Symbol:
Gsk3a
Name:
glycogen synthase kinase 3 alpha
RGD ID:
620351
Description:
Enables protein kinase A catalytic subunit binding activity; protein serine/threonine kinase activity; and protein serine/threonine kinase binding activity. Involved in negative regulation of dendrite development; negative regulation of insulin receptor signaling pathway; and positive regulation of neuron apoptotic process. Located in microtubule. Biomarker of Parkinsonism. Human ortholog(s) of this gene implicated in amyotrophic lateral sclerosis. Orthologous to human GSK3A (glycogen synthase kinase 3 alpha); PARTICIPATES IN glycogen biosynthetic pathway; nuclear factor, erythroid 2 like 2 signaling pathway; phosphatidylinositol 3-kinase-Akt signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 3,5-dichloro-N-[[(2S)-1-ethyl-2-pyrrolidinyl]methyl]-2-hydroxy-6-methoxybenzamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
FA; factor A; glycogen synthase kinase-3 alpha; GSK-3 alpha; serine/threonine-protein kinase GSK3A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GSK3A (glycogen synthase kinase 3 alpha) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Gsk3a (glycogen synthase kinase 3 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gsk3a (glycogen synthase kinase 3 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GSK3A (glycogen synthase kinase 3 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GSK3A (glycogen synthase kinase 3 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gsk3a (glycogen synthase kinase 3 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GSK3A (glycogen synthase kinase 3 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GSK3A (glycogen synthase kinase 3 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gsk3a (glycogen synthase kinase 3 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
GSK3A (glycogen synthase kinase 3 alpha)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Gsk3a (glycogen synthase kinase 3 alpha)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gsk3ab (glycogen synthase kinase 3 alpha b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gsk3aa (glycogen synthase kinase 3 alpha a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RIM11
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MRK1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
gsk-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
sgg
Alliance
DIOPT (OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
gsk3a
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 89,943,669 - 89,953,514 (-) NCBI GRCr8 mRatBN7.2 1 80,815,843 - 80,825,732 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 80,815,850 - 80,825,802 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 86,208,062 - 86,217,908 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 94,759,217 - 94,769,063 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 87,963,839 - 87,973,686 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 82,097,244 - 82,108,238 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 82,097,247 - 82,108,203 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 83,365,717 - 83,374,707 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 80,505,517 - 80,514,139 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 80,583,627 - 80,592,250 (-) NCBI Celera 1 75,259,483 - 75,269,362 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gsk3a Rat (-)-epigallocatechin 3-gallate increases phosphorylation ISO GSK3A (Homo sapiens) 6480464 epigallocatechin gallate results in increased phosphorylation of GSK3A protein CTD PMID:16968065 Gsk3a Rat (S)-nicotine multiple interactions ISO GSK3A (Homo sapiens) 6480464 [Nicotine results in increased phosphorylation of and results in increased activity of AKT1 protein] which results in increased phosphorylation of GSK3A protein CTD PMID:12511591 Gsk3a Rat (S)-nicotine increases expression ISO Gsk3a (Mus musculus) 6480464 Nicotine results in increased expression of GSK3A mRNA CTD PMID:31945395 Gsk3a Rat (S)-nicotine multiple interactions ISO Gsk3a (Mus musculus) 6480464 Nicotine results in increased expression of and results in decreased phosphorylation of GSK3A protein CTD PMID:31945395 Gsk3a Rat 1,2-dimethylhydrazine multiple interactions ISO Gsk3a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of GSK3A mRNA CTD PMID:22206623 Gsk3a Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO GSK3A (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Gsk3a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO GSK3A (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of GSK3A mRNA CTD PMID:23152189 Gsk3a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases phosphorylation EXP 6480464 Tetrachlorodibenzodioxin results in decreased phosphorylation of GSK3A protein CTD PMID:23639626 Gsk3a Rat 2,4,6-tribromophenol decreases expression ISO GSK3A (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Gsk3a Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of GSK3A mRNA CTD PMID:21346803 Gsk3a Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO GSK3A (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of GSK3A protein CTD PMID:31675489 Gsk3a Rat 3,5-dichloro-N-[[(2S)-1-ethyl-2-pyrrolidinyl]methyl]-2-hydroxy-6-methoxybenzamide multiple interactions EXP 6480464 DRD2 protein affects the reaction [Raclopride