Bcl-2 family members.	Hsu SY, etal., Proc Natl Acad Sci U S A 1997 Nov 11;94(23):12401-6.
6.	Bcl-2-related protein family gene expression during oligodendroglial differentiation.	Itoh T, etal., J Neurochem 2003 Jun;85(6):1500-12.
7.	Alteration of proteins regulating apoptosis, Bcl-2, Bcl-x, Bax, Bak, Bad, ICH-1 and CPP32, in Alzheimer's disease.	Kitamura Y, etal., Brain Res. 1998 Jan 12;780(2):260-9.
8.	Characterization of the antiapoptotic Bcl-2 family member myeloid cell leukemia-1 (Mcl-1) and the stimulation of its message by gonadotropins in the rat ovary.	Leo CP, etal., Endocrinology 1999 Dec;140(12):5469-77.
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	Differential expression of rat brain bcl-2 family proteins in development and aging.	Shimohama S, etal., Biochem Biophys Res Commun. 1998 Nov 9;252(1):92-6.
14.	Essential role of the prosurvival bcl-2 homologue A1 in mast cell survival after allergic activation.	Xiang Z, etal., J Exp Med 2001 Dec 3;194(11):1561-69.

Additional References at PubMed

PMID:23828564	PMID:30816537

Genomics

Comparative Map Data

Bcl2a1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	89,716,914 - 89,724,998 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	89,716,914 - 89,724,998 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	95,382,133 - 95,390,252 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	93,581,342 - 93,589,461 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	91,445,125 - 91,453,238 (+)	NCBI	Rnor_WKY
Rnor_6.0	8	96,551,424 - 96,559,527 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	96,551,245 - 96,559,483 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	96,059,040 - 96,067,299 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	94,045,109 - 94,053,777 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	94,064,563 - 94,073,232 (+)	NCBI
Celera	8	89,278,398 - 89,286,468 (+)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

BCL2A1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	79,960,892 - 79,971,196 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	15	79,960,892 - 79,971,196 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	80,253,234 - 80,263,538 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	78,040,290 - 78,050,698 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	78,040,289 - 78,050,698	NCBI
Celera	15	57,189,526 - 57,199,937 (-)	NCBI		Celera
Cytogenetic Map	15	q25.1	NCBI
HuRef	15	57,011,277 - 57,021,688 (-)	NCBI		HuRef
CHM1_1	15	80,370,121 - 80,380,532 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	77,823,803 - 77,834,097 (-)	NCBI		T2T-CHM13v2.0

Bcl2a1b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	89,081,326 - 89,089,891 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	89,081,262 - 89,089,880 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	89,199,273 - 89,207,838 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	89,199,209 - 89,207,827 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	89,094,111 - 89,102,676 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	88,997,122 - 89,005,719 (+)	NCBI		MGSCv36	mm8
Celera	9	87,568,132 - 87,573,632 (-)	NCBI		Celera
Cytogenetic Map	9	E3.1	NCBI

Bcl2a1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955533	773,912 - 785,037 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955533	773,912 - 785,040 (-)	NCBI	ChiLan1.0	ChiLan1.0

BCL2A1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	15	77,884,030 - 77,893,167 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	77,882,940 - 77,893,628 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	15	58,925,853 - 58,935,122 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

BCL2A1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	57,451,512 - 57,463,692 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	57,424,555 - 57,463,692 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	60,109,775 - 60,121,887 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	57,884,668 - 57,896,576 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	3	57,383,698 - 57,395,826 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	57,590,934 - 57,602,831 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	57,937,969 - 57,949,867 (+)	NCBI		UU_Cfam_GSD_1.0

Bcl2a1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	120,133,708 - 120,163,718 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	37,981,772 - 37,993,116 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936471	37,981,851 - 37,993,097 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BCL2A1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	48,887,094 - 48,897,870 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	48,887,227 - 48,897,667 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	54,395,262 - 54,419,816 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BCL2A1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	3,451,773 - 3,461,215 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	3,451,873 - 3,461,180 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	138,408,361 - 138,418,275 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bcl2a1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624941	907,119 - 933,356 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624941	907,382 - 932,751 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Bcl2a1
34 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	18
Count of miRNA genes:	18
Interacting mature miRNAs:	18
Transcripts:	ENSRNOT00000039850
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088624	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	82460758	122812818	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	89265192	114019816	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2		14	5	19	5				1	6	11
Low	1	33	43	36		36	8	11	68	34	35		8
Below cutoff		6							6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133416	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120938	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF378332	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000039850 ⟹ ENSRNOP00000038537

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	89,716,914 - 89,724,998 (+)	Ensembl
Rnor_6.0 Ensembl	8	96,551,245 - 96,559,483 (+)	Ensembl

RefSeq Acc Id:

NM_133416 ⟹ NP_596907

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	89,716,914 - 89,724,998 (+)	NCBI
Rnor_6.0	8	96,551,424 - 96,559,527 (+)	NCBI
Rnor_5.0	8	96,059,040 - 96,067,299 (+)	NCBI
RGSC_v3.4	8	94,045,109 - 94,053,777 (+)	RGD
Celera	8	89,278,398 - 89,286,468 (+)	RGD

