Akap7 (A-kinase anchoring protein 7)

Advanced Search (OLGA)

Gene: Akap7 (A-kinase anchoring protein 7) Rattus norvegicus

Analyze

Symbol:

Akap7

Name:

A-kinase anchoring protein 7

RGD ID:

1303071

Description:

Enables AMP binding activity; protein domain specific binding activity; and protein kinase A regulatory subunit binding activity. Involved in cAMP/PKA signal transduction. Located in several cellular components, including T-tubule; exocytic vesicle; and sarcoplasmic reticulum. Part of protein-containing complex. Orthologous to human AKAP7 (A-kinase anchoring protein 7); PARTICIPATES IN protein kinase A (PKA) signaling pathway; vasopressin signaling pathway; vasopressin signaling pathway via receptor type 2; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

A kinase (PRKA) anchor protein 7; A-kinase anchor protein 18; A-kinase anchor protein 7 isoforms delta and gamma; A-kinase anchoring protein 18; A-kinase anchoring protein 18 ,isoform delta; AKAP-18; AKAP-7 isoforms delta and gamma; Akap15; AKAP18; AKAP18d; MGC112559; PRKA7 isoforms delta and gamma; protein kinase A-anchoring protein 7 isoforms delta and gamma

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AKAP7 (A-kinase anchoring protein 7)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Akap7 (A kinase anchor protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Akap7 (A-kinase anchoring protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AKAP7 (A-kinase anchoring protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AKAP7 (A-kinase anchoring protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Akap7 (A-kinase anchoring protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AKAP7 (A-kinase anchoring protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AKAP7 (A-kinase anchoring protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Akap7 (A-kinase anchoring protein 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	AKAP7 (A-kinase anchoring protein 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Akap7 (A kinase anchor protein 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	akap7 (A kinase (PRKA) anchor protein 7)	Alliance	DIOPT (OrthoFinder\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	akap7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	21,906,503 - 22,168,663 (+)	NCBI		GRCr8
mRatBN7.2	1	20,087,190 - 20,217,799 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	20,087,373 - 20,217,797 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	19,864,239 - 19,992,689 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	25,857,412 - 25,985,488 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	20,064,071 - 20,192,538 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	21,129,213 - 21,263,850 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	21,141,970 - 21,263,850 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	22,621,908 - 22,742,822 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	20,573,215 - 20,704,564 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	20,573,194 - 20,706,460 (+)	NCBI
Celera	1	18,857,712 - 18,969,798 (+)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

substance-related disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chrysene (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

endosulfan (EXP)

fenvalerate (EXP)

folic acid (ISO)

fulvestrant (ISO)

genistein (EXP)

gentamycin (EXP)

hydrogen peroxide (ISO)

lead diacetate (ISO)

lovastatin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methimazole (EXP)

methotrexate (ISO)

methylmercury chloride (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (EXP)

pirinixic acid (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

tetrachloroethene (ISO)

tetraphene (ISO)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cAMP/PKA signal transduction (IMP)

cellular response to cAMP (ISO)

modulation of chemical synaptic transmission (ISO)

positive regulation of delayed rectifier potassium channel activity (ISO)

positive regulation of potassium ion transmembrane transport (ISO)

regulation of membrane repolarization (ISO)

regulation of protein kinase A signaling (IBA)

Cellular Component

apical plasma membrane (IDA,ISO)

cytosol (IBA,ISO)

exocytic vesicle (IDA)

hippocampal mossy fiber to CA3 synapse (ISO)

lateral plasma membrane (ISO)

nucleus (ISO)

protein-containing complex (IDA,ISO)

sarcoplasmic reticulum (IDA)

T-tubule (IDA)