results in increased expression of GSK3A protein] CTD PMID:16144542 Gsk3a Rat 3,5-dichloro-N-[[(2S)-1-ethyl-2-pyrrolidinyl]methyl]-2-hydroxy-6-methoxybenzamide increases expression EXP 6480464 Raclopride results in increased expression of GSK3A protein CTD PMID:16144542 Gsk3a Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO GSK3A (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of GSK3A mRNA CTD PMID:28628672 Gsk3a Rat 4,4'-sulfonyldiphenol increases expression ISO GSK3A (Homo sapiens) 6480464 bisphenol S results in increased expression of GSK3A mRNA CTD PMID:38568856 Gsk3a Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of GSK3A mRNA CTD PMID:36041667 Gsk3a Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one multiple interactions ISO GSK3A (Homo sapiens) 6480464 [4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased phosphorylation of and results in increased activity of AKT1 protein] which results in increased phosphorylation of GSK3A protein CTD PMID:12511591 Gsk3a Rat 5-aza-2'-deoxycytidine increases expression ISO Gsk3a (Mus musculus) 6480464 Decitabine results in increased expression of GSK3A mRNA CTD PMID:27915011 Gsk3a Rat 6-bromoindirubin-3'-oxime multiple interactions ISO GSK3A (Homo sapiens) 6480464 6-bromoindirubin-3'-oxime promotes the reaction [Paraquat results in decreased expression of GSK3A protein modified form] CTD PMID:28414160 Gsk3a Rat actinomycin D multiple interactions ISO GSK3A (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of GSK3A protein CTD PMID:38460933 Gsk3a Rat all-trans-retinoic acid decreases phosphorylation ISO Gsk3a (Mus musculus) 6480464 Tretinoin results in decreased phosphorylation of GSK3A protein CTD PMID:16288212 Gsk3a Rat all-trans-retinoic acid increases phosphorylation ISO Gsk3a (Mus musculus) 6480464 Tretinoin results in increased phosphorylation of GSK3A protein CTD PMID:16288212 Gsk3a Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GSK3A mRNA CTD PMID:16483693 Gsk3a Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of GSK3A protein CTD PMID:16144542 Gsk3a Rat amphetamine increases response to substance ISO Gsk3a (Mus musculus) 6480464 GSK3A gene mutant form results in increased susceptibility to Amphetamine CTD PMID:20357757 Gsk3a Rat aristolochic acid A increases expression ISO GSK3A (Homo sapiens) 6480464 aristolochic acid I results in increased expression of GSK3A mRNA CTD PMID:33212167 Gsk3a Rat arsane multiple interactions ISO GSK3A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GSK3A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GSK3A mRNA CTD PMID:39836092 Gsk3a Rat arsenic atom multiple interactions ISO GSK3A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GSK3A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GSK3A mRNA CTD PMID:39836092 Gsk3a Rat arsenite(3-) decreases expression ISO Gsk3a (Mus musculus) 6480464 arsenite results in decreased expression of GSK3A protein CTD PMID:37955338 Gsk3a Rat arsenite(3-) increases expression ISO Gsk3a (Mus musculus) 6480464 arsenite results in increased expression of GSK3A protein modified form CTD PMID:24457827 Gsk3a Rat benzo[a]pyrene affects response to substance EXP 6480464 GSK3A protein affects the susceptibility to Benzo(a)pyrene CTD PMID:22100782 Gsk3a Rat benzo[a]pyrene multiple interactions EXP 6480464 GSK3A protein affects the reaction [Benzo(a)pyrene results in decreased expression of MYC protein] and GSK3A protein affects the reaction [Benzo(a)pyrene results in increased expression of HK2 mRNA] CTD PMID:22100782 Gsk3a Rat bisphenol A increases expression ISO GSK3A (Homo sapiens) 6480464 bisphenol A results in increased expression of GSK3A mRNA CTD PMID:38568856 Gsk3a Rat bisphenol A increases phosphorylation ISO GSK3A (Homo sapiens) 6480464 bisphenol A results in increased phosphorylation of GSK3A protein CTD PMID:36232920 Gsk3a Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of GSK3A mRNA and [bisphenol A co-treated with INS protein] results in decreased phosphorylation of GSK3A protein CTD PMID:36041667 and PMID:36328215 Gsk3a Rat bisphenol AF decreases expression ISO GSK3A (Homo sapiens) 6480464 bisphenol AF results in decreased expression of GSK3A mRNA CTD PMID:31121516 Gsk3a Rat bisphenol F multiple interactions ISO GSK3A (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of GSK3A mRNA CTD PMID:28628672 Gsk3a Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of GSK3A mRNA CTD PMID:36041667 Gsk3a Rat bisphenol F increases expression ISO GSK3A (Homo sapiens) 6480464 bisphenol F results in increased expression of GSK3A mRNA CTD PMID:38568856 Gsk3a Rat bortezomib multiple interactions ISO GSK3A (Homo sapiens) 6480464 [Bortezomib co-treated with lonafarnib] results in decreased expression of GSK3A protein modified form CTD PMID:16118318 Gsk3a Rat cadmium atom multiple interactions EXP 6480464 [Cadmium co-treated with rottlerin] results in decreased expression of GSK3A protein more ... CTD PMID:27658547 Gsk3a Rat cadmium atom multiple interactions ISO GSK3A (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GSK3A mRNA CTD PMID:35301059 Gsk3a Rat cadmium atom affects response to substance EXP 6480464 GSK3A protein affects the susceptibility to Cadmium CTD PMID:27658547 Gsk3a Rat cadmium atom increases phosphorylation EXP 6480464 Cadmium results in increased phosphorylation of GSK3A protein CTD PMID:27658547 Gsk3a Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of GSK3A mRNA CTD PMID:33453195 Gsk3a Rat cadmium dichloride multiple interactions ISO GSK3A (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GSK3A mRNA CTD PMID:35301059 Gsk3a Rat cadmium dichloride increases phosphorylation ISO GSK3A (Homo sapiens) 6480464 Cadmium Chloride results in increased phosphorylation of GSK3A protein CTD PMID:24057571 and PMID:25118938 Gsk3a Rat caffeine increases expression EXP 6480464 Caffeine results in increased expression of GSK3A mRNA CTD PMID:25868845 Gsk3a Rat caffeine decreases phosphorylation ISO GSK3A (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of GSK3A protein CTD PMID:35688186 Gsk3a Rat cannabidiol multiple interactions ISO GSK3A (Homo sapiens) 6480464 [Cannabidiol co-treated with moringin] results in increased expression of GSK3A mRNA CTD PMID:30096889 Gsk3a Rat CGP 52608 multiple interactions ISO GSK3A (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GSK3A gene] CTD PMID:28238834 Gsk3a Rat chlordecone decreases expression ISO Gsk3a (Mus musculus) 6480464 Chlordecone results in decreased expression of GSK3A mRNA CTD PMID:33711761 Gsk3a Rat cisplatin decreases phosphorylation ISO GSK3A (Homo sapiens) 6480464 Cisplatin results in decreased phosphorylation of GSK3A protein CTD PMID:21821001 Gsk3a Rat clobetasol increases expression ISO Gsk3a (Mus musculus) 6480464 Clobetasol results in increased expression of GSK3A mRNA CTD PMID:27462272 Gsk3a Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of GSK3A protein CTD PMID:16144542 Gsk3a Rat clozapine multiple interactions EXP 6480464 DRD2 protein affects the reaction [Clozapine results in increased expression of GSK3A protein] CTD PMID:16144542 Gsk3a Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of GSK3A mRNA CTD PMID:12117546 Gsk3a Rat coumarin decreases phosphorylation ISO GSK3A (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of GSK3A protein CTD PMID:35688186 Gsk3a Rat cyclosporin A increases phosphorylation ISO Gsk3a (Mus musculus) 6480464 Cyclosporine results in increased phosphorylation of GSK3A protein CTD PMID:22416070 Gsk3a Rat cyclosporin A increases phosphorylation ISO GSK3A (Homo sapiens) 6480464 Cyclosporine results in increased phosphorylation of GSK3A protein CTD PMID:22416070 Gsk3a Rat cyclosporin A multiple interactions ISO GSK3A (Homo sapiens) 6480464 [GSK3A protein co-treated with GSK3B protein] affects the reaction [Cyclosporine results in increased expression of SNAI1 protein] CTD PMID:22416070 Gsk3a Rat dexamethasone multiple interactions ISO GSK3A (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of GSK3A mRNA CTD PMID:28628672 Gsk3a Rat Dibutyl phosphate affects expression ISO GSK3A (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GSK3A mRNA CTD PMID:37042841 Gsk3a Rat elemental selenium increases expression ISO GSK3A (Homo sapiens) 6480464 Selenium results in increased expression of GSK3A mRNA CTD PMID:19244175 Gsk3a Rat fenthion increases expression ISO Gsk3a (Mus musculus) 6480464 Fenthion results in increased expression of GSK3A mRNA CTD PMID:34813904 Gsk3a Rat folic acid multiple interactions ISO Gsk3a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of GSK3A mRNA CTD PMID:22206623 Gsk3a Rat FR900359 increases phosphorylation ISO GSK3A (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of GSK3A protein CTD PMID:37730182 Gsk3a Rat Fusaric acid increases phosphorylation ISO Gsk3a (Mus musculus) 6480464 Fusaric Acid results in increased phosphorylation of GSK3A protein CTD PMID:32156565 Gsk3a Rat Fusaric acid decreases phosphorylation ISO Gsk3a (Mus musculus) 6480464 Fusaric Acid results in decreased phosphorylation of GSK3A protein CTD PMID:32156565 Gsk3a Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of GSK3A protein CTD PMID:16144542 Gsk3a Rat haloperidol multiple interactions EXP 6480464 DRD2 protein affects the reaction [Haloperidol results in increased expression of GSK3A protein] CTD PMID:16144542 Gsk3a Rat hexadecanoic acid affects phosphorylation ISO GSK3A (Homo sapiens) 6480464 Palmitic Acid affects the phosphorylation of GSK3A protein CTD PMID:28073184 Gsk3a Rat hydrogen peroxide multiple interactions ISO Gsk3a (Mus musculus) 6480464 [Hydrogen Peroxide co-treated with N-(oxo-5 more ... CTD PMID:31494107 Gsk3a Rat IC-87114 decreases phosphorylation ISO Gsk3a (Mus musculus) 6480464 IC 87114 results in decreased phosphorylation of GSK3A protein CTD PMID:16179367 Gsk3a Rat indometacin multiple interactions ISO GSK3A (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of GSK3A mRNA CTD PMID:28628672 Gsk3a Rat kenpaullone decreases phosphorylation EXP 6480464 kenpaullone results in decreased phosphorylation of GSK3A protein CTD PMID:17993264 Gsk3a Rat lead diacetate decreases methylation EXP 6480464 lead acetate results in decreased methylation of GSK3A gene CTD PMID:29571894 Gsk3a Rat lead diacetate increases expression ISO GSK3A (Homo sapiens) 6480464 lead acetate results in increased expression of GSK3A mRNA CTD PMID:38568856 Gsk3a Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of GSK3A protein CTD PMID:18296634 Gsk3a Rat lithium atom multiple interactions ISO GSK3A (Homo sapiens) 6480464 Lithium promotes the reaction [sodium arsenite results in increased phosphorylation of GSK3A protein] CTD PMID:17849503 Gsk3a