Sequence:

show sequence

AGTCAGCTCTGCCTGGGAAGATGACAGACTGTGAGTTCATGTATATCCACTCCCTGGCTGAGAA
CTATCTTCAGTATGTCCTGCAGGTACCTGCCTTTGAATCGGCTCCAAGCAAAACGTCCAGAGTG
CTACAGAGAGTTGCTTTCTCTGTACAAAAGGAAGTTGAAAAGAATCTGAAGCCATACTTGGATG
ACTTTCACGTGGAATCCATAGATACTGCCAGAATAATATTCAACCAAGTGATGGAAAAAGAATT
TGAAGATGGCATCATTAACTGGGGAAGGATTGTGACTATATTTGCCTTTGGGGGTGTTCTCCTG
AAAAAGCTTCCACAAGAGCAGATTGGCCTGGATGTGGATACTTACAAGCAAGTTTCCAGTTTTG
TGGCGGAATTCATAATGAATAACACAGGAGAATGGATACAGCAGAATGGAGGCTGGGAAGATGG
CTTCACAAAGAAGTTTGAACCTAAATCTGGCTGGCTGACTTTTCTGCAGATGACAGGGAAGATC
TGGGAAATGCTCTTTCTCCTCAAGCAACACTACTGACCAGAGAGAACCCTGGCTCCCTTGAGAA
TGGTGATCAGCACTTGGTGTTTCCATTTACAAACAGATAACATGGACAATGAAACTTGACTTTC
CAGAGTTGCAGATATTTTGTTTCTACTTTAATGAATAAACTACTAATATTTGTTTCTGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_596907	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK55419	(Get FASTA)	NCBI Sequence Viewer
	EDL77577	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_596907 ⟸ NM_133416
- UniProtKB:	Q925A9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDFHVESI DTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIGLDVDTYKQVSSFVAEFIMN NTGEWIQQNGGWEDGFTKKFEPKSGWLTFLQMTGKIWEMLFLLKQHY hide sequence

RefSeq Acc Id:

ENSRNOP00000038537 ⟸ ENSRNOT00000039850

Protein Domains

Bcl-2 Bcl-2 homology region 1-3

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V977-F1-model_v2	AlphaFold	G3V977	1-175	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620621	AgrOrtholog
BioCyc Gene	G2FUF-29592	BioCyc
Ensembl Genes	ENSRNOG00000047606	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000038537	ENTREZGENE
	ENSRNOP00000038537.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000039850	ENTREZGENE
	ENSRNOT00000039850.4	UniProtKB/TrEMBL
Gene3D-CATH	1.10.437.10	UniProtKB/TrEMBL
InterPro	Apop_reg_Bcl2Rel	UniProtKB/TrEMBL
	Bcl-2_BH1-3	UniProtKB/TrEMBL
	Bcl2-like_apoptosis	UniProtKB/TrEMBL
	Bcl2_BH1_motif_CS	UniProtKB/TrEMBL
	Bcl2_BH2_motif_CS	UniProtKB/TrEMBL
	Blc2-like_sf	UniProtKB/TrEMBL
	Blc2_fam	UniProtKB/TrEMBL
KEGG Report	rno:170929	UniProtKB/TrEMBL
NCBI Gene	170929	ENTREZGENE
PANTHER	PTHR11256	UniProtKB/TrEMBL
	PTHR11256:SF10	UniProtKB/TrEMBL
Pfam	Bcl-2	UniProtKB/TrEMBL
PhenoGen	Bcl2a1	PhenoGen
PRINTS	BCL2FAMILY	UniProtKB/TrEMBL
	BCL2RLATEDA1	UniProtKB/TrEMBL
PROSITE	BCL2_FAMILY	UniProtKB/TrEMBL
	BH1	UniProtKB/TrEMBL
	BH2	UniProtKB/TrEMBL
SMART	BCL	UniProtKB/TrEMBL
Superfamily-SCOP	SSF56854	UniProtKB/TrEMBL
UniProt	G3V977_RAT	UniProtKB/TrEMBL
	Q925A9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-01-30	Bcl2a1d	BCL2-related protein A1D	Bcl2a1	BCL2-related protein A1	Name and Symbol changed	629549	APPROVED
2015-01-30	Bcl2a1	BCL2-related protein A1	Bcl2a1d	BCL2-related protein A1d	Name and Symbol changed	629549	APPROVED
2015-01-30	Bcl2a1d	BCL2-related protein A1d	Bcl2a1d	BCL2-related protein A1D	Name changed	629549	APPROVED
2012-07-13	Bcl2a1	BCL2-related protein A1	Bcl2a1d	BCL2-related protein A1d	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-01-06	Bcl2a1d	BCL2-related protein A1d	Bcl2a1d	B-cell leukemia/lymphoma 2 related protein A1d	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-05-15	Bcl2a1d	B-cell leukemia/lymphoma 2 related protein A1d	Bcl2a1	B-cell leukemia/lymphoma 2 related protein A1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Bcl2a1	B-cell leukemia/lymphoma 2 related protein A1		BCL2-related protein A1	Name updated	1299863	APPROVED
2002-08-07	Bcl2a1	BCL2-related protein A1			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	not express in oligodendroglial lineage cells (OLC)	631874

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations