Symbol:
Pln
Name:
phospholamban
RGD ID:
619894
Description:
Enables ATPase inhibitor activity and identical protein binding activity. Involved in several processes, including response to insulin; response to testosterone; and response to zinc ion. Located in sarcoplasmic reticulum and vesicle. Part of protein-containing complex. Used to study congestive heart failure; heart disease; and myocardial infarction. Biomarker of myocardial infarction and type 2 diabetes mellitus. Human ortholog(s) of this gene implicated in dilated cardiomyopathy 1P and hypertrophic cardiomyopathy 18. Orthologous to human PLN (phospholamban); PARTICIPATES IN acebutolol pharmacodynamics pathway; adrenergic beta receptor agonist and beta-blocker pharmacodynamics pathway; amiodarone pharmacodynamics pathway; INTERACTS WITH (-)-epigallocatechin 3-gallate; 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
cardiac phospholamban; PLB; Plm
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PLN (phospholamban) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Pln (phospholamban) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pln (phospholamban) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PLN (phospholamban) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PLN (phospholamban) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pln (phospholamban) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PLN (phospholamban) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PLN (phospholamban) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pln (phospholamban) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Pln (phospholamban)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PLN (phospholamban)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 33,166,512 - 33,182,241 (+) NCBI GRCr8 mRatBN7.2 20 32,629,537 - 32,639,559 (+) NCBI mRatBN7.2 mRatBN7.2 UTH_Rnor_SHR_Utx 20 33,643,487 - 33,653,241 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 33,034,203 - 33,043,957 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 33,768,368 - 33,778,120 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 34,633,157 - 34,642,904 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 34,633,157 - 34,642,904 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 36,390,879 - 36,400,626 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 32,000,371 - 32,008,559 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 32,014,170 - 32,022,359 (+) NCBI Celera 20 34,009,102 - 34,018,849 (+) NCBI Celera Cytogenetic Map 20 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pln Rat (-)-epigallocatechin 3-gallate increases expression EXP 11097969 EGCG increases expression of Pln protein after myocardial infarction in rat heart left ventricle RGD Pln Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO Pln (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pln Rat 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of PLN mRNA CTD PMID:27840820 Pln Rat 1,2-dimethylhydrazine increases expression ISO Pln (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PLN mRNA CTD PMID:22206623 Pln Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Pln (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pln Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Pln (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pln Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO PLN (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of PLN mRNA] CTD PMID:11007951 Pln Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PLN mRNA CTD PMID:34747641 Pln Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PLN (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLN mRNA CTD PMID:11007951 Pln Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO Pln (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pln Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine increases expression EXP 6480464 Puromycin Aminonucleoside results in increased expression of PLN mRNA CTD PMID:17457379 Pln Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Pln (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PLN mRNA CTD PMID:20188158 Pln Rat 4,4'-sulfonyldiphenol increases phosphorylation EXP 6480464 bisphenol S results in increased phosphorylation of PLN protein CTD PMID:25723814 Pln Rat 4,4'-sulfonyldiphenol affects phosphorylation ISO Pln (Mus musculus) 6480464 bisphenol S affects the phosphorylation of PLN protein CTD PMID:31685870 Pln Rat 4,4'-sulfonyldiphenol increases expression ISO Pln (Mus musculus) 6480464 bisphenol S results in increased expression of PLN mRNA CTD PMID:30951980 Pln Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 4-(2-phenyl-5 more ... CTD PMID:25723814 Pln Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of PLN mRNA CTD PMID:22484513 Pln Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PLN mRNA CTD PMID:24780913 and PMID:30047161 Pln Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PLN mRNA CTD PMID:31881176 Pln Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of PLN protein CTD PMID:33236894 Pln Rat aflatoxin B1 decreases expression ISO Pln (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of PLN mRNA CTD PMID:19770486 Pln Rat aflatoxin B1 decreases methylation ISO PLN (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PLN gene CTD PMID:27153756 Pln Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PLN mRNA CTD PMID:22484513 more ... Pln Rat all-trans-retinoic acid increases expression ISO PLN (Homo sapiens) 6480464 Tretinoin results in increased expression of PLN mRNA CTD PMID:21934132 Pln Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of PLN mRNA CTD PMID:35163327 Pln Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PLN mRNA CTD PMID:30047161 Pln Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PLN mRNA CTD PMID:16483693 Pln Rat anthracen-2-amine increases expression EXP 6480464 2-anthramine results in increased expression of PLN mRNA CTD PMID:23038007 Pln Rat arotinoid acid multiple interactions ISO PLN (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Pln Rat astragaloside IV multiple interactions EXP 6480464 astragaloside A inhibits the reaction [Isoproterenol results in decreased phosphorylation of PLN protein] CTD PMID:17509559 Pln Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of PLN mRNA CTD PMID:21839799 Pln Rat benzo[a]pyrene decreases expression ISO Pln (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PLN mRNA CTD PMID:22228805 and PMID:22610609 Pln Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of PLN mRNA CTD PMID:20920545 Pln Rat bis(2-ethylhexyl) phthalate increases expression ISO PLN (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of PLN mRNA CTD PMID:31163220 Pln Rat bisphenol A increases expression ISO Pln (Mus musculus) 6480464 bisphenol A results in increased expression of PLN protein CTD PMID:23418087 Pln Rat bisphenol A decreases expression ISO Pln (Mus musculus) 6480464 bisphenol A results in decreased expression of PLN mRNA CTD PMID:32156529 Pln Rat bisphenol A decreases phosphorylation ISO Pln (Mus musculus) 6480464 bisphenol A results in decreased phosphorylation of PLN protein CTD PMID:31685870 Pln Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PLN gene CTD PMID:28505145 Pln Rat bisphenol A multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Progesterone inhibits the reaction [bisphenol A results in increased phosphorylation of PLN protein]] more ... CTD PMID:28324061 Pln Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PLN mRNA CTD PMID:25181051 Pln Rat bisphenol A increases phosphorylation EXP 6480464 bisphenol A results in increased phosphorylation of PLN protein CTD PMID:24140712 and PMID:28324061 Pln Rat bisphenol F increases expression ISO Pln (Mus musculus) 6480464 bisphenol F results in increased expression of PLN mRNA CTD PMID:30951980 Pln Rat cadmium atom decreases expression ISO PLN (Homo sapiens) 6480464 Cadmium results in decreased expression of PLN mRNA CTD PMID:21694771 Pln Rat candesartan multiple interactions EXP 6480464 candesartan inhibits the reaction [Isoproterenol results in decreased phosphorylation of PLN protein] CTD PMID:16723803 Pln Rat cantharidin decreases expression ISO Pln (Mus musculus) 6480464 Cantharidin results in decreased expression of PLN mRNA CTD PMID:36907384 Pln Rat CHIR 99021 multiple interactions ISO PLN (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Pln Rat cilostazol affects expression EXP 6480464 cilostazol affects the expression of PLN mRNA and cilostazol affects the expression of PLN protein CTD PMID:18088389 Pln Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of PLN mRNA CTD PMID:22023808 Pln Rat copper atom increases expression EXP 6480464 Copper results in increased expression of PLN mRNA CTD PMID:30556269 Pln Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of PLN mRNA CTD PMID:30556269 Pln Rat cortisol multiple interactions ISO PLN (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Pln Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of PLN mRNA CTD PMID:26577399 and PMID:27523638 Pln Rat cycloheximide multiple interactions ISO PLN (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of PLN mRNA] CTD PMID:11007951 Pln Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of PLN mRNA CTD PMID:23914054 Pln Rat dibromine decreases phosphorylation EXP 6480464 Bromine results in decreased phosphorylation of PLN protein CTD PMID:32979061 Pln Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PLN mRNA CTD PMID:21266533 Pln Rat diethyldithiocarbamic acid increases phosphorylation EXP 6480464 Ditiocarb results in increased phosphorylation of PLN protein CTD PMID:16288776 Pln Rat diethyldithiocarbamic acid multiple interactions EXP 6480464 1 more ... CTD PMID:16288776 Pln Rat dioxygen increases expression ISO Pln (Mus musculus) 6480464 Oxygen results in increased expression of PLN protein CTD PMID:30529165 Pln Rat dioxygen multiple interactions ISO Pln (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PLN mRNA more ... CTD PMID:30529165 Pln Rat diuron increases expression EXP 6480464 Diuron results in increased expression of PLN mRNA CTD PMID:21551480 Pln Rat dobutamine affects response to substance ISO PLN (Homo sapiens) 6480464 PLN protein affects the susceptibility to Dobutamine CTD PMID:14991071 Pln Rat doxorubicin decreases expression ISO Pln (Mus musculus) 6480464 Doxorubicin results in decreased expression of PLN mRNA CTD PMID:16243910 Pln Rat doxorubicin decreases expression ISO PLN (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PLN mRNA CTD PMID:29803840 Pln Rat doxorubicin affects expression ISO PLN (Homo sapiens) 6480464 Doxorubicin affects the expression of PLN protein CTD PMID:29385562 Pln Rat doxorubicin multiple interactions EXP 6480464 N-benzyladriamycin-14-valerate inhibits the reaction [Doxorubicin results in increased phosphorylation of PLN protein] CTD PMID:20668052 Pln Rat doxorubicin increases phosphorylation EXP 6480464 Doxorubicin results in increased phosphorylation of PLN protein CTD PMID:20668052 Pln Rat Echimidine decreases expression EXP 6480464 echimidine results in decreased expression of PLN mRNA CTD PMID:34185104 Pln Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PLN mRNA CTD PMID:29391264 Pln Rat ethanol multiple interactions ISO Pln (Mus musculus) 6480464 Ethanol results in increased expression of and results in decreased phosphorylation of PLN protein more ... CTD PMID:23448468 and PMID:34864093 Pln Rat ethanol decreases phosphorylation ISO Pln (Mus musculus) 6480464 Ethanol results in decreased phosphorylation of PLN protein CTD PMID:34864093 Pln Rat ferrostatin-1 multiple interactions ISO Pln (Mus musculus) 6480464 ferrostatin-1 inhibits the reaction [Ethanol results in decreased phosphorylation of PLN protein] CTD PMID:34864093 Pln Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of PLN mRNA CTD PMID:18035473 Pln Rat harmine increases expression EXP 11097969 harmine increases expression of Pln protein after myocardial infarction in rat heart left ventricle RGD Pln Rat Heliotrine decreases expression EXP 6480464 heliotrine results in decreased expression of PLN mRNA CTD PMID:34185104 Pln Rat isoprenaline multiple interactions EXP 6480464 astragaloside A inhibits the reaction [Isoproterenol results in decreased phosphorylation of PLN protein] more ... CTD PMID:10997724 more ... Pln Rat isoprenaline decreases phosphorylation EXP 6480464 Isoproterenol results in decreased phosphorylation of PLN protein CTD PMID:16723803 and PMID:17509559 Pln Rat isoprenaline increases phosphorylation EXP 6480464 Isoproterenol results in increased phosphorylation of PLN protein CTD PMID:21268078 Pln Rat L-ascorbic acid multiple interactions ISO PLN (Homo sapiens) 6480464 [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of PLN mRNA CTD PMID:34480604 Pln Rat L-ascorbic acid 2-phosphate multiple interactions ISO PLN (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of PLN mRNA CTD PMID:34480604 Pln Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of PLN mRNA CTD PMID:22641619 Pln Rat lidocaine decreases expression EXP 6480464 Lidocaine results in decreased expression of PLN mRNA CTD PMID:35283115 Pln Rat manganese atom decreases expression ISO PLN (Homo sapiens) 6480464 Manganese results in decreased expression of PLN mRNA CTD PMID:17175027 Pln Rat manganese(0) decreases expression ISO PLN (Homo sapiens) 6480464 Manganese results in decreased expression of PLN mRNA CTD PMID:17175027 Pln Rat manganese(II) chloride decreases expression ISO PLN (Homo sapiens) 6480464 manganese chloride results in decreased expression of PLN mRNA CTD PMID:17175027 Pln Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of PLN mRNA CTD PMID:28801915 Pln Rat mercury dichloride decreases phosphorylation EXP 6480464 Mercuric Chloride results in decreased phosphorylation of PLN protein CTD PMID:21723307 Pln Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of PLN protein CTD PMID:21723307 Pln Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of PLN mRNA CTD PMID:30467583 Pln Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PLN mRNA CTD PMID:30047161 Pln Rat methotrexate affects expression ISO Pln (Mus musculus) 6480464 Methotrexate affects the expression of PLN mRNA CTD PMID:18502557 Pln Rat mifepristone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Progesterone inhibits the reaction [bisphenol A results in increased phosphorylation of PLN protein]] and Mifepristone inhibits the reaction [progesterone-11-bovine serum albumin inhibits the reaction [bisphenol A results in increased phosphorylation of PLN protein]] CTD PMID:28324061 Pln Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide decreases phosphorylation EXP 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide results in decreased phosphorylation of PLN protein CTD PMID:27495954 Pln Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO Pln (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of PLN mRNA CTD PMID:25566086 Pln Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PLN mRNA CTD PMID:28801915 Pln Rat nickel atom decreases expression ISO PLN (Homo sapiens) 6480464 Nickel results in decreased expression of PLN mRNA CTD PMID:24768652 and PMID:25583101 Pln Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of PLN mRNA CTD PMID:33484710 Pln Rat okadaic acid decreases expression ISO PLN (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of PLN mRNA CTD PMID:38832940 Pln Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of PLN mRNA CTD PMID:25729387 Pln Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PLN mRNA CTD PMID:25729387 Pln Rat ozone increases phosphorylation EXP 6480464 Ozone results in increased phosphorylation of PLN protein CTD PMID:33146391 Pln Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PLN mRNA CTD PMID:32680482 Pln Rat PCB138 multiple interactions ISO Pln (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pln Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of PLN mRNA CTD PMID:35163327 Pln Rat pioglitazone multiple interactions ISO Pln (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of PLN mRNA CTD PMID:27935865 Pln Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of PLN mRNA CTD PMID:16376865 Pln Rat progesterone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Progesterone inhibits the reaction [bisphenol A results in increased phosphorylation of PLN protein]] more ... CTD PMID:28324061 Pln Rat propofol decreases phosphorylation EXP 6480464 Propofol results in decreased phosphorylation of PLN protein CTD PMID:27495954 Pln Rat propranolol multiple interactions EXP 6480464 Propranolol inhibits the reaction [Isoproterenol results in decreased expression of and results in decreased phosphorylation of PLN protein] CTD PMID:10997724 Pln Rat psilocin increases phosphorylation ISO PLN (Homo sapiens) 6480464 psilocin results in increased phosphorylation of PLN protein CTD PMID:38876450 Pln Rat psilocin multiple interactions ISO PLN (Homo sapiens) 6480464 [HTR4 protein results in increased susceptibility to psilocin] which results in increased phosphorylation of PLN protein CTD PMID:38876450 Pln Rat psilocybin multiple interactions ISO PLN (Homo sapiens) 6480464 [HTR4 protein results in increased susceptibility to Psilocybin] which results in increased phosphorylation of PLN protein CTD PMID:38876450 Pln Rat resveratrol decreases expression ISO Pln (Mus musculus) 6480464 resveratrol results in decreased expression of PLN mRNA CTD PMID:22610192 Pln Rat resveratrol increases phosphorylation EXP 6480464 resveratrol results in increased phosphorylation of PLN protein CTD PMID:25425099 Pln Rat sarpogrelate affects expression EXP 6480464 sarpogrelate affects the expression of PLN mRNA and sarpogrelate affects the expression of PLN protein CTD PMID:18088389 Pln Rat SB 431542 multiple interactions ISO PLN (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with EGF protein co-treated with FGF2 protein] results in decreased expression of PLN mRNA CTD PMID:34480604 Pln Rat senecionine decreases expression EXP 6480464 senecionine results in decreased expression of PLN mRNA CTD PMID:34185104 Pln Rat sodium arsenite decreases expression ISO Pln (Mus musculus) 6480464 sodium arsenite results in decreased expression of PLN mRNA CTD PMID:37682722 Pln Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of PLN mRNA and Streptozocin results in decreased expression of PLN protein CTD PMID:19000375 Pln Rat streptozocin multiple interactions EXP 6480464 Triterpenes inhibits the reaction [Streptozocin results in decreased expression of PLN mRNA] and Triterpenes inhibits the reaction [Streptozocin results in decreased expression of PLN protein] CTD PMID:19000375 Pln Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of PLN mRNA CTD PMID:30047161 Pln Rat sulforaphane increases expression ISO Pln (Mus musculus) 6480464 sulforaphane results in increased expression of PLN mRNA and sulforaphane results in increased expression of PLN protein CTD PMID:30529165 Pln Rat sulforaphane multiple interactions ISO Pln (Mus musculus) 6480464 NFE2L2 protein affects the reaction [sulforaphane promotes the reaction [Oxygen results in increased expression of PLN protein]] more ... CTD PMID:30529165 Pln Rat tamoxifen decreases expression ISO Pln (Mus musculus) 6480464 Tamoxifen results in decreased expression of PLN mRNA CTD PMID:17555576 Pln Rat tauroursodeoxycholic acid multiple interactions ISO Pln (Mus musculus) 6480464 ursodoxicoltaurine inhibits the reaction [LEP protein mutant form results in decreased expression of PLN protein] CTD PMID:38906502 Pln Rat tebuconazole increases expression EXP 6480464 tebuconazole results in increased expression of PLN mRNA CTD PMID:33049508 Pln Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PLN mRNA CTD PMID:23411599 and PMID:34492290 Pln Rat Tiron multiple interactions EXP 6480464 1 more ... CTD PMID:16288776 Pln Rat titanium dioxide decreases expression ISO Pln (Mus musculus) 6480464 titanium dioxide results in decreased expression of PLN mRNA CTD PMID:23557971 Pln Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of PLN mRNA CTD PMID:25729387 Pln Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PLN mRNA CTD PMID:25729387 Pln Rat trichloroethene increases expression ISO PLN (Homo sapiens) 6480464 Trichloroethylene results in increased expression of PLN mRNA CTD PMID:25847060 Pln Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PLN mRNA CTD PMID:33387578 Pln Rat triclosan decreases expression ISO PLN (Homo sapiens) 6480464 Triclosan results in decreased expression of PLN mRNA CTD PMID:30510588 Pln Rat valproic acid affects expression ISO Pln (Mus musculus) 6480464 Valproic Acid affects the expression of PLN mRNA CTD PMID:17292431 Pln Rat valproic acid affects expression ISO PLN (Homo sapiens) 6480464 Valproic Acid affects the expression of PLN mRNA CTD PMID:25979313 Pln Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of PLN mRNA CTD PMID:23034163 Pln Rat wortmannin multiple interactions EXP 6480464 wortmannin inhibits the reaction [Progesterone inhibits the reaction [bisphenol A results in increased phosphorylation of PLN protein]] CTD PMID:28324061 Pln Rat XAV939 multiple interactions ISO PLN (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of PLN mRNA and [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of PLN mRNA CTD PMID:34480604
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (EXP) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dimethylhydrazine (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aconitine (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) anthracen-2-amine (EXP) arotinoid acid (ISO) astragaloside IV (EXP) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) candesartan (EXP) cantharidin (ISO) CHIR 99021 (ISO) cilostazol (EXP) cisplatin (EXP) copper atom (EXP) copper(0) (EXP) cortisol (ISO) Cuprizon (EXP) cycloheximide (ISO) decabromodiphenyl ether (EXP) dibromine (EXP) dibutyl phthalate (EXP) diethyldithiocarbamic acid (EXP) dioxygen (ISO) diuron (EXP) dobutamine (ISO) doxorubicin (EXP,ISO) Echimidine (EXP) endosulfan (EXP) ethanol (ISO) ferrostatin-1 (ISO) flavonoids (EXP) harmine (EXP) Heliotrine (EXP) isoprenaline (EXP) L-ascorbic acid (ISO) L-ascorbic acid 2-phosphate (ISO) lead diacetate (EXP) lidocaine (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (EXP,ISO) mercury dichloride (EXP) methapyrilene (EXP) methimazole (EXP) methotrexate (ISO) mifepristone (EXP) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-4-phenylpyridinium (EXP) nickel atom (ISO) nitrofen (EXP) okadaic acid (ISO) oxaliplatin (EXP) ozone (EXP) paraquat (EXP) PCB138 (ISO) perfluorooctanoic acid (EXP) pioglitazone (ISO) progesterone (EXP) propofol (EXP) propranolol (EXP) psilocin (ISO) psilocybin (ISO) resveratrol (EXP,ISO) sarpogrelate (EXP) SB 431542 (ISO) senecionine (EXP) sodium arsenite (ISO) streptozocin (EXP) sulfadimethoxine (EXP) sulforaphane (ISO) tamoxifen (ISO) tauroursodeoxycholic acid (ISO) tebuconazole (EXP) thioacetamide (EXP) Tiron (EXP) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP,ISO) triclosan (ISO) valproic acid (ISO) vinclozolin (EXP) wortmannin (EXP) XAV939 (ISO)
Biological Process
acrosome assembly (IEA,ISO,ISS) adenylate cyclase-activating adrenergic receptor signaling pathway involved in heart process (IEA,ISO) calcium ion transport (IMP,NAS) cardiac muscle tissue development (IEA,ISO) circadian sleep/wake cycle, sleep (IEA,ISO,ISS) heart process (ISO) intracellular calcium ion homeostasis (IEA,ISO,ISS) locomotor rhythm (IEA,ISO,ISS) muscle cell cellular homeostasis (IEA,ISO) negative regulation of ATPase-coupled calcium transmembrane transporter activity (ISO,ISS) negative regulation of calcium ion import into sarcoplasmic reticulum (IBA,IEA,ISO,ISS) negative regulation of calcium ion transport (IEA,ISO) negative regulation of heart contraction (IEA,ISO) negative regulation of heart rate (IBA,IEA,ISO) Notch signaling pathway (IEA,ISO) regulation of ATPase-coupled calcium transmembrane transporter activity (ISO) regulation of calcium ion import (IEA,ISO) regulation of calcium ion transport (IEA,ISO,ISS) regulation of cardiac muscle cell contraction (IEA,ISO) regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion (IEA,ISO) regulation of cytosolic calcium ion concentration (ISO) regulation of heart contraction (IEA,ISO) regulation of relaxation of muscle (IEA,ISO) regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum (IEA,ISO) regulation of ryanodine-sensitive calcium-release channel activity (ISO) regulation of the force of heart contraction (IEA,ISO) regulation of the force of heart contraction by cardiac conduction (IEA,ISO) response to insulin (IEP) response to testosterone (IDA) response to zinc ion (IDA) spermatogenesis (IEA,ISO) visual learning (IEA,ISO,ISS)
Cellular Component
calcium ion-transporting ATPase complex (IEA,ISO) endoplasmic reticulum (IEA) endoplasmic reticulum membrane (IEA,ISO,ISS) membrane (IBA,IEA,ISO) mitochondrial membrane (IEA) mitochondrion (IEA) phospholamban complex (IEA,ISO) protein-containing complex (IDA) sarcoplasmic reticulum (IBA,IDA,IEA,ISO) sarcoplasmic reticulum membrane (IEA,ISO,ISS) vesicle (IDA)
1.
Reversal of subcellular remodelling by losartan in heart failure due to myocardial infarction.
Babick A, etal., J Cell Mol Med. 2012 Dec;16(12):2958-67. doi: 10.1111/j.1582-4934.2012.01623.x.
2.
Luteolin inhibits apoptosis and improves cardiomyocyte contractile function through the PI3K/Akt pathway in simulated ischemia/reperfusion.
Fang F, etal., Pharmacology. 2011;88(3-4):149-58. doi: 10.1159/000330068. Epub 2011 Sep 16.
3.
[Diaphragm dysfunction and expressions of calcium regulatory proteins in diabetic rats].
Fang Y, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2013 Feb;33(2):177-81.
4.
Comparable levels of Ca-ATPase inhibition by phospholamban in slow-twitch skeletal and cardiac sarcoplasmic reticulum.
Ferrington DA, etal., Biochemistry 2002 Nov 5;41(44):13289-96.
5.
Increased myocardial SERCA expression in early type 2 diabetes mellitus is insulin dependent: In vivo and in vitro data.
Fredersdorf S, etal., Cardiovasc Diabetol. 2012 May 23;11:57.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
A mutation in the human phospholamban gene, deleting arginine 14, results in lethal, hereditary cardiomyopathy.
Haghighi K, etal., Proc Natl Acad Sci U S A. 2006 Jan 31;103(5):1388-93. Epub 2006 Jan 23.
8.
Involvement of the dual-specificity tyrosine phosphorylation-regulated kinase 1A-alternative splicing factor-calcium/calmodulin-dependent protein kinase IIdelta signaling pathway in myocardial infarction-induced heart failure of rats.
He J, etal., J Card Fail. 2015 Sep;21(9):751-60. doi: 10.1016/j.cardfail.2015.05.015. Epub 2015 Jun 9.
9.
Cloning phospholamban cDNA from rat aortic smooth muscle.
Hwang KS and Nadal-Ginard B, Adv Exp Med Biol 1991;304:387-95.
10.
Identification of a highly conserved region at the 5' flank of the phospholamban gene.
Johns DC and Feldman AM, Biochem Biophys Res Commun 1992 Oct 30;188(2):927-33.
11.
Abnormal amounts of intracellular calcium regulatory proteins in SHRSP.Z-Lepr(fa)/IzmDmcr rats with metabolic syndrome and cardiac dysfunction.
Kagota S, etal., Can J Physiol Pharmacol. 2013 Feb;91(2):124-33. doi: 10.1139/cjpp-2012-0226. Epub 2013 Feb 15.
12.
Combined insulin treatment and intense exercise training improved basal cardiac function and Ca(2+)-cycling proteins expression in type 1 diabetic rats.
Le Douairon Lahaye S, etal., Appl Physiol Nutr Metab. 2012 Feb;37(1):53-62. doi: 10.1139/h11-127. Epub 2011 Dec 20.
13.
Abnormal intracellular calcium homeostasis in sympathetic neurons from young prehypertensive rats.
Li D, etal., Hypertension. 2012 Mar;59(3):642-9. doi: 10.1161/HYPERTENSIONAHA.111.186460. Epub 2012 Jan 17.
14.
AKAP complex regulates Ca2+ re-uptake into heart sarcoplasmic reticulum.
Lygren B, etal., EMBO Rep. 2007 Nov;8(11):1061-7. Epub 2007 Sep 28.
15.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
16.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
17.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
18.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
19.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
20.
Rosuvastatin-attenuated heart failure in aged spontaneously hypertensive rats via PKCalpha/beta2 signal pathway.
Qiu Z, etal., J Cell Mol Med. 2012 Dec;16(12):3052-61. doi: 10.1111/j.1582-4934.2012.01632.x.
21.
GOA pipeline
RGD automated data pipeline
22.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
23.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
24.
New therapeutic targets in cardiology: arrhythmias and Ca2+/calmodulin-dependent kinase II (CaMKII).
Rokita AG and Anderson ME, Circulation. 2012 Oct 23;126(17):2125-39. doi: 10.1161/CIRCULATIONAHA.112.124990.
25.
Isolation of gene markers of differentiated and proliferating vascular smooth muscle cells.
Shanahan CM, etal., Circ Res 1993 Jul;73(1):193-204.
26.
Differential regulation of SR calcium transporters by thyroid hormone in rat atria and ventricles.
Shenoy R, etal., Am J Physiol Heart Circ Physiol 2001 Oct;281(4):H1690-6.
27.
Time course and mechanisms of phosphorylation of phospholamban residues in ischemia-reperfused rat hearts. Dissociation of phospholamban phosphorylation pathways.
Vittone L, etal., J Mol Cell Cardiol 2002 Jan;34(1):39-50.
28.
Testosterone regulates cardiac contractile activation by modulating SERCA but not NCX activity.
Witayavanitkul N, etal., Am J Physiol Heart Circ Physiol. 2013 Feb 1;304(3):H465-72. doi: 10.1152/ajpheart.00555.2012. Epub 2012 Nov 30.
29.
Altered phospholamban-calcium ATPase interaction in cardiac sarcoplasmic reticulum during the progression of sepsis.
Wu LL, etal., Shock 2002 May;17(5):389-93.
30.
Wenxin-Keli Regulates the Calcium/Calmodulin-Dependent Protein Kinase II Signal Transduction Pathway and Inhibits Cardiac Arrhythmia in Rats with Myocardial Infarction.
Xing Y, etal., Evid Based Complement Alternat Med. 2013;2013:464508. doi: 10.1155/2013/464508. Epub 2013 May 28.
31.
Identifying cellular mechanisms of zinc-induced relaxation in isolated cardiomyocytes.
Yi T, etal., Am J Physiol Heart Circ Physiol. 2013 Sep;305(5):H706-15. doi: 10.1152/ajpheart.00025.2013. Epub 2013 Jun 28.
Pln Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 33,166,512 - 33,182,241 (+) NCBI GRCr8 mRatBN7.2 20 32,629,537 - 32,639,559 (+) NCBI mRatBN7.2 mRatBN7.2 UTH_Rnor_SHR_Utx 20 33,643,487 - 33,653,241 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 33,034,203 - 33,043,957 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 33,768,368 - 33,778,120 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 34,633,157 - 34,642,904 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 34,633,157 - 34,642,904 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 36,390,879 - 36,400,626 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 32,000,371 - 32,008,559 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 32,014,170 - 32,022,359 (+) NCBI Celera 20 34,009,102 - 34,018,849 (+) NCBI Celera Cytogenetic Map 20 q11 NCBI
PLN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 118,548,296 - 118,561,716 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 118,548,296 - 118,561,716 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 118,869,459 - 118,882,879 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 118,976,165 - 118,988,280 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 118,976,164 - 118,988,279 NCBI Celera 6 119,612,768 - 119,624,905 (+) NCBI Celera Cytogenetic Map 6 q22.31 NCBI HuRef 6 116,451,106 - 116,463,257 (+) NCBI HuRef CHM1_1 6 119,133,487 - 119,145,628 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 119,733,450 - 119,746,868 (+) NCBI T2T-CHM13v2.0
Pln Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 53,213,782 - 53,222,095 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 53,213,763 - 53,222,083 (+) Ensembl GRCm39 Ensembl GRCm38 10 53,337,686 - 53,345,999 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 53,337,667 - 53,345,987 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 53,057,492 - 53,065,805 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 53,026,122 - 53,034,396 (+) NCBI MGSCv36 mm8 Celera 10 54,164,488 - 54,172,801 (+) NCBI Celera Cytogenetic Map 10 B3 NCBI cM Map 10 27.11 NCBI
Pln Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955436 1,439,098 - 1,447,070 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955436 1,439,098 - 1,447,070 (+) NCBI ChiLan1.0 ChiLan1.0
PLN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 138,552,963 - 138,575,943 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 136,456,523 - 136,469,893 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 116,357,335 - 116,370,382 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 120,498,943 - 120,511,969 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 120,509,510 - 120,509,668 (+) Ensembl panpan1.1 panPan2
PLN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 58,579,095 - 58,590,541 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 58,579,145 - 58,590,535 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 59,381,980 - 59,393,371 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 58,763,549 - 58,775,010 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 58,763,595 - 58,775,006 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 58,664,392 - 58,675,778 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 58,505,736 - 58,517,122 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 59,137,737 - 59,149,128 (+) NCBI UU_Cfam_GSD_1.0
Pln Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 109,336,904 - 109,346,907 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936658 1,443,795 - 1,453,839 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936658 1,443,626 - 1,453,770 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PLN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 43,449,354 - 43,458,925 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 43,449,354 - 43,458,925 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 48,678,936 - 48,688,510 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PLN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 55,316,962 - 55,332,502 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 55,318,326 - 55,318,481 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 27,627,687 - 27,641,160 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pln
.