Rat lithium chloride multiple interactions EXP 6480464 Lithium Chloride promotes the reaction [Cadmium results in increased phosphorylation of GSK3A protein] CTD PMID:27658547 Gsk3a Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of GSK3A protein CTD PMID:18296634 Gsk3a Rat lithium hydride multiple interactions ISO GSK3A (Homo sapiens) 6480464 Lithium promotes the reaction [sodium arsenite results in increased phosphorylation of GSK3A protein] CTD PMID:17849503 Gsk3a Rat lonafarnib multiple interactions ISO GSK3A (Homo sapiens) 6480464 [Bortezomib co-treated with lonafarnib] results in decreased expression of GSK3A protein modified form CTD PMID:16118318 Gsk3a Rat LY294002 decreases phosphorylation ISO GSK3A (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased phosphorylation of GSK3A protein CTD PMID:21821001 Gsk3a Rat LY294002 decreases phosphorylation ISO Gsk3a (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased phosphorylation of GSK3A protein CTD PMID:16179367 Gsk3a Rat LY294002 multiple interactions ISO GSK3A (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [resveratrol results in increased phosphorylation of GSK3A protein] and 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased phosphorylation of and results in increased activity of GSK3A protein CTD PMID:14750165 and PMID:19661225 Gsk3a Rat manganese atom multiple interactions ISO GSK3A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GSK3A mRNA CTD PMID:39836092 Gsk3a Rat manganese(0) multiple interactions ISO GSK3A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GSK3A mRNA CTD PMID:39836092 Gsk3a Rat manganese(II) chloride multiple interactions ISO GSK3A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GSK3A mRNA CTD PMID:39836092 Gsk3a Rat metformin increases phosphorylation ISO GSK3A (Homo sapiens) 6480464 Metformin results in increased phosphorylation of GSK3A protein CTD PMID:26835874 Gsk3a Rat methamphetamine decreases expression ISO Gsk3a (Mus musculus) 6480464 Methamphetamine results in decreased expression of GSK3A protein CTD PMID:16192988 Gsk3a Rat methamphetamine affects phosphorylation ISO GSK3A (Homo sapiens) 6480464 Methamphetamine affects the phosphorylation of GSK3A protein CTD PMID:31270305 Gsk3a Rat methamphetamine multiple interactions ISO GSK3A (Homo sapiens) 6480464 Rosiglitazone affects the reaction [Methamphetamine affects the phosphorylation of GSK3A protein] CTD PMID:31270305 Gsk3a Rat methidathion increases expression ISO Gsk3a (Mus musculus) 6480464 methidathion results in increased expression of GSK3A mRNA CTD PMID:34813904 Gsk3a Rat methylparaben increases expression ISO GSK3A (Homo sapiens) 6480464 methylparaben results in increased expression of GSK3A mRNA CTD PMID:38568856 Gsk3a Rat microcystin-LR multiple interactions ISO GSK3A (Homo sapiens) 6480464 cyanoginosin LR promotes the reaction [INS protein results in increased phosphorylation of and results in decreased activity of GSK3A protein] more ... CTD PMID:28984034 Gsk3a Rat microcystin-LR increases phosphorylation ISO Gsk3a (Mus musculus) 6480464 cyanoginosin LR results in increased phosphorylation of GSK3A protein CTD PMID:31714646 Gsk3a Rat microcystin-LR increases phosphorylation ISO GSK3A (Homo sapiens) 6480464 cyanoginosin LR results in increased phosphorylation of GSK3A protein CTD PMID:32073747 Gsk3a Rat microcystin-LR multiple interactions ISO Gsk3a (Mus musculus) 6480464 cyanoginosin LR results in increased phosphorylation of and results in decreased activity of GSK3A protein CTD PMID:28984034 Gsk3a Rat N-acetylsphingosine decreases phosphorylation ISO GSK3A (Homo sapiens) 6480464 N-acetylsphingosine results in decreased phosphorylation of GSK3A protein CTD PMID:21821001 Gsk3a Rat nicotine multiple interactions ISO GSK3A (Homo sapiens) 6480464 [Nicotine results in increased phosphorylation of and results in increased activity of AKT1 protein] which results in increased phosphorylation of GSK3A protein CTD PMID:12511591 Gsk3a Rat nicotine multiple interactions ISO Gsk3a (Mus musculus) 6480464 Nicotine results in increased expression of and results in decreased phosphorylation of GSK3A protein CTD PMID:31945395 Gsk3a Rat nicotine increases expression ISO Gsk3a (Mus musculus) 6480464 Nicotine results in increased expression of GSK3A mRNA CTD PMID:31945395 Gsk3a Rat nordihydroguaiaretic acid increases phosphorylation EXP 329955565 NDGA increases phosphorylation in liver of high fructose fed rats RGD Gsk3a Rat Nutlin-3 multiple interactions ISO GSK3A (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of GSK3A protein CTD PMID:38460933 Gsk3a Rat ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased phosphorylation of GSK3A protein CTD PMID:37088303 Gsk3a Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of GSK3A mRNA CTD PMID:15206577 Gsk3a Rat paraquat increases phosphorylation ISO GSK3A (Homo sapiens) 6480464 Paraquat results in increased phosphorylation of GSK3A protein CTD PMID:30205152 Gsk3a Rat paraquat decreases expression ISO GSK3A (Homo sapiens) 6480464 Paraquat results in decreased expression of GSK3A protein CTD PMID:28414160 Gsk3a Rat paraquat multiple interactions ISO GSK3A (Homo sapiens) 6480464 6-bromoindirubin-3'-oxime promotes the reaction [Paraquat results in decreased expression of GSK3A protein modified form] CTD PMID:28414160 Gsk3a Rat perfluorodecanoic