Molecular Function

AMP binding (IDA)

protein binding (IPI,ISO)

protein domain specific binding (IPI)

protein kinase A binding (ISO,TAS)

protein kinase A regulatory subunit binding (IBA,IDA)

protein kinase binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

protein kinase A (PKA) signaling pathway (IMP,ISO)

vasopressin signaling pathway (IDA,ISO)

vasopressin signaling pathway via receptor type 2 (IDA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Physiology and pathophysiology of the vasopressin-regulated renal water reabsorption.	Boone M and Deen PM, Pflugers Arch. 2008 Sep;456(6):1005-24. Epub 2008 Apr 23.
2.	A-kinase anchoring proteins: from protein complexes to physiology and disease.	Carnegie GK, etal., IUBMB Life. 2009 Apr;61(4):394-406.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	AKAP18 contains a phosphoesterase domain that binds AMP.	Gold MG, etal., J Mol Biol. 2008 Feb 1;375(5):1329-43. Epub 2007 Nov 22.
5.	Identification of a novel A-kinase anchoring protein 18 isoform and evidence for its role in the vasopressin-induced aquaporin-2 shuttle in renal principal cells.	Henn V, etal., J Biol Chem 2004 Jun 18;279(25):26654-65. Epub 2004 Mar 22.
6.	Beta-adrenergic regulation requires direct anchoring of PKA to cardiac CaV1.2 channels via a leucine zipper interaction with A kinase-anchoring protein 15.	Hulme JT, etal., Proc Natl Acad Sci U S A 2003 Oct 28;100(22):13093-8. Epub 2003 Oct 20.
7.	AKAP complex regulates Ca2+ re-uptake into heart sarcoplasmic reticulum.	Lygren B, etal., EMBO Rep. 2007 Nov;8(11):1061-7. Epub 2007 Sep 28.
8.	Phosphorylation of the cAMP-dependent protein kinase (PKA) regulatory subunit modulates PKA-AKAP interaction, substrate phosphorylation, and calcium signaling in cardiac cells.	Manni S, etal., J Biol Chem. 2008 Aug 29;283(35):24145-54. Epub 2008 Jun 12.
9.	Spatial organisation of AKAP18 and PDE4 isoforms in renal collecting duct principal cells.	McSorley T, etal., Eur J Cell Biol. 2006 Jul;85(7):673-8. Epub 2006 Feb 28.
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Localized effects of cAMP mediated by distinct routes of protein kinase A.	Tasken K and Aandahl EM, Physiol Rev. 2004 Jan;84(1):137-67.

Additional References at PubMed

PMID:9545239	PMID:10613906	PMID:11299204	PMID:12477932	PMID:12804576	PMID:19896945	PMID:25002582	PMID:25097019	PMID:26027516	PMID:27911261	PMID:28331977	PMID:34814703

Genomics

Comparative Map Data

Akap7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	21,906,503 - 22,168,663 (+)	NCBI		GRCr8
mRatBN7.2	1	20,087,190 - 20,217,799 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	20,087,373 - 20,217,797 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	19,864,239 - 19,992,689 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	25,857,412 - 25,985,488 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	20,064,071 - 20,192,538 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	21,129,213 - 21,263,850 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	21,141,970 - 21,263,850 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	22,621,908 - 22,742,822 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	20,573,215 - 20,704,564 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	20,573,194 - 20,706,460 (+)	NCBI
Celera	1	18,857,712 - 18,969,798 (+)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

AKAP7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	131,125,627 - 131,283,532 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	131,135,467 - 131,283,535 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	131,456,607 - 131,604,672 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	131,508,154 - 131,646,366 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	131,613,196 - 131,646,366	NCBI
Celera	6	132,213,109 - 132,351,308 (+)	NCBI		Celera
Cytogenetic Map	6	q23.2	NCBI
HuRef	6	129,038,098 - 129,185,928 (+)	NCBI		HuRef
CHM1_1	6	131,720,231 - 131,868,081 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	132,320,223 - 132,477,983 (+)	NCBI		T2T-CHM13v2.0

Akap7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	25,044,988 - 25,175,115 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	25,044,988 - 25,183,768 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	25,169,090 - 25,299,217 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	25,169,090 - 25,307,870 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	24,888,896 - 25,018,969 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	24,859,538 - 24,988,579 (-)	NCBI		MGSCv36	mm8
Celera	10	26,111,351 - 26,240,604 (-)	NCBI		Celera
Cytogenetic Map	10	A4	NCBI
cM Map	10	12.26	NCBI

Akap7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955436	11,884,433 - 12,004,013 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955436	11,883,840 - 12,002,668 (+)	NCBI	ChiLan1.0	ChiLan1.0

AKAP7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	151,140,808 - 151,289,973 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	149,049,175 - 149,196,706 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	128,936,583 - 129,084,018 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	133,043,403 - 133,190,745 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	133,043,403 - 133,190,745 (+)	Ensembl	panpan1.1		panPan2

AKAP7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	69,360,664 - 69,483,102 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	69,360,781 - 69,483,113 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	70,103,473 - 70,230,654 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	69,581,946 - 69,709,298 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	69,581,961 - 69,709,309 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	69,500,153 - 69,627,658 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	69,272,793 - 69,400,276 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	69,932,193 - 70,059,519 (+)	NCBI		UU_Cfam_GSD_1.0

Akap7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	119,623,429 - 119,740,215 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936790	223,218 - 339,713 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936790	223,080 - 339,078 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AKAP7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	32,221,066 - 32,362,149 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	32,221,061 - 32,362,153 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	35,795,817 - 35,828,693 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AKAP7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	42,270,160 - 42,418,728 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666040	14,418,317 - 14,563,356 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Akap7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624753	5,303,234 - 5,436,636 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624753	5,297,268 - 5,436,631 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Akap7
1162 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	482
Count of miRNA genes:	252
Interacting mature miRNAs:	305
Transcripts:	ENSRNOT00000017617
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578650	Bmd6	Bone mineral density QTL 6	12.2		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	1	509108	43284926	Rat
1354647	Despr8	Despair related QTL 8		0.0000341	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	1	24744506	Rat
1578651	Bmd7	Bone mineral density QTL 7	14.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	1	509108	43284926	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
2313070	Bss52	Bone structure and strength QTL 52	4.4	0.0001	body length (VT:0001256)	body length (CMO:0000013)	1	1	32356093	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	16206210	49268520	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	15431621	49361612	Rat
2298546	Neuinf4	Neuroinflammation QTL 4	5.1		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	1	1	28736750	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	7e-07	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	15431621	49361612	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2317755	Glom22	Glomerulus QTL 22	3.8		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	11481482	32355910	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
2313090	Bmd69	Bone mineral density QTL 69	4.4	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	1	32356093	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	5925877	24697545	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	2244390	43433040	Rat
1578669	Bss9	Bone structure and strength QTL 9	6.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	1	509108	43284926	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	19333571	56983283	Rat
2313053	Bss51	Bone structure and strength QTL 51	3.8	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	1	32356093	Rat

Markers in Region

D1Rat479

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	20,166,196 - 20,166,426 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	20,166,222 - 20,166,426 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	21,213,756 - 21,213,959	NCBI	Rnor6.0
Rnor_6.0	1	21,213,730 - 21,213,959	NCBI	Rnor6.0
Rnor_5.0	1	22,692,631 - 22,692,860	UniSTS	Rnor5.0
Rnor_5.0	1	22,692,657 - 22,692,860	UniSTS	Rnor5.0
RGSC_v3.4	1	20,652,699 - 20,652,902	UniSTS	RGSC3.4
RGSC_v3.4	1	20,652,673 - 20,652,902	UniSTS	RGSC3.4
RGSC_v3.1	1	20,652,760 - 20,652,964	RGD
Celera	1	18,920,215 - 18,920,418	UniSTS
Celera	1	18,920,189 - 18,920,418	UniSTS
SHRSP x BN Map	1	15.98	UniSTS
SHRSP x BN Map	1	15.98	RGD
Cytogenetic Map	1	p12	UniSTS

