Symbol:
Homer2
Name:
homer scaffold protein 2
RGD ID:
620705
Description:
Enables G protein-coupled glutamate receptor binding activity; identical protein binding activity; and protein domain specific binding activity. Predicted to be involved in several processes, including G protein-coupled glutamate receptor signaling pathway; negative regulation of calcineurin-NFAT signaling cascade; and negative regulation of interleukin-2 production. Predicted to act upstream of or within behavioral response to cocaine; calcium-mediated signaling; and regulation of G protein-coupled receptor signaling pathway. Located in dendrite; neuronal cell body; and plasma membrane. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 68. Orthologous to human HOMER2 (homer scaffold protein 2); PARTICIPATES IN glutamate signaling pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 2,3,7,8-tetrachlorodibenzodioxine; aflatoxin B1.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
cupidin; homer homolog 2; homer homolog 2 (Drosophila); homer protein homolog 2; homer scaffolding protein 2; homer, neuronal immediate early gene, 2; homer-2; VASP/Ena-related gene up-regulated during seizure and LTP 2; Vesl-2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 144,968,207 - 145,069,022 (-) NCBI GRCr8 mRatBN7.2 1 135,558,977 - 135,659,780 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 135,567,414 - 135,659,772 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 143,488,882 - 143,581,178 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 150,658,320 - 150,750,396 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 143,564,822 - 143,658,186 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 143,443,300 - 143,535,579 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 143,443,300 - 143,535,583 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 144,387,025 - 144,478,034 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 137,827,128 - 137,933,089 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 137,905,533 - 138,012,215 (-) NCBI Celera 1 127,618,673 - 127,711,006 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Homer2 Rat (1->4)-beta-D-glucan multiple interactions ISO Homer2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of HOMER2 mRNA CTD PMID:36331819 Homer2 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of HOMER2 protein CTD PMID:17337753 Homer2 Rat 1,2-dichloroethane decreases expression ISO Homer2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of HOMER2 mRNA CTD PMID:28189721 and PMID:28960355 Homer2 Rat 1,2-dimethylhydrazine affects expression ISO Homer2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of HOMER2 mRNA CTD PMID:22206623 Homer2 Rat 17alpha-ethynylestradiol increases expression ISO Homer2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of HOMER2 mRNA CTD PMID:17942748 Homer2 Rat 17alpha-ethynylestradiol multiple interactions ISO Homer2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HOMER2 mRNA CTD PMID:17942748 Homer2 Rat 17beta-estradiol multiple interactions ISO HOMER2 (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of HOMER2 mRNA CTD PMID:20404318 Homer2 Rat 17beta-estradiol decreases expression ISO Homer2 (Mus musculus) 6480464 Estradiol results in decreased expression of HOMER2 mRNA CTD PMID:39298647 Homer2 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO HOMER2 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of HOMER2 mRNA CTD PMID:29581250 Homer2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HOMER2 mRNA CTD PMID:32109520 Homer2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Homer2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HOMER2 mRNA CTD PMID:26377647 and PMID:28922406 Homer2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of HOMER2 mRNA CTD PMID:22298810 Homer2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Homer2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of HOMER2 mRNA CTD PMID:16960034 Homer2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HOMER2 mRNA CTD PMID:16960034 Homer2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Homer2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HOMER2 mRNA CTD PMID:17942748 Homer2 Rat 2-hydroxypropanoic acid decreases expression ISO HOMER2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of HOMER2 mRNA CTD PMID:30851411 Homer2 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Homer2 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Homer2 Rat 4,4'-sulfonyldiphenol affects expression ISO Homer2 (Mus musculus) 6480464 bisphenol S affects the expression of HOMER2 mRNA CTD PMID:39298647 Homer2 Rat 4,4'-sulfonyldiphenol affects methylation ISO Homer2 (Mus musculus) 6480464 bisphenol S affects the methylation of HOMER2 gene CTD PMID:31683443 Homer2 Rat aflatoxin B1 affects expression ISO HOMER2 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of HOMER2 protein CTD PMID:20106945 Homer2 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of HOMER2 mRNA CTD PMID:33354967 Homer2 Rat aflatoxin B1 affects methylation ISO HOMER2 (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of HOMER2 intron CTD PMID:30157460 Homer2 Rat aflatoxin B1 increases methylation ISO HOMER2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of HOMER2 gene CTD PMID:31555880 Homer2 Rat aflatoxin B1 decreases expression ISO HOMER2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of HOMER2 mRNA CTD PMID:22100608 and PMID:31555880 Homer2 Rat aflatoxin B1 decreases expression ISO Homer2 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of HOMER2 mRNA CTD PMID:19770486 Homer2 Rat Aflatoxin B2 alpha decreases methylation ISO HOMER2 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of HOMER2 intron CTD PMID:30157460 Homer2 Rat alachlor increases expression EXP 6480464 alachlor results in increased expression of HOMER2 mRNA CTD PMID:12419858 Homer2 Rat arsane multiple interactions ISO HOMER2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HOMER2 mRNA CTD PMID:39836092 Homer2 Rat arsenic atom multiple interactions ISO HOMER2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HOMER2 mRNA CTD PMID:39836092 Homer2 Rat arsenite(3-) increases methylation ISO HOMER2 (Homo sapiens) 6480464 arsenite results in increased methylation of HOMER2 promoter CTD PMID:23974009 Homer2 Rat arsenous acid decreases expression ISO HOMER2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of HOMER2 mRNA CTD PMID:29633893 Homer2 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of HOMER2 gene CTD PMID:35440735 Homer2 Rat belinostat decreases expression ISO HOMER2 (Homo sapiens) 6480464 belinostat results in decreased expression of HOMER2 mRNA CTD PMID:26272509 Homer2 Rat benzo[a]pyrene decreases expression ISO Homer2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of HOMER2 mRNA CTD PMID:21715664 Homer2 Rat benzo[a]pyrene affects methylation ISO HOMER2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HOMER2 intron CTD PMID:30157460 Homer2 Rat benzo[a]pyrene increases methylation ISO HOMER2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of HOMER2 gene CTD PMID:31555880 Homer2 Rat benzo[a]pyrene decreases expression ISO HOMER2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of HOMER2 mRNA CTD PMID:20106945 more ... Homer2 Rat bis(2-ethylhexyl) phthalate increases expression ISO HOMER2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of HOMER2 mRNA CTD PMID:28412506 Homer2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO HOMER2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of HOMER2 mRNA CTD PMID:31163220 Homer2 Rat bisphenol A decreases expression ISO Homer2 (Mus musculus) 6480464 bisphenol A results in decreased expression of HOMER2 mRNA CTD PMID:26063408 and PMID:32156529 Homer2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of HOMER2 gene CTD PMID:28505145 Homer2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HOMER2 mRNA CTD PMID:25181051 Homer2 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of HOMER2 mRNA CTD PMID:12628495 Homer2 Rat butanal increases expression ISO HOMER2 (Homo sapiens) 6480464 butyraldehyde results in increased expression of HOMER2 mRNA CTD PMID:26079696 Homer2 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of HOMER2 mRNA CTD PMID:33453195 Homer2 Rat calcitriol increases expression ISO HOMER2 (Homo sapiens) 6480464 Calcitriol results in increased expression of HOMER2 mRNA CTD PMID:26485663 Homer2 Rat cantharidin decreases expression ISO Homer2 (Mus musculus) 6480464 Cantharidin results in decreased expression of HOMER2 mRNA CTD PMID:36907384 Homer2 Rat CGP 52608 multiple interactions ISO HOMER2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to HOMER2 gene] CTD PMID:28238834 Homer2 Rat chlordecone increases expression ISO Homer2 (Mus musculus) 6480464 Chlordecone results in increased expression of HOMER2 mRNA CTD PMID:33711761 Homer2 Rat cisplatin decreases expression ISO HOMER2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of HOMER2 mRNA CTD PMID:27392435 Homer2 Rat cocaine multiple interactions ISO Homer2 (Mus musculus) 6480464 Cocaine affects the reaction [HOMER2 mutant form results in decreased secretion of Excitatory Amino Acid Agents] and FOS protein mutant form inhibits the reaction [Cocaine results in decreased expression of HOMER2 mRNA] CTD PMID:15545022 and PMID:18355967 Homer2 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of HOMER2 mRNA CTD PMID:20187946 Homer2 Rat cocaine decreases response to substance ISO Homer2 (Mus musculus) 6480464 HOMER2 protein results in decreased susceptibility to Cocaine and HOMER2 results in decreased susceptibility to Cocaine CTD PMID:14684444 more ... Homer2 Rat cocaine decreases expression ISO Homer2 (Mus musculus) 6480464 Cocaine results in decreased expression of HOMER2 mRNA CTD PMID:18355967 Homer2 Rat copper(II) sulfate increases expression ISO HOMER2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of HOMER2 mRNA CTD PMID:19549813 Homer2 Rat cyclosporin A decreases expression ISO HOMER2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of HOMER2 mRNA CTD PMID:20106945 Homer2 Rat cyclosporin A increases expression ISO HOMER2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of HOMER2 mRNA CTD PMID:25562108 and PMID:27989131 Homer2 Rat deguelin decreases expression ISO HOMER2 (Homo sapiens) 6480464 deguelin results in decreased expression of HOMER2 mRNA CTD PMID:33512557 Homer2 Rat diarsenic trioxide decreases expression ISO HOMER2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of HOMER2 mRNA CTD PMID:29633893 Homer2 Rat dibenz[a,h]anthracene increases expression ISO Homer2 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Homer2 Rat Dibutyl phosphate affects expression ISO HOMER2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of HOMER2 mRNA CTD PMID:37042841 Homer2 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of HOMER2 mRNA CTD PMID:36653537 Homer2 Rat doxorubicin decreases expression ISO HOMER2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of HOMER2 mRNA CTD PMID:29803840 Homer2 Rat epoxiconazole decreases expression ISO Homer2 (Mus musculus) 6480464 epoxiconazole results in decreased expression of HOMER2 mRNA CTD PMID:35436446 Homer2 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of HOMER2 mRNA CTD PMID:20655511 Homer2 Rat ethanol increases expression ISO Homer2 (Mus musculus) 6480464 Ethanol results in increased expression of HOMER2 mRNA CTD PMID:30319688 Homer2 Rat genistein decreases expression ISO HOMER2 (Homo sapiens) 6480464 Genistein results in decreased expression of HOMER2 mRNA CTD PMID:15378649 Homer2 Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of HOMER2 gene CTD PMID:31011160 Homer2 Rat GW 4064 increases expression ISO Homer2 (Mus musculus) 6480464 GW 4064 results in increased expression of HOMER2 mRNA CTD PMID:26655953 Homer2 Rat Licochalcone B increases expression ISO HOMER2 (Homo sapiens) 6480464 licochalcone B results in increased expression of HOMER2 mRNA CTD PMID:33647349 Homer2 Rat maneb multiple interactions ISO Homer2 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of HOMER2 mRNA CTD PMID:36117858 Homer2 Rat manganese atom multiple interactions ISO HOMER2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HOMER2 mRNA CTD PMID:39836092 Homer2 Rat manganese(0) multiple interactions ISO HOMER2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HOMER2 mRNA CTD PMID:39836092 Homer2 Rat manganese(II) chloride multiple interactions ISO HOMER2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HOMER2 mRNA CTD PMID:39836092 Homer2 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of HOMER2 gene CTD PMID:33148267 Homer2 Rat ozone multiple interactions ISO Homer2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of HOMER2 mRNA more ... CTD PMID:25658374 more ... Homer2 Rat ozone increases expression ISO Homer2 (Mus musculus) 6480464 Ozone results in increased expression of HOMER2 mRNA CTD PMID:25658374 Homer2 Rat paracetamol affects expression ISO Homer2 (Mus musculus) 6480464 Acetaminophen affects the expression of HOMER2 mRNA CTD PMID:17562736 Homer2 Rat paraquat decreases expression ISO Homer2 (Mus musculus) 6480464 Paraquat results in decreased expression of HOMER2 mRNA CTD PMID:21371552 Homer2 Rat paraquat multiple interactions ISO Homer2 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of HOMER2 mRNA CTD PMID:36117858 Homer2 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of HOMER2 mRNA CTD PMID:32680482 Homer2 Rat parathion increases expression ISO Homer2 (Mus musculus) 6480464 Parathion results in increased expression of HOMER2 mRNA CTD PMID:34813904 Homer2 Rat pentanal increases expression ISO HOMER2 (Homo sapiens) 6480464 pentanal results in increased expression of HOMER2 mRNA CTD PMID:26079696 Homer2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Homer2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of HOMER2 mRNA CTD PMID:36331819 Homer2 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of HOMER2 gene CTD PMID:33148267 Homer2 Rat phenylmercury acetate decreases expression ISO HOMER2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of HOMER2 mRNA CTD PMID:26272509 Homer2 Rat phosgene affects expression ISO Homer2 (Mus musculus) 6480464 Phosgene affects the expression of HOMER2 mRNA CTD PMID:16300373 Homer2 Rat picoxystrobin decreases expression ISO HOMER2 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of HOMER2 mRNA CTD PMID:33512557 Homer2 Rat pirinixic acid multiple interactions ISO HOMER2 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of HOMER2 mRNA CTD PMID:19710929 Homer2 Rat pirinixic acid decreases expression ISO Homer2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of HOMER2 mRNA CTD PMID:20813756 and PMID:23811191 Homer2 Rat pirinixic acid increases expression ISO Homer2 (Mus musculus) 6480464 pirinixic acid results in increased expression of HOMER2 mRNA CTD PMID:17426115 Homer2 Rat pirinixic acid multiple interactions ISO Homer2 (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in decreased expression of HOMER2 mRNA CTD PMID:20813756 Homer2 Rat progesterone decreases expression ISO Homer2 (Mus musculus) 6480464 Progesterone results in decreased expression of HOMER2 mRNA CTD PMID:22238285 Homer2 Rat rac-lactic acid decreases expression ISO HOMER2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of HOMER2 mRNA CTD PMID:30851411 Homer2 Rat raloxifene affects expression ISO HOMER2 (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of HOMER2 mRNA CTD PMID:14699072 Homer2 Rat resveratrol decreases expression ISO HOMER2 (Homo sapiens) 6480464 resveratrol results in decreased expression of HOMER2 mRNA CTD PMID:18586690 Homer2 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of HOMER2 mRNA CTD PMID:28374803 Homer2 Rat sodium arsenite increases expression ISO HOMER2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of HOMER2 mRNA CTD PMID:34032870 Homer2 Rat sodium arsenite increases expression ISO Homer2 (Mus musculus) 6480464 sodium arsenite results in increased expression of HOMER2 mRNA CTD PMID:37682722 Homer2 Rat sodium arsenite multiple interactions ISO HOMER2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HOMER2 mRNA CTD PMID:39836092 Homer2 Rat tamoxifen affects expression ISO HOMER2 (Homo sapiens) 6480464 Tamoxifen affects the expression of HOMER2 mRNA CTD PMID:14699072 Homer2 Rat tamoxifen decreases expression ISO HOMER2 (Homo sapiens) 6480464 Tamoxifen results in decreased expression of HOMER2 mRNA CTD PMID:15590111 Homer2 Rat tebuconazole decreases expression ISO HOMER2 (Homo sapiens) 6480464 tebuconazole results in decreased expression of HOMER2 mRNA CTD