Predicted Target Of
Count of predictions: 34 Count of miRNA genes: 34 Interacting mature miRNAs: 34 Transcripts: ENSRNOT00000000469 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
4889610 Pancm3 Pancreatic morphology QTL 3 3.75 0.001 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 20 17617832 47606836 Rat 2303587 Bw93 Body weight QTL 93 13 body mass (VT:0001259) body weight (CMO:0000012) 20 25106722 54435887 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 2303626 Vencon10 Ventilatory control QTL 10 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 20 19190721 54435887 Rat 1598869 Memor6 Memory QTL 6 3.1 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 20 29244388 54435887 Rat 70158 Bp60 Blood pressure QTL 60 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 31614284 44396023 Rat 7411652 Foco24 Food consumption QTL 24 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 11757515 54435887 Rat 1331747 Hrtrt16 Heart rate QTL 16 3.163 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 20 25209734 54435887 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 2303578 Gluco50 Glucose level QTL 50 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 20 25106722 54435887 Rat 2317880 Alcrsp25 Alcohol response QTL 25 2.3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 17697550 54435887 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat 9590092 Insglur9 Insulin/glucose ratio QTL 9 18.38 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 20 11757515 54435887 Rat 2300188 Bmd68 Bone mineral density QTL 68 6.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 20 25106722 54435887 Rat
RH133632
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 32,637,611 - 32,637,811 (+) MAPPER mRatBN7.2 Rnor_6.0 20 34,640,957 - 34,641,156 NCBI Rnor6.0 Rnor_5.0 20 36,398,679 - 36,398,878 UniSTS Rnor5.0 RGSC_v3.4 20 32,008,164 - 32,008,363 UniSTS RGSC3.4 Celera 20 34,016,902 - 34,017,101 UniSTS RH 3.4 Map 20 332.11 UniSTS Cytogenetic Map 20 q11 UniSTS
RH140536
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 32,637,624 - 32,637,868 (+) MAPPER mRatBN7.2 Rnor_6.0 20 34,640,970 - 34,641,213 NCBI Rnor6.0 Rnor_5.0 20 36,398,692 - 36,398,935 UniSTS Rnor5.0 RGSC_v3.4 20 32,008,177 - 32,008,420 UniSTS RGSC3.4 Celera 20 34,016,915 - 34,017,158 UniSTS RH 3.4 Map 20 332.63 UniSTS Cytogenetic Map 20 q11 UniSTS
BE100029
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 32,631,348 - 32,631,498 (+) MAPPER mRatBN7.2 Rnor_6.0 20 34,634,695 - 34,634,844 NCBI Rnor6.0 Rnor_5.0 20 36,392,417 - 36,392,566 UniSTS Rnor5.0 RGSC_v3.4 20 32,001,902 - 32,002,051 UniSTS RGSC3.4 Celera 20 34,010,640 - 34,010,789 UniSTS RH 3.4 Map 20 332.52 UniSTS Cytogenetic Map 20 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
84
91
90
59
25
59
6
217
97
64
44
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000000469 ⟹ ENSRNOP00000000469
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 34,633,157 - 34,642,904 (+) Ensembl
RefSeq Acc Id:
NM_022707 ⟹ NP_073198
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 33,172,494 - 33,182,241 (+) NCBI mRatBN7.2 20 32,629,811 - 32,639,559 (+) NCBI Rnor_6.0 20 34,633,157 - 34,642,904 (+) NCBI Rnor_5.0 20 36,390,879 - 36,400,626 (+) NCBI RGSC_v3.4 20 32,000,371 - 32,008,559 (+) RGD Celera 20 34,009,102 - 34,018,849 (+) NCBI
Sequence:
AAAGCTGCGCAGCTGAGCTCCCAGACTTCACACAACTAAACAGTCTGCATTGTGACGATCACAGAAGCCAAGGCCTCCTAAAAGGAGACAGCTCGCGTTTGGCTGCCTGCTGTCAACTTTTTATCTTT
hide sequence
RefSeq Acc Id:
XM_039099053 ⟹ XP_038954981
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 33,166,512 - 33,181,883 (+) NCBI mRatBN7.2 20 32,629,537 - 32,639,198 (+) NCBI
RefSeq Acc Id:
NP_073198 ⟸ NM_022707
- UniProtKB:
P61016 (UniProtKB/Swiss-Prot), A6K492 (UniProtKB/TrEMBL)
- Sequence:
MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
hide sequence
Ensembl Acc Id:
ENSRNOP00000000469 ⟸ ENSRNOT00000000469
RefSeq Acc Id:
XP_038954981 ⟸ XM_039099053
- Peptide Label:
isoform X1
- UniProtKB:
P61016 (UniProtKB/Swiss-Prot), A6K492 (UniProtKB/TrEMBL)
RGD ID: 13701626 Promoter ID: EPDNEW_R12150 Type: initiation region Name: Pln_1 Description: phospholamban SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 34,633,171 - 34,633,231 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Pln
phospholamban
Plm
Symbol updated
1299863 APPROVED
2002-08-07
Plm
phospholamban
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in heart atria and ventricles
631306
gene_process
may regulate function of Atp2a2, a cardiac muscle, Ca++ transporting, slow twitch ATPase 2
631306