RH137836

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	20,216,051 - 20,216,257 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	21,263,939 - 21,264,144	NCBI	Rnor6.0
Rnor_5.0	1	22,742,911 - 22,743,116	UniSTS	Rnor5.0
RGSC_v3.4	1	20,704,653 - 20,704,858	UniSTS	RGSC3.4
Celera	1	18,969,887 - 18,970,092	UniSTS
RH 3.4 Map	1	191.61	UniSTS
Cytogenetic Map	1	p12	UniSTS

PMC22491P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	20,100,439 - 20,100,939 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	21,146,050 - 21,146,549	NCBI	Rnor6.0
Rnor_5.0	1	22,625,814 - 22,626,313	UniSTS	Rnor5.0
RGSC_v3.4	1	20,586,019 - 20,586,518	UniSTS	RGSC3.4
Celera	1	18,074,164 - 18,074,663	UniSTS
Cytogenetic Map	8	q24	UniSTS
Cytogenetic Map	1	p12	UniSTS

RH134040

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	20,099,779 - 20,099,962 (+)	MAPPER	mRatBN7.2
mRatBN7.2	8	71,087,624 - 71,087,807 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	76,848,003 - 76,848,185	NCBI	Rnor6.0
Rnor_6.0	1	21,145,390 - 21,145,572	NCBI	Rnor6.0
Rnor_5.0	8	76,233,731 - 76,233,913	UniSTS	Rnor5.0
Rnor_5.0	1	22,625,154 - 22,625,336	UniSTS	Rnor5.0
RGSC_v3.4	1	20,585,359 - 20,585,541	UniSTS	RGSC3.4
RGSC_v3.4	8	74,892,139 - 74,892,321	UniSTS	RGSC3.4
Celera	8	70,640,887 - 70,641,069	UniSTS
Celera	1	18,075,141 - 18,075,323	UniSTS
Cytogenetic Map	8	q24	UniSTS
Cytogenetic Map	1	p12	UniSTS

RH139240

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	20,174,974 - 20,175,098 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	21,222,866 - 21,222,989	NCBI	Rnor6.0
Rnor_5.0	1	22,701,767 - 22,701,890	UniSTS	Rnor5.0
RGSC_v3.4	1	20,661,749 - 20,661,872	UniSTS	RGSC3.4
Celera	1	18,928,911 - 18,929,034	UniSTS
Cytogenetic Map	1	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001001801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081134	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081160	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005487780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005487783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005487784	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010054020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY350741	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098632	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214543	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017617 ⟹ ENSRNOP00000017617

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	20,096,281 - 20,217,797 (+)	Ensembl
Rnor_6.0 Ensembl	1	21,141,970 - 21,263,850 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096819 ⟹ ENSRNOP00000084444

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	20,087,373 - 20,217,797 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096990 ⟹ ENSRNOP00000089300

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	20,187,851 - 20,217,792 (+)	Ensembl

RefSeq Acc Id:

NM_001001801 ⟹ NP_001001801

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	21,906,676 - 22,037,090 (+)	NCBI
mRatBN7.2	1	20,087,373 - 20,217,799 (+)	NCBI
Rnor_6.0	1	21,129,213 - 21,263,850 (+)	NCBI
Rnor_5.0	1	22,621,908 - 22,742,822 (+)	NCBI
RGSC_v3.4	1	20,573,215 - 20,704,564 (+)	RGD
Celera	1	18,857,712 - 18,969,798 (+)	RGD