acid decreases expression ISO GSK3A (Homo sapiens) 6480464 perfluorodecanoic acid results in decreased expression of GSK3A mRNA CTD PMID:38568856 Gsk3a Rat perfluorododecanoic acid decreases expression EXP 6480464 perfluorododecanoic acid results in decreased expression of GSK3A protein and perfluorododecanoic acid results in decreased expression of GSK3A protein modified form CTD PMID:23353032 Gsk3a Rat perfluorododecanoic acid affects response to substance EXP 6480464 GSK3A protein affects the susceptibility to perfluorododecanoic acid CTD PMID:23353032 Gsk3a Rat perfluorooctanoic acid multiple interactions ISO Gsk3a (Mus musculus) 6480464 Dietary Fats and Unsaturated inhibits the reaction [perfluorooctanoic acid results in increased expression of GSK3A mRNA] CTD PMID:23626681 Gsk3a Rat phenanthrene decreases expression ISO GSK3A (Homo sapiens) 6480464 phenanthrene results in decreased expression of GSK3A mRNA CTD PMID:38568856 Gsk3a Rat phorbol 13-acetate 12-myristate increases phosphorylation EXP 6480464 Tetradecanoylphorbol Acetate results in increased phosphorylation of GSK3A protein CTD PMID:17993264 Gsk3a Rat phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 U 0126 inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of GSK3A protein] CTD PMID:17993264 Gsk3a Rat potassium atom multiple interactions EXP 6480464 GW 506033X promotes the reaction [Potassium deficiency results in decreased phosphorylation of GSK3A protein] CTD PMID:19046382 Gsk3a Rat potassium atom decreases phosphorylation EXP 6480464 Potassium deficiency results in decreased phosphorylation of GSK3A protein CTD PMID:19046382 Gsk3a Rat propylparaben increases expression ISO GSK3A (Homo sapiens) 6480464 propylparaben results in increased expression of GSK3A mRNA CTD PMID:38568856 Gsk3a Rat prostaglandin E2 increases phosphorylation ISO Gsk3a (Mus musculus) 6480464 Dinoprostone results in increased phosphorylation of GSK3A protein CTD PMID:20578217 Gsk3a Rat quercetin decreases expression ISO GSK3A (Homo sapiens) 6480464 Quercetin results in decreased expression of GSK3A protein CTD PMID:16968065 Gsk3a Rat resveratrol multiple interactions ISO GSK3A (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [resveratrol results in increased phosphorylation of GSK3A protein] and resveratrol results in decreased phosphorylation of and results in increased activity of GSK3A protein CTD PMID:14750165 and PMID:17486135 Gsk3a Rat resveratrol increases phosphorylation ISO GSK3A (Homo sapiens) 6480464 resveratrol results in increased phosphorylation of GSK3A protein CTD PMID:14750165 Gsk3a Rat resveratrol decreases phosphorylation ISO GSK3A (Homo sapiens) 6480464 resveratrol results in decreased phosphorylation of GSK3A protein CTD PMID:14750165 Gsk3a Rat risperidone increases expression EXP 6480464 Risperidone results in increased expression of GSK3A protein CTD PMID:16144542 Gsk3a Rat risperidone multiple interactions EXP 6480464 DRD2 protein affects the reaction [Risperidone results in increased expression of GSK3A protein] CTD PMID:16144542 Gsk3a Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of GSK3A mRNA CTD PMID:28374803 Gsk3a Rat rottlerin decreases expression EXP 6480464 rottlerin results in decreased expression of GSK3A protein CTD PMID:27658547 Gsk3a Rat rottlerin multiple interactions EXP 6480464 [Cadmium co-treated with rottlerin] results in decreased expression of GSK3A protein CTD PMID:27658547 Gsk3a Rat ruthenium atom decreases activity ISO GSK3A (Homo sapiens) 6480464 Ruthenium results in decreased activity of GSK3A protein CTD PMID:17210701 Gsk3a Rat selenium atom increases expression ISO GSK3A (Homo sapiens) 6480464 Selenium results in increased expression of GSK3A mRNA CTD PMID:19244175 Gsk3a Rat silver atom affects phosphorylation ISO GSK3A (Homo sapiens) 6480464 Silver affects the phosphorylation of GSK3A protein CTD PMID:27593553 Gsk3a Rat silver(0) affects phosphorylation ISO GSK3A (Homo sapiens) 6480464 Silver affects the phosphorylation of GSK3A protein CTD PMID:27593553 Gsk3a Rat sodium arsenite multiple interactions ISO GSK3A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GSK3A mRNA more ... CTD PMID:17849503 and PMID:39836092 Gsk3a Rat sodium arsenite decreases expression ISO GSK3A (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GSK3A protein CTD PMID:30528433 Gsk3a Rat sodium arsenite increases phosphorylation ISO Gsk3a (Mus musculus) 6480464 sodium arsenite results in increased phosphorylation of GSK3A protein CTD PMID:12529330 Gsk3a Rat sodium arsenite increases phosphorylation ISO GSK3A (Homo sapiens) 6480464 sodium arsenite results in increased phosphorylation of GSK3A protein CTD PMID:17849503 more ... Gsk3a Rat sodium fluoride increases expression ISO Gsk3a (Mus musculus) 6480464 Sodium Fluoride results in increased expression of GSK3A protein CTD PMID:28918527 Gsk3a Rat sphingosine 1-phosphate multiple interactions ISO GSK3A (Homo sapiens) 6480464 sphingosine 1-phosphate inhibits the reaction [beta-N-methylamino-L-alanine results in increased expression of GSK3A protein] and Wortmannin inhibits the reaction [sphingosine 1-phosphate inhibits the reaction [beta-N-methylamino-L-alanine results in increased expression of GSK3A protein]] CTD PMID:25769802 Gsk3a Rat sucrose decreases phosphorylation EXP 6480464 Sucrose results in decreased phosphorylation of GSK3A protein CTD PMID:12514263 Gsk3a Rat tacrolimus hydrate multiple interactions ISO GSK3A (Homo sapiens) 6480464 [GSK3A protein co-treated with GSK3B protein] affects the reaction [Tacrolimus results in increased expression of SNAI1 protein] CTD PMID:22416070 Gsk3a Rat tacrolimus hydrate increases phosphorylation ISO GSK3A (Homo sapiens) 6480464 Tacrolimus results in increased phosphorylation of GSK3A protein CTD PMID:22416070 Gsk3a Rat triphenyl phosphate affects expression ISO GSK3A (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GSK3A mRNA CTD PMID:37042841 Gsk3a Rat urethane increases expression ISO GSK3A (Homo sapiens) 6480464 Urethane results in increased expression of GSK3A mRNA CTD PMID:28818685 Gsk3a Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of GSK3A mRNA CTD PMID:23034163 Gsk3a Rat vitamin E increases expression ISO GSK3A (Homo sapiens) 6480464 Vitamin E results in increased expression of GSK3A mRNA CTD PMID:19244175 Gsk3a Rat wortmannin multiple interactions ISO GSK3A (Homo sapiens) 6480464 Wortmannin inhibits the reaction [sphingosine 1-phosphate inhibits the reaction [beta-N-methylamino-L-alanine results in increased expression of GSK3A protein]] CTD PMID:25769802
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,5-dichloro-N-[[(2S)-1-ethyl-2-pyrrolidinyl]methyl]-2-hydroxy-6-methoxybenzamide (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO) 5-aza-2'-deoxycytidine (ISO) 6-bromoindirubin-3'-oxime (ISO) actinomycin D (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphetamine (EXP,ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP,ISO) bortezomib (ISO) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) caffeine (EXP,ISO) cannabidiol (ISO) CGP 52608 (ISO) chlordecone (ISO) cisplatin (ISO) clobetasol (ISO) clozapine (EXP) cocaine (EXP) coumarin (ISO) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) elemental selenium (ISO) fenthion (ISO) folic acid (ISO) FR900359 (ISO) Fusaric acid (ISO) haloperidol (EXP) hexadecanoic acid (ISO) hydrogen peroxide (ISO) IC-87114 (ISO) indometacin (ISO) kenpaullone (EXP) lead diacetate (EXP,ISO) lithium atom (EXP,ISO) lithium chloride (EXP) lithium hydride (EXP,ISO) lonafarnib (ISO) LY294002 (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) metformin (ISO) methamphetamine (ISO) methidathion (ISO) methylparaben (ISO) microcystin-LR (ISO) N-acetylsphingosine (ISO) nicotine (ISO) nordihydroguaiaretic acid (EXP) Nutlin-3 (ISO) ozone (EXP) paraquat (EXP,ISO) perfluorodecanoic acid (ISO) perfluorododecanoic acid (EXP) perfluorooctanoic acid (ISO) phenanthrene (ISO) phorbol 13-acetate 12-myristate (EXP) potassium atom (EXP) propylparaben (ISO) prostaglandin E2 (ISO) quercetin (ISO) resveratrol (ISO) risperidone (EXP) rotenone (EXP) rottlerin (EXP) ruthenium atom (ISO) selenium atom (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sphingosine 1-phosphate (ISO) sucrose (EXP) tacrolimus hydrate (ISO) triphenyl phosphate (ISO) urethane (ISO) vinclozolin (EXP) vitamin E (ISO) wortmannin (ISO)
Biological Process
autosome genomic imprinting (ISO) cardiac left ventricle morphogenesis (ISO) cell differentiation (IBA) cell migration (ISO) cellular response to glucocorticoid stimulus (ISO) cellular response to insulin stimulus (ISO) cellular response to interleukin-3 (ISO,ISS) cellular response to lithium ion (ISO) extrinsic apoptotic signaling pathway (ISO) extrinsic apoptotic signaling pathway in absence of ligand (ISO,ISS) glycogen metabolic process (IEA) insulin receptor signaling pathway (IBA,ISO) negative regulation of canonical Wnt signaling pathway (IBA) negative regulation of cell growth involved in cardiac muscle cell development (ISO) negative regulation of D-glucose import (ISO) negative regulation of dendrite development (IMP) negative regulation of developmental process (IEA) negative regulation of insulin receptor signaling pathway (IDA,ISO) negative regulation of signal transduction (IEA) negative regulation of TOR signaling (IBA,ISO) nervous system development (IEA) peptidyl-serine phosphorylation (ISO) positive regulation of adenylate cyclase-activating adrenergic receptor signaling pathway (ISO) positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway (ISO) positive regulation of amyloid-beta formation (ISO) positive regulation of autophagy (IBA,ISO,ISS) positive regulation of gene expression (ISO) positive regulation of glycogen (starch) synthase activity (ISO) positive regulation of heart contraction (ISO) positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway (ISO,ISS) positive regulation of neuron apoptotic process (IBA,IMP) positive regulation of peptidyl-serine phosphorylation (ISO) positive regulation of peptidyl-threonine phosphorylation (ISO) positive regulation of proteasomal ubiquitin-dependent protein catabolic process (IBA,ISO) positive regulation of protein targeting to mitochondrion (ISO) positive regulation of protein ubiquitination (ISO) positive regulation of transcription by RNA polymerase II (ISO) proteasome-mediated ubiquitin-dependent protein catabolic process (ISO,ISS) protein phosphorylation (ISO) regulation of microtubule cytoskeleton organization (IBA) regulation of mitophagy (ISO) regulation of neuron projection development (IBA) regulation of systemic arterial blood pressure (ISO) Wnt signaling pathway (IEA)
1.
Inhibition of glycogen synthase kinase-3 by insulin mediated by protein kinase B.
Cross DA, etal., Nature. 1995 Dec 21-28;378(6559):785-9.
2.
Structural and functional characterization of Nrf2 degradation by glycogen synthase kinase 3/beta-TrCP.
Cuadrado A Free Radic Biol Med. 2015 Nov;88(Pt B):147-57. doi: 10.1016/j.freeradbiomed.2015.04.029. Epub 2015 Apr 30.
3.
Phosphorylation and inactivation of glycogen synthase kinase 3 by protein kinase A.
Fang X, etal., Proc Natl Acad Sci U S A. 2000 Oct 24;97(22):11960-5.
4.
Glycogen synthase kinase 3: a key regulator of cellular fate.
Forde JE and Dale TC, Cell Mol Life Sci. 2007 Aug;64(15):1930-44.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Different localization of tau protein kinase I/glycogen synthase kinase-3 beta from glycogen synthase kinase-3 alpha in cerebellum mitochondria.
Hoshi M, etal., J Biochem. 1995 Oct;118(4):683-5.
7.
Protein kinase and protein phosphatase expression in amyotrophic lateral sclerosis spinal cord.
Hu JH, etal., J Neurochem. 2003 Apr;85(2):432-42.
8.
Selectively silencing GSK-3 isoforms reduces plaques and tangles in mouse models of Alzheimer's disease.
Hurtado DE, etal., J Neurosci. 2012 May 23;32(21):7392-402. doi: 10.1523/JNEUROSCI.0889-12.2012.
9.
Measures of striatal insulin resistance in a 6-hydroxydopamine model of Parkinson's disease.
Morris JK, etal., Brain Res. 2008 Nov 13;1240:185-95. doi: 10.1016/j.brainres.2008.08.089. Epub 2008 Sep 11.
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
13.
Insulin decreases the glycogen synthase kinase-3 alpha mRNA levels by altering its stability in streptozotocin-induced diabetic rat liver.
Rao PV, etal., Biochem Biophys Res Commun. 1995 Dec 5;217(1):250-6.
14.
Flavonoid-mediated presenilin-1 phosphorylation reduces Alzheimer's disease beta-amyloid production.
Rezai-Zadeh K, etal., J Cell Mol Med. 2009 Mar;13(3):574-88. doi: 10.1111/j.1582-4934.2008.00344.x. Epub 2008 Apr 9.
15.
GOA pipeline
RGD automated data pipeline
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Enhanced glycogenesis is involved in cellular senescence via GSK3/GS modulation.
Seo YH, etal., Aging Cell. 2008 Dec;7(6):894-907. doi: 10.1111/j.1474-9726.2008.00436.x. Epub 2008 Sep 8.
18.
Inhibitory phosphorylation of GSK-3 by CaMKII couples depolarization to neuronal survival.
Song B, etal., J Biol Chem. 2010 Dec 24;285(52):41122-34. doi: 10.1074/jbc.M110.130351. Epub 2010 Sep 14.
19.
GSK-3alpha/beta-mediated phosphorylation of CRMP-2 regulates activity-dependent dendritic growth.
Tan M, etal., J Neurochem. 2013 Jun;125(5):685-97. doi: 10.1111/jnc.12230. Epub 2013 Mar 25.
20.
Molecular cloning and expression of glycogen synthase kinase-3/factor A.
Woodgett JR EMBO J 1990 Aug;9(8):2431-8.
21.
Glycogen synthase kinase-3alpha reduces cardiac growth and pressure overload-induced cardiac hypertrophy by inhibition of extracellular signal-regulated kinases.
Zhai P, etal., J Biol Chem. 2007 Nov 9;282(45):33181-91. Epub 2007 Sep 12.
22.
Effect of Creosote Bush-Derived NDGA on Expression of Genes Involved in Lipid Metabolism in Liver of High-Fructose Fed Rats: Relevance to NDGA Amelioration of Hypertriglyceridemia and Hepatic Steatosis.
Zhang H, etal., PLoS One. 2015 Sep 22;10(9):e0138203. doi: 10.1371/journal.pone.0138203. eCollection 2015.
Gsk3a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 89,943,669 - 89,953,514 (-) NCBI GRCr8 mRatBN7.2 1 80,815,843 - 80,825,732 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 80,815,850 - 80,825,802 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 86,208,062 - 86,217,908 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 94,759,217 - 94,769,063 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 87,963,839 - 87,973,686 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 82,097,244 - 82,108,238 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 82,097,247 - 82,108,203 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 83,365,717 - 83,374,707 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 80,505,517 - 80,514,139 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 80,583,627 - 80,592,250 (-) NCBI Celera 1 75,259,483 - 75,269,362 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
GSK3A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 42,230,190 - 42,242,602 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 42,226,225 - 42,242,625 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 42,734,342 - 42,746,754 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 47,426,178 - 47,438,576 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 47,426,177 - 47,438,576 NCBI Celera 19 39,535,133 - 39,547,532 (-) NCBI Celera Cytogenetic Map 19 q13.2 NCBI HuRef 19 39,164,764 - 39,177,148 (-) NCBI HuRef CHM1_1 19 42,736,013 - 42,748,418 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 45,049,560 - 45,061,976 (-) NCBI T2T-CHM13v2.0
Gsk3a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 24,927,683 - 24,937,276 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 24,927,683 - 24,937,276 (-) Ensembl GRCm39 Ensembl GRCm38 7 25,228,258 - 25,237,851 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 25,228,258 - 25,237,851 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 26,013,278 - 26,022,870 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 24,937,019 - 24,946,611 (-) NCBI MGSCv36 mm8 Celera 7 19,843,563 - 19,853,655 (-) NCBI Celera Cytogenetic Map 7 A3 NCBI cM Map 7 13.73 NCBI
Gsk3a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955555 667,973 - 676,351 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955555 668,641 - 676,351 (+) NCBI ChiLan1.0 ChiLan1.0
GSK3A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 48,335,581 - 48,348,020 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 50,204,206 - 50,216,648 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 39,118,330 - 39,130,768 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 47,710,197 - 47,722,531 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 47,710,197 - 47,726,948 (-) Ensembl panpan1.1 panPan2
GSK3A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 112,129,116 - 112,138,714 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 112,103,825 - 112,138,559 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 111,555,288 - 111,565,002 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 112,741,760 - 112,751,476 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 112,741,641 - 112,751,092 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 112,295,962 - 112,305,677 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 111,931,910 - 111,941,621 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 112,858,454 - 112,868,171 (+) NCBI UU_Cfam_GSD_1.0
Gsk3a
GSK3A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 49,690,370 - 49,701,189 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 49,690,319 - 49,700,735 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 45,607,906 - 45,618,432 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GSK3A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 36,434,966 - 36,447,676 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 36,435,578 - 36,447,633 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 14,679,200 - 14,692,630 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gsk3a
.
Predicted Target Of
Count of predictions: 6 Count of miRNA genes: 3 Interacting mature miRNAs: 6 Transcripts: ENSRNOT00000027677 Prediction methods: Targetscan Result types: miRGate_prediction
1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 51940904 101229020 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 87889942 132889942 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 39728272 132889942 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 46302615 91302615 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 51941022 208479811 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 46302615 91302615 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 51940904 168768703 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 46302615 91302615 Rat 1331800 Scl25 Serum cholesterol level QTL 25 3.013 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 87785026 142582336 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 83019780 128019780 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 46302615 91302615 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 66404680 111404680 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 34184556 172281316 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 46302615 91302615 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 81269860 99645535 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 66009857 160501508 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 34565911 208798288 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 46302615 91302615 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 66400974 132889942 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 84107164 115183752 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 51511344 153680016 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 65405637 96805205 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 51909206 91302615 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 86622262 131622262 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 58769992 103769992 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 46302615 91302615 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 66077886 111077886 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 46302615 91302615 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 86993904 131993904 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 87558587 132558587 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 46302615 91302615 Rat
AI044641
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 80,817,592 - 80,817,772 (+) MAPPER mRatBN7.2 Rnor_6.0 1 82,100,103 - 82,100,282 NCBI Rnor6.0 Rnor_5.0 1 83,366,607 - 83,366,786 UniSTS Rnor5.0 RGSC_v3.4 1 80,506,039 - 80,506,218 UniSTS RGSC3.4 Celera 1 75,261,262 - 75,261,441 UniSTS RH 3.4 Map 1 824.5 UniSTS Cytogenetic Map 1 q21 UniSTS
AU048392
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 80,827,014 - 80,827,144 (+) MAPPER mRatBN7.2 Rnor_6.0 1 82,109,527 - 82,109,658 NCBI Rnor6.0 Rnor_5.0 1 83,376,031 - 83,376,162 UniSTS Rnor5.0 RGSC_v3.4 1 80,515,463 - 80,515,594 UniSTS RGSC3.4 Celera 1 75,270,686 - 75,270,817 UniSTS Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027677 ⟹ ENSRNOP00000027677
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 80,815,850 - 80,825,802 (-) Ensembl Rnor_6.0 Ensembl 1 82,097,848 - 82,108,083 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000084530 ⟹ ENSRNOP00000074376
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 82,097,247 - 82,108,203 (-) Ensembl
RefSeq Acc Id:
NM_017344 ⟹ NP_059040
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 89,943,669 - 89,953,514 (-) NCBI mRatBN7.2 1 80,815,847 - 80,825,691 (-) NCBI Rnor_6.0 1 82,097,244 - 82,108,203 (-) NCBI Rnor_5.0 1 83,365,717 - 83,374,707 (-) NCBI RGSC_v3.4 1 80,505,517 - 80,514,139 (-) RGD Celera 1 75,259,483 - 75,269,362 (-) RGD
Sequence:
GGGCACGCCGGAGCCCGAACGGCGCAGCCTGGAAGAGGCCGGAGCCCAAGGGAGGCGGCGGTAGAGGCAGCGGCGGGGGCAGCCCAGGCAGCCCGAGCCCCGCGGCCTGGGCCTGCGCTCGGCGCCAT
hide sequence
RefSeq Acc Id:
NP_059040 ⟸ NM_017344
- UniProtKB:
P18265 (UniProtKB/Swiss-Prot), A6J947 (UniProtKB/TrEMBL), A0A8L2QGG1 (UniProtKB/TrEMBL)
- Sequence:
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPSGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNG
hide sequence
Ensembl Acc Id:
ENSRNOP00000074376 ⟸ ENSRNOT00000084530
Ensembl Acc Id:
ENSRNOP00000027677 ⟸ ENSRNOT00000027677
RGD ID: 13689811 Promoter ID: EPDNEW_R336 Type: initiation region Name: Gsk3a_1 Description: glycogen synthase kinase 3 alpha SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 82,108,178 - 82,108,238 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-01-20
Gsk3a
glycogen synthase kinase 3 alpha
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Gsk3a
glycogen synthase kinase 3 alpha
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_protein
51 kDa
70757