PMID:30458266 Homer2 Rat temozolomide decreases expression ISO HOMER2 (Homo sapiens) 6480464 Temozolomide results in decreased expression of HOMER2 mRNA CTD PMID:31758290 Homer2 Rat tetrachloromethane decreases expression ISO Homer2 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of HOMER2 mRNA CTD PMID:31919559 Homer2 Rat triclosan increases expression ISO HOMER2 (Homo sapiens) 6480464 Triclosan results in increased expression of HOMER2 mRNA CTD PMID:30510588 Homer2 Rat triphenyl phosphate affects expression ISO HOMER2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of HOMER2 mRNA CTD PMID:37042841 Homer2 Rat undecane decreases expression EXP 6480464 undecane results in decreased expression of HOMER2 protein CTD PMID:17337753 Homer2 Rat valproic acid affects expression ISO Homer2 (Mus musculus) 6480464 Valproic Acid affects the expression of HOMER2 mRNA CTD PMID:17963808 Homer2 Rat valproic acid decreases methylation ISO HOMER2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of HOMER2 gene CTD PMID:29154799 Homer2 Rat valproic acid increases expression ISO HOMER2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of HOMER2 mRNA CTD PMID:23179753 and PMID:29154799 Homer2 Rat valproic acid decreases expression ISO HOMER2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of HOMER2 mRNA CTD PMID:26272509 and PMID:28001369
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2,4-trimethylbenzene (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) alachlor (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP) belinostat (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) butanal (ISO) cadmium dichloride (EXP) calcitriol (ISO) cantharidin (ISO) CGP 52608 (ISO) chlordecone (ISO) cisplatin (ISO) cocaine (EXP,ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) deguelin (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) Dibutyl phosphate (ISO) diethylstilbestrol (EXP) doxorubicin (ISO) epoxiconazole (ISO) ethanol (EXP,ISO) genistein (ISO) glyphosate (EXP) GW 4064 (ISO) Licochalcone B (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) N,N-diethyl-m-toluamide (EXP) ozone (ISO) paracetamol (ISO) paraquat (EXP,ISO) parathion (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) phenylmercury acetate (ISO) phosgene (ISO) picoxystrobin (ISO) pirinixic acid (ISO) progesterone (ISO) rac-lactic acid (ISO) raloxifene (ISO) resveratrol (ISO) rotenone (EXP) sodium arsenite (ISO) tamoxifen (ISO) tebuconazole (ISO) temozolomide (ISO) tetrachloromethane (ISO) triclosan (ISO) triphenyl phosphate (ISO) undecane (EXP) valproic acid (ISO)
Biological Process
behavioral response to cocaine (IEA,ISO) calcium-mediated signaling (IEA,ISO) G protein-coupled glutamate receptor signaling pathway (IBA,IEA) negative regulation of calcineurin-NFAT signaling cascade (IEA,ISO,ISS) negative regulation of interleukin-2 production (IEA,ISO,ISS) regulation of G protein-coupled receptor signaling pathway (IEA,ISO) regulation of store-operated calcium entry (IBA) sensory perception of sound (IEA,ISO,ISS)
Cellular Component
apical part of cell (IEA,ISO) cell projection (IEA) cytoplasm (IBA,IEA,ISO) cytosol (IEA,ISO) dendrite (IBA,IDA) glutamatergic synapse (IEA,ISO) membrane (IEA) neuronal cell body (IDA) plasma membrane (IBA,IDA,IEA) postsynaptic density (IBA,IEA,ISO) stereocilium (IEA) stereocilium tip (IEA,ISO,ISS) synapse (IEA)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Combined genealogical, mapping, and expression approaches to identify spontaneously hypertensive rat hypertension candidate genes.
Hinojos CA, etal., Hypertension 2005 Apr;45(4):698-704. Epub 2005 Feb 14.
3.
A novel protein specifically interacting with Homer2 regulates ubiquitin-proteasome systems.
Ishibashi T, etal., J Biochem. 2005 May;137(5):617-23.
4.
A key role for diacylglycerol lipase-alpha in metabotropic glutamate receptor-dependent endocannabinoid mobilization.
Jung KM, etal., Mol Pharmacol. 2007 Sep;72(3):612-21. doi: 10.1124/mol.107.037796. Epub 2007 Jun 21.
5.
Novel members of the Vesl/Homer family of PDZ proteins that bind metabotropic glutamate receptors.
Kato A, etal., J Biol Chem 1998 Sep 11;273(37):23969-75.
6.
The scaffold protein Homer1b/c links metabotropic glutamate receptor 5 to extracellular signal-regulated protein kinase cascades in neurons.
Mao L, etal., J Neurosci. 2005 Mar 9;25(10):2741-52.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Homer2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 144,968,207 - 145,069,022 (-) NCBI GRCr8 mRatBN7.2 1 135,558,977 - 135,659,780 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 135,567,414 - 135,659,772 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 143,488,882 - 143,581,178 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 150,658,320 - 150,750,396 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 143,564,822 - 143,658,186 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 143,443,300 - 143,535,579 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 143,443,300 - 143,535,583 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 144,387,025 - 144,478,034 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 137,827,128 - 137,933,089 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 137,905,533 - 138,012,215 (-) NCBI Celera 1 127,618,673 - 127,711,006 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
HOMER2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 82,834,661 - 82,986,157 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 82,836,946 - 82,986,153 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 83,517,735 - 83,621,472 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 81,314,789 - 81,412,477 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 81,314,788 - 81,412,477 NCBI Celera 15 60,965,171 - 61,062,906 (+) NCBI Celera Cytogenetic Map 15 q25.2 NCBI HuRef 15 59,787,302 - 59,884,988 (-) NCBI HuRef CHM1_1 15 83,259,957 - 83,363,087 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 80,701,241 - 80,850,554 (-) NCBI T2T-CHM13v2.0
Homer2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 81,250,229 - 81,356,673 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 81,250,229 - 81,357,275 (-) Ensembl GRCm39 Ensembl GRCm38 7 81,600,481 - 81,706,925 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 81,600,481 - 81,707,527 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 88,745,367 - 88,851,811 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 81,483,228 - 81,580,639 (-) NCBI MGSCv36 mm8 Celera 7 79,009,788 - 79,104,812 (-) NCBI Celera Cytogenetic Map 7 D3 NCBI cM Map 7 45.71 NCBI
Homer2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 13,741,161 - 13,818,060 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 13,671,115 - 13,828,413 (+) NCBI ChiLan1.0 ChiLan1.0
HOMER2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 72,906,093 - 73,051,976 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 77,066,987 - 77,212,497 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 62,617,905 - 62,762,903 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 80,731,863 - 80,876,442 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 80,737,570 - 80,784,729 (-) Ensembl panpan1.1 panPan2
Homer2 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 128,699,719 - 128,836,080 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936483 17,507,533 - 17,539,105 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936483 17,500,962 - 17,634,804 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HOMER2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 52,001,579 - 52,096,828 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 52,001,253 - 52,104,426 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 57,489,011 - 57,584,450 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HOMER2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 2,667,718 - 2,810,238 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 2,706,134 - 2,803,372 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 44,281,540 - 44,425,488 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Homer2 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 309 Count of miRNA genes: 186 Interacting mature miRNAs: 214 Transcripts: ENSRNOT00000026158 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 631570 Bp94 Blood pressure QTL 94 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123479780 142990467 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631202 Gluco13 Glucose level QTL 13 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 131763437 159756369 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
D1Mco51
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 135,589,540 - 135,589,751 (+) MAPPER mRatBN7.2 Rnor_6.0 1 143,465,134 - 143,465,344 NCBI Rnor6.0 Rnor_5.0 1 144,408,859 - 144,409,069 UniSTS Rnor5.0 RGSC_v3.4 1 137,848,962 - 137,849,172 UniSTS RGSC3.4 Celera 1 127,640,507 - 127,640,717 UniSTS Cytogenetic Map 1 q31 UniSTS
RH140724
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 135,563,325 - 135,563,498 (+) MAPPER mRatBN7.2 Rnor_6.0 1 143,438,923 - 143,439,095 NCBI Rnor6.0 Rnor_5.0 1 144,382,648 - 144,382,820 UniSTS Rnor5.0 RGSC_v3.4 1 137,875,004 - 137,875,176 UniSTS RGSC3.4 RGSC_v3.4 1 137,822,751 - 137,822,923 UniSTS RGSC3.4 Celera 1 127,614,308 - 127,614,480 UniSTS RH 3.4 Map 1 1087.3 UniSTS Cytogenetic Map 1 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000087785 ⟹ ENSRNOP00000070858
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 135,567,414 - 135,659,772 (-) Ensembl Rnor_6.0 Ensembl 1 143,443,300 - 143,535,583 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094383 ⟹ ENSRNOP00000088957
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 135,567,414 - 135,601,000 (-) Ensembl
RefSeq Acc Id:
NM_053309 ⟹ NP_445761
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 144,976,642 - 145,068,997 (-) NCBI mRatBN7.2 1 135,567,414 - 135,659,772 (-) NCBI Rnor_6.0 1 143,443,300 - 143,535,579 (-) NCBI Rnor_5.0 1 144,387,025 - 144,478,034 (-) NCBI RGSC_v3.4 1 137,827,128 - 137,933,089 (-) RGD Celera 1 127,618,673 - 127,711,006 (-) RGD
Sequence:
GGCACGAGCGGGAGGGACCGGCGGCTCCGCCCGAGCGCGGCCGCCCAGCCCCGGGCCGCCCAGCCGCCCAGCCCCCGCCCTCCCGCCGGCCCGCGCCTGGCGGCGGCCCCGACACCGACAGAGCAGCC GCGCTGCCGGCGGAATGGAGCGGCGCCGGGGCTGAGCCGGGCGCACTCGGGCCGCCGCATGTGCCGCGCGGGGAGCAGCTGCCGAGCGGGCGGAGAGCGAACGCCAGGGGCCCCGTCGGAGCGGCCAC AGGAGCAGCGCCGGAGATGGGAGAGCAGCCCATCTTCACCACGCGAGCGCACGTCTTCCAGATTGACCCCAGCACCAAGAAGAACTGGGTGCCGGCAAGCAAGCAGGCCGTCACTGTTTCCTACTTCT ACGATGTCACCAGGAACAGCTATCGGATCATCAGTGTGGATGGAGCCAAGGTAATCATAAACAGCACCATCACCCCGAACATGACGTTCACCAAAACTTCACAGAAGTTCGGGCAGTGGGCTGACAGC AGGGCCAACACCGTGTTCGGTCTGGGATTCTCCTCAGAGCAGCAGCTCACAAAGTTTGCAGAGAAATTCCAGGAGGTAAGAGAAGCTGCCAGGTTAGCCAGAGACAAGTCCCAGGAGAAAATCGAGAC GTCAAGTAATCATTCCCAAGAATCTGGGTGTGAAACCCCGTCTTCCACTCAGGCATCCAGCGTCAATGGGACAGATGACGAGAAAGCCTCCCATGCGAGTCCGGCCGACACACACCTCAAGTCTGAGA ATGACAAGCTGAAGATCGCTTTGACACAGAGTGCTGCCAATGTGAAGAAGTGGGAGATCGAGCTGCAGACCCTGCGGGAGAGCAATGCCCGGCTGACCACCGCGCTGCAGGAGTCGGCGGCCAGTGTA GAACAGTGGAAGCGGCAATTCTCCATCTGCAGAGATGAGAATGACAGGCTCCGCAGCAAGATTGAGGAGCTGGAAGAACAGTGCGGTGAGATCAACAGGGAGAAGGAAAAGAACACCCAGCTGAAGAG GAGGATTGAGGAGCTGGAGTCAGAGGTCCGAGAAAAGGAAATGGAGTTGAAGGATCTCCGCAAACAAAGTGAAATCATACCTCAGCTCATGTCCGAGTGTGAATATGTCTCTGAGAAGTTAGAGGCTG CAGAAAGAGACAATCAAAACTTGGAAGACAAAGTGCGGTCTCTAAAGACAGACATCGAGGAGAGTAAATACCGGCAGCGCCACCTGAAGGGGGAGCTCAAGAGCTTCCTTGAGGTGCTGGACGGAAAG ATCGATGACCTCCACGACTTCCGCCGAGGGCTCTCCAAGCTAGGCACGGATAACTAGGGTGGGGCGGAGCCTAGATGGAGAGTGGAAAGCGTGTGTGAGAGATGAAGTGGGCATAGGGCATTCTCCGT TTGCTTCTGTAATGCGGGTGCGTTCTGTCTGTCTCCAGGCCAGTCGTGCCGTCCACTCGCTCCTCCAGAATAGAAAATCTCTTGCTTCTCTGGCTTTGTGAGGTCGTGGACACCTGGAAGCTTCTGAC TCAGGAATCCAGAACGGTCTACCTTAGCCGTTTACGCAGTCAGGGCAGGGACATTCAGATCTTCCCTTAAGGGCTGTTGCAACCCTATGAACTGGGGATGGGGGAAGTATTTTCTAATCCAAGTATCA TTAACCTTTACAACAGGCCTTTGGGCGCCTTCCGCTGCGTGGCACTCAGTGTGTGAGACTCTAGATTCCAGACCGGGAGCACGTGGAGGGAACATCTTTTCCCAGGATGCATTCTGTTCCTTTAGCAG AGGTAGCTAACCTTTCGAAGTTATGACAGATTTCACACTCAAAAACTGCACAATTGATCTACCCAAAAAGAAATAATTATTTAAAAAAAAAAACCTAACATATTTTAAGTAAATACACTGTTTTGGGT TGGAGCGCATTCATAGTTACCCTCAGCTGCATGTGGCCTTTGGACTGTAGGCCACACAAACCTCGTGCCGAATT
hide sequence
RefSeq Acc Id:
XM_039109538 ⟹ XP_038965466
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 144,968,207 - 145,069,022 (-) NCBI mRatBN7.2 1 135,558,977 - 135,659,772 (-) NCBI
RefSeq Acc Id:
XM_039109542 ⟹ XP_038965470
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 144,968,207 - 145,053,748 (-) NCBI mRatBN7.2 1 135,558,977 - 135,644,428 (-) NCBI
RefSeq Acc Id:
XM_063287628 ⟹ XP_063143698
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 144,968,207 - 145,033,967 (-) NCBI
RefSeq Acc Id:
NP_445761 ⟸ NM_053309
- UniProtKB:
O88802 (UniProtKB/Swiss-Prot), O88801 (UniProtKB/Swiss-Prot), A6JCH3 (UniProtKB/TrEMBL), A0A8I6GHM8 (UniProtKB/TrEMBL)
- Sequence:
MGEQPIFTTRAHVFQIDPSTKKNWVPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVREAARLARDKSQEKIETSSNHS QESGCETPSSTQASSVNGTDDEKASHASPADTHLKSENDKLKIALTQSAANVKKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRSKIEELEEQCGEINREKEKNTQLKRRIEEL ESEVREKEMELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKGELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
hide sequence
Ensembl Acc Id:
ENSRNOP00000070858 ⟸ ENSRNOT00000087785
RefSeq Acc Id:
XP_038965466 ⟸ XM_039109538
- Peptide Label:
isoform X1
- UniProtKB:
A6JCH2 (UniProtKB/TrEMBL), A0A8I6GHM8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965470 ⟸ XM_039109542
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6GHM8 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000088957 ⟸ ENSRNOT00000094383
RefSeq Acc Id:
XP_063143698 ⟸ XM_063287628
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6GHM8 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-03-16
Homer2
homer scaffold protein 2
Homer2
homer scaffolding protein 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2015-02-25
Homer2
homer scaffolding protein 2
Homer2
homer homolog 2 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2004-09-10
Homer2
homer homolog 2 (Drosophila)
homer, neuronal immediate early gene, 2
Name updated
1299863
APPROVED
2002-08-07
Homer2
homer, neuronal immediate early gene, 2
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_domains
contains N-terminal EVH1- and PDZ-like domains, C-terminal MCC (mutated in colorectal cancer)-like domain and leucine zipper
632975
gene_expression
expression is increased 1.5 fold in SHR compared with WKY rats
1357414
gene_product
member of the Vesl/Homer family of PDZ proteins
632975