Sequence:

show sequence

ATGGAGCGCCCCGCCGCGGGAGAAATAGATGCCAATAAGTGTGATCATTTATCAAGAGGAGAGG
AAGGGACGGGGGACCTGGAGACCAGCCCTGTAGGTTCTCTGGCAGACCTGCCGTTTGCTGCCGT
AGACATTCAAGATGACTGTGGACTCCCTGATGTACCTCAAGGAAATGTACCTCAAGGAAACCCA
AAGAGAAGCAAAGAAAATAGAGGCGACAGGAATGATCACGTGAAGAAGAGGAAGAAGGCCAAGA
AAGATTATCAACCCAACTATTTCCTGTCCATTCCAATCACCAACAAAAAGATTACAGCTGGAAT
TAAAGTCTTGCAAAATTCGATACTGAGACAGGATAATCGATTGACCAAAGCCATGGTCGGCGAC
GGCTCCTTTCACATCACCTTGCTAGTGATGCAGCTATTAAACGAAGATGAAGTAAACATAGGTA
CCGACGCGCTTTTGGAACTGAAGCCGTTCGTTGAGGAGATCCTTGAGGGGAAGCATCTGACTTT
GCCCTTCCACGGGATTGGCACTTTCCAAGGTCAGGTTGGCTTTGTGAAGCTGGCAGACGGAGAT
CACGTCAGTGCCCTCCTGGAGATAGCAGAGACTGCAAAAAGGACATTTCAGGAAAAAGGCATCC
TGGCTGGAGAAAGCAGAACTTTTAAGCCTCACCTGACCTTTATGAAGCTGTCCAAAGCACCAAT
GCTCTGGAAGAAGGGAGTGAGAAAAATAGAGCCTGGATTGTATGAGCAATTTATCGACCACAGA
TTTGGAGAAGAAATACTGTACCAAATAGATCTCTGCTCCATGCTGAAGAAAAAACAGAGCAATG
GTTATTACCACTGCGAGTCTTCGATCGTGATCGGTGAGAAGGACCGAAAGGAGCCTGAGGATGC
TGAACTGGTCAGGCTCAGTAAGAGGCTGGTGGAGAACGCCGTGCTCAAGGCTGTCCAGCAGTAC
CTAGAAGAGACACAGAACAAAAAGCAGCCGGGGGAGGGGAACTCCGTCAAAGCTGAGGAGGGAG
ATCGGAATGGCGATGGCAGTGATAACAACCGGAAGTGA

hide sequence

RefSeq Acc Id:

XM_039081121 ⟹ XP_038937049

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	21,906,522 - 22,037,089 (+)	NCBI
mRatBN7.2	1	20,087,204 - 20,217,799 (+)	NCBI

RefSeq Acc Id:

XM_039081134 ⟹ XP_038937062

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	21,906,507 - 21,983,347 (+)	NCBI
mRatBN7.2	1	20,087,194 - 20,164,060 (+)	NCBI

RefSeq Acc Id:

XM_039081154 ⟹ XP_038937082

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	21,929,143 - 22,037,089 (+)	NCBI
mRatBN7.2	1	20,109,841 - 20,217,799 (+)	NCBI

RefSeq Acc Id:

XM_039081160 ⟹ XP_038937088

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	22,006,447 - 22,037,089 (+)	NCBI
mRatBN7.2	1	20,187,144 - 20,217,799 (+)	NCBI

RefSeq Acc Id:

XM_063266032 ⟹ XP_063122102

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	21,915,837 - 22,037,089 (+)	NCBI

RefSeq Acc Id:

XR_005487780

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	21,906,503 - 21,983,366 (+)	NCBI
mRatBN7.2	1	20,087,190 - 20,164,071 (+)	NCBI

RefSeq Acc Id:

XR_005487783

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	21,906,505 - 22,035,198 (+)	NCBI
mRatBN7.2	1	20,087,193 - 20,215,900 (+)	NCBI

RefSeq Acc Id:

XR_005487784

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	21,906,505 - 22,036,023 (+)	NCBI
mRatBN7.2	1	20,087,193 - 20,216,723 (+)	NCBI

RefSeq Acc Id:

XR_010054020

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	21,906,503 - 22,168,663 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001001801	(Get FASTA)	NCBI Sequence Viewer
	XP_038937049	(Get FASTA)	NCBI Sequence Viewer
	XP_038937062	(Get FASTA)	NCBI Sequence Viewer
	XP_038937082	(Get FASTA)	NCBI Sequence Viewer
	XP_038937088	(Get FASTA)	NCBI Sequence Viewer
	XP_063122102	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98632	(Get FASTA)	NCBI Sequence Viewer
	AAR06859	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017617.6
	ENSRNOP00000084444.1
	ENSRNOP00000089300.1
GenBank Protein	Q6JP77	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001001801 ⟸ NM_001001801

- UniProtKB:

D3ZMQ5 (UniProtKB/Swiss-Prot), Q6JP77 (UniProtKB/Swiss-Prot), A0A0A0MXX1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MERPAAGEIDANKCDHLSRGEEGTGDLETSPVGSLADLPFAAVDIQDDCGLPDVPQGNVPQGNP
KRSKENRGDRNDHVKKRKKAKKDYQPNYFLSIPITNKKITAGIKVLQNSILRQDNRLTKAMVGD
GSFHITLLVMQLLNEDEVNIGTDALLELKPFVEEILEGKHLTLPFHGIGTFQGQVGFVKLADGD
HVSALLEIAETAKRTFQEKGILAGESRTFKPHLTFMKLSKAPMLWKKGVRKIEPGLYEQFIDHR
FGEEILYQIDLCSMLKKKQSNGYYHCESSIVIGEKDRKEPEDAELVRLSKRLVENAVLKAVQQY
LEETQNKKQPGEGNSVKAEEGDRNGDGSDNNRK

hide sequence

Ensembl Acc Id:

ENSRNOP00000017617 ⟸ ENSRNOT00000017617

RefSeq Acc Id:	XP_038937062 ⟸ XM_039081134
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038937049 ⟸ XM_039081121
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZX86 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038937082 ⟸ XM_039081154
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038937088 ⟸ XM_039081160
- Peptide Label:	isoform X5

Ensembl Acc Id:

ENSRNOP00000084444 ⟸ ENSRNOT00000096819

Ensembl Acc Id:

ENSRNOP00000089300 ⟸ ENSRNOT00000096990

RefSeq Acc Id:	XP_063122102 ⟸ XM_063266032
- Peptide Label:	isoform X3

Protein Domains

A-kinase anchor protein 7 RI-RII subunit-binding A-kinase anchor protein 7-like phosphoesterase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6JP77-F1-model_v2	AlphaFold	Q6JP77	1-353	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303071	AgrOrtholog
BioCyc Gene	G2FUF-62128	BioCyc
Ensembl Genes	ENSRNOG00000013202	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017617.8	UniProtKB/TrEMBL
	ENSRNOT00000096819.1	UniProtKB/TrEMBL
	ENSRNOT00000096990.1	UniProtKB/TrEMBL
Gene3D-CATH	Cyclic phosphodiesterase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7315112	IMAGE-MGC_LOAD
InterPro	AKAP7_isoform_gamma	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AKAP7_RI-RII-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	cNuc_Pdiesterase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Kinase-A_anchor_nucl_local_sig	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:361458	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112559	IMAGE-MGC_LOAD
NCBI Gene	361458	ENTREZGENE
PANTHER	A-KINASE ANCHOR PROTEIN 7 ISOFORM GAMMA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RNA 2',3'-CYCLIC PHOSPHODIESTERASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	AKAP7_NLS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AKAP7_RIRII_bdg	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Akap7	PhenoGen
RatGTEx	ENSRNOG00000013202	RatGTEx
Superfamily-SCOP	SSF55144	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0A0MXX1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZX86	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A8D9_RAT	UniProtKB/TrEMBL
	AKA7G_RAT	UniProtKB/Swiss-Prot
	D3ZMQ5	ENTREZGENE
	Q6JP77	ENTREZGENE
UniProt Secondary	D3ZMQ5	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Akap7	A-kinase anchoring protein 7	Akap7	A kinase (PRKA) anchor protein 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-02-14	Akap7	A kinase (PRKA) anchor protein 7			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations