Symbol:
Tpo
Name:
thyroid peroxidase
RGD ID:
3900
Description:
Predicted to enable iodide peroxidase activity. Involved in cellular response to nitric oxide and response to lipid. Located in cell surface. Human ortholog(s) of this gene implicated in congenital hypothyroidism; glomerulonephritis; and thyroid dyshormonogenesis 2A. Orthologous to human TPO (thyroid peroxidase); PARTICIPATES IN thyroid hormone biosynthetic pathway; autoimmune thyroiditis pathway; cytokine mediated signaling pathway; INTERACTS WITH (S)-naringenin; 1,3-benzothiazole-2-thiol; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
truncated thyroid peroxidase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TPO (thyroid peroxidase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Tpo (thyroid peroxidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tpo (thyroid peroxidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TPO (thyroid peroxidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TPO (thyroid peroxidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tpo (thyroid peroxidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TPO (thyroid peroxidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TPO (thyroid peroxidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tpo (thyroid peroxidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Tpo (thyroid peroxidase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TPO (thyroid peroxidase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG4009
Alliance
DIOPT (Ensembl Compara|OMA)
Xenopus tropicalis (tropical clawed frog):
tpo
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 52,425,998 - 52,495,793 (-) NCBI GRCr8 mRatBN7.2 6 46,698,402 - 46,768,199 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 46,698,414 - 46,768,199 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 47,003,424 - 47,073,172 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 47,318,282 - 47,388,031 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 46,753,566 - 46,823,319 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 49,020,918 - 49,089,855 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 49,021,044 - 49,089,855 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 57,702,091 - 57,770,914 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 47,954,848 - 48,025,740 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 47,957,973 - 48,028,866 (-) NCBI Celera 6 45,906,515 - 45,971,940 (-) NCBI Celera RH 3.4 Map 6 299.2 RGD Cytogenetic Map 6 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Tpo Rat anterior segment dysgenesis 7 ISO RGD:735786 8554872 ClinVar Annotator: match by term: Anterior segment dysgenesis 7 ClinVar PMID:28492532 Tpo Rat congenital hypothyroidism ISO RGD:735786 8554872 ClinVar Annotator: match by term: Congenital hypothyroidism ClinVar PMID:25741868|PMID:28492532 Tpo Rat Congenital Nongoitrous Hypothyroidism ISO RGD:735786 8554872 ClinVar Annotator: match by term: TSH RESISTANCE ClinVar PMID:25741868 Tpo Rat congenital nongoitrous hypothyroidism 1 ISO RGD:735786 8554872 ClinVar Annotator: match by term: Hypothyroidism, congenital, nongoitrous, 1 ClinVar PMID:25741868 Tpo Rat Developmental Disabilities ISO RGD:735786 8554872 ClinVar Annotator: match by term: Global developmental delay ClinVar PMID:25741868 Tpo Rat Dwarfism ISO RGD:735786 8554872 ClinVar Annotator: match by term: Short stature ClinVar PMID:25741868 Tpo Rat genetic disease ISO RGD:735786 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:25741868|PMID:28492532 Tpo Rat intellectual disability ISO RGD:735786 8554872 ClinVar Annotator: match by term: Intellectual disability, severe ClinVar PMID:25741868 Tpo Rat Neurodevelopmental Disorders ISO RGD:735786 8554872 ClinVar Annotator: match by term: Neurodevelopmental disorder ClinVar PMID:11874711|PMID:15745925|PMID:17381485|PMID:21490078|PMID:25741868|PMID:28492532|PMID:33368191|PMID:34539567 Tpo Rat thyroid dyshormonogenesis 2A ISO RGD:735786 8554872 ClinVar Annotator: match by term: HYPOTHYROIDISM, CONGENITAL, DUE TO DYSHORMONOGENESIS, 2A | ClinVar Annotator: match more ... ClinVar PMID:10084596|PMID:10468986|PMID:11061528|PMID:11238503|PMID:11874711|PMID:11916616|PMID:12213873|PMID:12843174|PMID:12938097|PMID:1401057|PMID:14751036|PMID:15055360|PMID:15279913|PMID:15745925|PMID:16199547|PMID:16684826|PMID:17381485|PMID:174668186|PMID:17468186|PMID:17547680|PMID:18029453|PMID:19243353|PMID:21340161|PMID:21490078|PMID:21900383|PMID:22919382|PMID:23236987|PMID:23329183|PMID:23512414|PMID:24482635|PMID:24790296|PMID:25241611|PMID:25564141|PMID:25741868|PMID:25968604|PMID:26565538|PMID:27060741|PMID:27135621|PMID:27173810|PMID:27373559|PMID:27525530|PMID:27617131|PMID:28444304|PMID:28492532|PMID:28867693|PMID:29546359|PMID:29650690|PMID:29790453|PMID:30022773|PMID:30240412|PMID:30662777|PMID:31287502|PMID:31430255|PMID:31867598|PMID:32078117|PMID:32088313|PMID:32319661|PMID:32424871|PMID:32425884|PMID:32459320|PMID:32765423|PMID:33029631|PMID:33179747|PMID:33368191|PMID:34200080|PMID:34220711|PMID:34248839|PMID:34276565|PMID:34426522|PMID:34539567|PMID:34780050|PMID:35002963|PMID:35507000|PMID:36474027|PMID:7550241|PMID:8027236|PMID:8964831|PMID:9024270|PMID:9814507
Tpo Rat hypothyroidism ISO RGD:12139633 9068941 Hypothyroidism, congenital OMIA PMID:10088086|PMID:10340243|PMID:10340250|PMID:11316303|PMID:11860240|PMID:12125189|PMID:12219595|PMID:12416867|PMID:12564727|PMID:12741092|PMID:12892299|PMID:14518649|PMID:16300118|PMID:16451201|PMID:17197623|PMID:1748985|PMID:17619002|PMID:17619004|PMID:2061865|PMID:21541884|PMID:2307615|PMID:23113744|PMID:23223904|PMID:23683021|PMID:25290378|PMID:25555336|PMID:25958183|PMID:26261983|PMID:26401337|PMID:26401340|PMID:26478542|PMID:26696394|PMID:27267591|PMID:3223852|PMID:35610669|PMID:37167252|PMID:37980820|PMID:38532265|PMID:7695146|PMID:7730121|PMID:7744675|PMID:8091179|PMID:8116929|PMID:8175472|PMID:8496104|PMID:8592797|PMID:8731132|PMID:8799987|PMID:8885174|PMID:8913019|PMID:9282344|PMID:9444634|PMID:9503354|PMID:9590447|PMID:9682425
Only show annotations with direct experimental evidence (0 objects hidden)
Tpo Rat (S)-naringenin decreases activity EXP 6480464 naringenin results in decreased activity of TPO protein CTD PMID:26884060 Tpo Rat 1,3-benzothiazole-2-thiol multiple interactions ISO RGD:735786 6480464 captax binds to and results in decreased activity of TPO protein CTD PMID:26865668 Tpo Rat 1,3-benzothiazole-2-thiol decreases activity ISO RGD:735786 6480464 captax results in decreased activity of TPO protein CTD PMID:31629072 Tpo Rat 1,3-benzothiazole-2-thiol decreases activity EXP 6480464 captax results in decreased activity of TPO protein CTD PMID:23959146|PMID:26884060|PMID:31629072 Tpo Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:735786 6480464 Dihydrotestosterone results in increased expression of TPO mRNA CTD PMID:15953861 Tpo Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of TPO mRNA CTD PMID:26827900 Tpo Rat 2,4-Dihydroxybenzophenone decreases activity EXP 6480464 2,4-dihydroxybenzophenone results in decreased activity of TPO protein CTD PMID:26884060 Tpo Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:733214 6480464 tetrabromobisphenol A results in decreased expression of TPO protein CTD PMID:37487893 Tpo Rat 3,3',5-triiodo-L-thyronine decreases expression ISO RGD:733214 6480464 Triiodothyronine results in decreased expression of TPO protein CTD PMID:37487893 Tpo Rat 4,4'-diaminodiphenylmethane decreases activity EXP 6480464 4,4'-diaminodiphenylmethane results in decreased activity of TPO protein CTD PMID:26884060 Tpo Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:733214 6480464 bisphenol S results in decreased expression of TPO mRNA; bisphenol S results in decreased expression more ... CTD PMID:37487893|PMID:39298647 Tpo Rat 4-Aminophenyl ether decreases activity EXP 6480464 di-(4-aminophenyl)ether results in decreased activity of TPO protein CTD PMID:26884060 Tpo Rat 5-azacytidine increases expression ISO RGD:735786 6480464 Azacitidine results in increased expression of TPO mRNA CTD PMID:17679169 Tpo Rat 6-propyl-2-thiouracil decreases expression ISO RGD:735786 6480464 Propylthiouracil results in decreased expression of TPO mRNA CTD PMID:22342233 Tpo Rat 6-propyl-2-thiouracil multiple interactions EXP 6480464 [Propylthiouracil results in decreased activity of TPO protein] which results in decreased chemical synthesis of more ... CTD PMID:28973696 Tpo Rat 6-propyl-2-thiouracil decreases activity EXP 6480464 Propylthiouracil results in decreased activity of TPO protein CTD PMID:22342233|PMID:23959146|PMID:26884060|PMID:28973696|PMID:31629072|PMID:31697382|PMID:39069214 Tpo Rat 6-propyl-2-thiouracil multiple interactions ISO RGD:735786 6480464 Propylthiouracil binds to and results in decreased activity of TPO protein CTD PMID:26865668 Tpo Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TPO mRNA CTD PMID:22342233|PMID:39441382 Tpo Rat 6-propyl-2-thiouracil decreases activity ISO RGD:735786 6480464 Propylthiouracil results in decreased activity of TPO protein CTD PMID:22342233|PMID:31629072 Tpo Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of TPO mRNA CTD PMID:28959563 Tpo Rat all-trans-retinoic acid increases expression ISO RGD:735786 6480464 Tretinoin results in increased expression of TPO mRNA CTD PMID:17679169 Tpo Rat all-trans-retinoic acid affects expression ISO RGD:735786 6480464 Tretinoin affects the expression of TPO mRNA CTD PMID:31600526 Tpo Rat amiodarone decreases expression ISO RGD:735786 6480464 Amiodarone results in decreased expression of TPO mRNA CTD PMID:18020914 Tpo Rat amiodarone increases expression EXP 6480464 Amiodarone results in increased expression of TPO mRNA CTD PMID:27197836 Tpo Rat amitrole decreases activity EXP 6480464 Amitrole results in decreased activity of TPO protein CTD PMID:20937625 Tpo Rat amitrole decreases activity ISO RGD:735786 6480464 Amitrole results in decreased activity of TPO protein CTD PMID:31629072 Tpo Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TPO mRNA CTD PMID:16483693 Tpo Rat arsane decreases expression ISO RGD:735786 6480464 Arsenic results in decreased expression of TPO mRNA CTD PMID:36861143 Tpo Rat arsenic atom decreases expression ISO RGD:735786 6480464 Arsenic results in decreased expression of TPO mRNA CTD PMID:36861143 Tpo Rat arsenous acid decreases activity ISO RGD:735786 6480464 Arsenic Trioxide results in decreased activity of TPO protein CTD PMID:25595679 Tpo Rat arsenous acid multiple interactions ISO RGD:735786 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to TPO protein]; Arsenic Trioxide promotes the reaction more ... CTD PMID:25595679|PMID:26598702 Tpo Rat asbestos affects methylation ISO RGD:735786 6480464 Asbestos affects the methylation of TPO gene CTD PMID:28722770 Tpo Rat bathocuproine disulfonic acid multiple interactions EXP 6480464 bathocuproine sulfonate inhibits the reaction [pyrrolidine dithiocarbamic acid results in decreased expression of TPO mRNA] CTD PMID:11108245 Tpo Rat benzo[a]pyrene increases activity ISO RGD:735786 6480464 Benzo(a)pyrene results in increased activity of TPO protein CTD PMID:21809831 Tpo Rat benzo[a]pyrene affects methylation ISO RGD:735786 6480464 Benzo(a)pyrene affects the methylation of TPO promoter CTD PMID:27901495 Tpo Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of TPO mRNA CTD PMID:21839799|PMID:30085273 Tpo Rat benzo[a]pyrene increases mutagenesis ISO RGD:735786 6480464 Benzo(a)pyrene results in increased mutagenesis of TPO gene CTD PMID:25435355 Tpo Rat benzo[e]pyrene increases methylation ISO RGD:735786 6480464 benzo(e)pyrene results in increased methylation of TPO polyA tail CTD PMID:30157460 Tpo Rat benzophenone decreases activity ISO RGD:735786 6480464 benzophenone results in decreased activity of TPO protein CTD PMID:21809831 Tpo Rat bis(2-chloroethyl) sulfide increases expression ISO RGD:733214 6480464 Mustard Gas results in increased expression of TPO mRNA CTD PMID:15674843 Tpo Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of TPO mRNA CTD PMID:36714560 Tpo Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of TPO mRNA; Diethylhexyl Phthalate results in increased expression more ... CTD PMID:30716676|PMID:33649816 Tpo Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TPO mRNA CTD PMID:23238275 Tpo Rat bisphenol A decreases expression ISO RGD:733214 6480464 bisphenol A results in decreased expression of TPO protein CTD PMID:37487893 Tpo Rat bisphenol A decreases methylation ISO RGD:735786 6480464 bisphenol A results in decreased methylation of TPO gene CTD PMID:31601247 Tpo Rat bisphenol A multiple interactions ISO RGD:735786 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TPO gene CTD PMID:31601247 Tpo Rat bisphenol A multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [bisphenol A results in decreased expression of TPO mRNA] CTD PMID:30352396 Tpo Rat bisphenol A decreases activity EXP 6480464 bisphenol A results in decreased activity of TPO protein CTD PMID:30352396 Tpo Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TPO mRNA CTD PMID:25181051|PMID:26827900|PMID:30352396 Tpo Rat Butylparaben increases activity EXP 6480464 butylparaben results in increased activity of TPO protein CTD PMID:32798586 Tpo Rat Butylparaben increases expression EXP 6480464 butylparaben results in increased expression of TPO mRNA CTD PMID:32798586 Tpo Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of TPO mRNA CTD PMID:19167457 Tpo Rat cadmium dichloride decreases expression ISO RGD:735786 6480464 Cadmium Chloride results in decreased expression of TPO mRNA CTD PMID:38382870 Tpo Rat carbaryl increases activity ISO RGD:735786 6480464 Carbaryl results in increased activity of TPO protein CTD PMID:21809831 Tpo Rat CGP 52608 multiple interactions ISO RGD:735786 6480464 CGP 52608 promotes the reaction [RORA protein binds to TPO gene] CTD PMID:28238834 Tpo Rat copper atom multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of TPO mRNA CTD PMID:26033743 Tpo Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of TPO mRNA CTD PMID:26033743 Tpo Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of TPO mRNA CTD PMID:26033743 Tpo Rat copper(0) multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of TPO mRNA CTD PMID:26033743 Tpo Rat cyclosporin A decreases methylation ISO RGD:735786 6480464 Cyclosporine results in decreased methylation of TPO promoter CTD PMID:27989131 Tpo Rat daidzein decreases expression EXP 6480464 daidzein results in decreased expression of TPO mRNA CTD PMID:24793811 Tpo Rat daidzein decreases activity ISO RGD:735786 6480464 daidzein results in decreased activity of TPO protein CTD PMID:31629072 Tpo Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of TPO mRNA CTD PMID:23640034|PMID:30844666 Tpo Rat diarsenic trioxide multiple interactions ISO RGD:735786 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to TPO protein]; Arsenic Trioxide promotes the reaction more ... CTD PMID:25595679|PMID:26598702 Tpo Rat diarsenic trioxide decreases activity ISO RGD:735786 6480464 Arsenic Trioxide results in decreased activity of TPO protein CTD PMID:25595679 Tpo Rat dibenz[a,h]anthracene increases activity ISO RGD:735786 6480464 1,2,5,6-dibenzanthracene results in increased activity of TPO protein CTD PMID:21809831 Tpo Rat dibutyl phthalate increases activity ISO RGD:735786 6480464 Dibutyl Phthalate results in increased activity of TPO protein CTD PMID:21809831 Tpo Rat doxorubicin decreases expression ISO RGD:735786 6480464 Doxorubicin results in decreased expression of TPO mRNA CTD PMID:29803840 Tpo Rat efavirenz increases expression ISO RGD:735786 6480464 efavirenz results in increased expression of TPO mRNA; efavirenz results in increased expression of TPO more ... CTD PMID:16030158 Tpo Rat Ethylenethiourea decreases activity ISO RGD:735786 6480464 Ethylenethiourea results in decreased activity of TPO protein CTD PMID:7626075|PMID:9248629 Tpo Rat Ethylenethiourea affects activity ISO RGD:735786 6480464 Ethylenethiourea affects the activity of TPO protein CTD PMID:31629072 Tpo Rat fulvestrant increases methylation ISO RGD:735786 6480464 Fulvestrant results in increased methylation of TPO gene CTD PMID:31601247 Tpo Rat fulvestrant multiple interactions ISO RGD:735786 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TPO gene CTD PMID:31601247 Tpo Rat genistein decreases activity ISO RGD:735786 6480464 Genistein results in decreased activity of TPO protein CTD PMID:21809831|PMID:31629072 Tpo Rat genistein decreases expression EXP 6480464 Genistein results in decreased expression of TPO mRNA; Genistein results in decreased expression of TPO more ... CTD PMID:24793811 Tpo Rat glutathione decreases activity ISO RGD:735786 6480464 Glutathione results in decreased activity of TPO protein CTD PMID:25595679 Tpo Rat glutathione multiple interactions ISO RGD:735786 6480464 arsenic trioxide promotes the reaction [Glutathione results in decreased activity of TPO protein]; Glutathione promotes more ... CTD PMID:25595679 Tpo Rat glyphosate multiple interactions ISO RGD:733214 6480464 Melatonin inhibits the reaction [Glyphosate results in decreased expression of TPO mRNA] CTD PMID:33159990 Tpo Rat glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of TPO mRNA CTD PMID:36462676 Tpo Rat glyphosate decreases expression ISO RGD:733214 6480464 Glyphosate results in decreased expression of TPO mRNA CTD PMID:33159990 Tpo Rat iodide salt increases oxidation ISO RGD:735786 6480464 TPO protein results in increased oxidation of Iodides CTD PMID:25595679 Tpo Rat isoniazide decreases activity EXP 6480464 Isoniazid results in decreased activity of TPO protein CTD PMID:26884060 Tpo Rat isoprenaline decreases activity EXP 6480464 Isoproterenol results in decreased activity of TPO protein CTD PMID:26884060 Tpo Rat mancozeb decreases activity EXP 6480464 mancozeb results in decreased activity of TPO protein CTD PMID:9418944 Tpo Rat melatonin multiple interactions ISO RGD:733214 6480464 Melatonin inhibits the reaction [Glyphosate results in decreased expression of TPO mRNA] CTD PMID:33159990 Tpo Rat methapyrilene increases methylation ISO RGD:735786 6480464 Methapyrilene results in increased methylation of TPO polyA tail CTD PMID:30157460 Tpo Rat methimazole multiple interactions ISO RGD:735786 6480464 Methimazole binds to and results in decreased activity of TPO protein; Sodium Iodide inhibits the more ... CTD PMID:26865668|PMID:7626075 Tpo Rat methimazole decreases activity EXP 6480464 Methimazole results in decreased activity of TPO protein CTD PMID:22342233|PMID:23959146|PMID:26884060|PMID:31629072|PMID:31697382 Tpo Rat methimazole decreases activity ISO RGD:735786 6480464 Methimazole results in decreased activity of TPO protein CTD PMID:21809831|PMID:22342233|PMID:31629072|PMID:7626075|PMID:9248629 Tpo Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of TPO mRNA CTD PMID:22342233 Tpo Rat minocycline decreases activity EXP 6480464 Minocycline results in decreased activity of TPO protein CTD PMID:26884060 Tpo Rat mono(2-ethylhexyl) phthalate decreases expression ISO RGD:735786 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of TPO protein CTD PMID:36005737 Tpo Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of TPO mRNA CTD PMID:21515302 Tpo Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [bisphenol A results in decreased expression of TPO mRNA] CTD PMID:30352396 Tpo Rat N-Vinyl-2-pyrrolidone multiple interactions EXP 6480464 [N-vinyl-2-pyrrolidinone binds to N-vinyl-2-pyrrolidinone] which results in increased expression of TPO mRNA CTD PMID:22037397 Tpo Rat nevirapine increases expression ISO RGD:735786 6480464 Nevirapine results in increased expression of TPO mRNA; Nevirapine results in increased expression of TPO more ... CTD PMID:16030158 Tpo Rat nitrogen dioxide multiple interactions ISO RGD:735786 6480464 [Air Pollutants results in increased abundance of Nitrogen Dioxide] which results in decreased methylation of more ... CTD PMID:27448387 Tpo Rat o-anisidine decreases activity EXP 6480464 2-anisidine results in decreased activity of TPO protein CTD PMID:26884060 Tpo Rat okadaic acid decreases expression ISO RGD:735786 6480464 Okadaic Acid results in decreased expression of TPO mRNA CTD PMID:38832940 Tpo Rat oxymetholone increases expression ISO RGD:735786 6480464 Oxymetholone results in increased expression of TPO mRNA CTD PMID:15953861 Tpo Rat ozone decreases expression ISO RGD:735786 6480464 Ozone results in decreased expression of TPO mRNA CTD PMID:27206323 Tpo Rat perchlorate increases expression EXP 6480464 perchlorate results in increased expression of TPO mRNA CTD PMID:35385113 Tpo Rat perfluorooctane-1-sulfonic acid decreases activity ISO RGD:735786 6480464 perfluorooctane sulfonic acid results in decreased activity of TPO protein CTD PMID:21809831 Tpo Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of TPO mRNA CTD PMID:34246126 Tpo Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of TPO mRNA CTD PMID:22037397 Tpo Rat potassium iodide multiple interactions EXP 6480464 [Potassium Iodide co-treated with TSHB protein co-treated with FOXE1 protein] binds to TPO promoter; [Potassium more ... CTD PMID:27568464 Tpo Rat pregnenolone 16alpha-carbonitrile affects expression EXP 6480464 Pregnenolone Carbonitrile affects the expression of TPO mRNA CTD PMID:19162173 Tpo Rat propanal decreases expression ISO RGD:735786 6480464 propionaldehyde results in decreased expression of TPO mRNA CTD PMID:26079696 Tpo Rat pyridine-2,3-diol decreases activity EXP 6480464 2,3-dihydroxypyridine results in decreased activity of TPO protein CTD PMID:26884060 Tpo Rat pyrrolidine dithiocarbamate decreases activity EXP 6480464 pyrrolidine dithiocarbamic acid results in decreased activity of TPO promoter CTD PMID:11108245 Tpo Rat pyrrolidine dithiocarbamate multiple interactions EXP 6480464 bathocuproine sulfonate inhibits the reaction [pyrrolidine dithiocarbamic acid results in decreased expression of TPO mRNA]; more ... CTD PMID:11108245 Tpo Rat pyrrolidine dithiocarbamate decreases expression EXP 6480464 pyrrolidine dithiocarbamic acid results in decreased expression of TPO mRNA CTD PMID:11108245 Tpo Rat quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of TPO mRNA; Quercetin results in decreased expression of TPO more ... CTD PMID:24447974 Tpo Rat resorcinol multiple interactions ISO RGD:735786 6480464 resorcinol binds to and results in decreased activity of TPO protein CTD PMID:26865668 Tpo Rat resorcinol decreases activity ISO RGD:735786 6480464 resorcinol results in decreased activity of TPO protein CTD PMID:31629072 Tpo Rat resorcinol decreases activity EXP 6480464 resorcinol results in decreased activity of TPO protein CTD PMID:31629072 Tpo Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of TPO mRNA; resveratrol results in decreased expression of TPO more ... CTD PMID:28668442 Tpo Rat salicylhydroxamic acid decreases activity EXP 6480464 salicylhydroxamic acid results in decreased activity of TPO protein CTD PMID:26884060 Tpo Rat silver atom increases expression ISO RGD:735786 6480464 Silver analog results in increased expression of TPO mRNA CTD PMID:27180073 Tpo Rat silver(0) increases expression ISO RGD:735786 6480464 Silver analog results in increased expression of TPO mRNA CTD PMID:27180073 Tpo Rat silver(1+) nitrate increases expression ISO RGD:735786 6480464 Silver Nitrate results in increased expression of TPO mRNA CTD PMID:27180073 Tpo Rat sodium arsenite increases expression ISO RGD:735786 6480464 sodium arsenite results in increased expression of TPO mRNA CTD PMID:38568856 Tpo Rat sodium azide decreases activity EXP 6480464 Sodium Azide results in decreased activity of TPO protein CTD PMID:26884060 Tpo Rat sodium iodide multiple interactions ISO RGD:735786 6480464 Sodium Iodide inhibits the reaction [Methimazole results in decreased activity of TPO protein] CTD PMID:7626075 Tpo Rat sodium nitrate increases expression EXP 6480464 sodium nitrate results in increased expression of TPO mRNA CTD PMID:34409734 Tpo Rat sodium perchlorate decreases activity EXP 6480464 sodium perchlorate results in decreased activity of TPO protein CTD PMID:23959146 Tpo Rat sodium perchlorate increases expression EXP 6480464 sodium perchlorate results in increased expression of TPO mRNA; sodium perchlorate results in increased expression more ... CTD PMID:29139221 Tpo Rat Tesaglitazar decreases expression EXP 6480464 tesaglitazar results in decreased expression of TPO mRNA CTD PMID:21515302 Tpo Rat testosterone increases expression ISO RGD:735786 6480464 Testosterone results in increased expression of TPO mRNA CTD PMID:33359661 Tpo Rat thiram increases expression ISO RGD:735786 6480464 Thiram results in increased expression of TPO mRNA CTD PMID:38568856 Tpo Rat thyroxine multiple interactions EXP 6480464 [Propylthiouracil results in decreased activity of TPO protein] which results in decreased chemical synthesis of more ... CTD PMID:28973696 Tpo Rat triclocarban decreases activity EXP 6480464 triclocarban results in decreased activity of TPO protein CTD PMID:26827900 Tpo Rat triclosan decreases activity EXP 6480464 Triclosan results in decreased activity of TPO protein CTD PMID:26827900|PMID:31629072 Tpo Rat triclosan multiple interactions ISO RGD:735786 6480464 Triclosan binds to and results in decreased activity of TPO protein CTD PMID:26865668 Tpo Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of TPO mRNA CTD PMID:25646720 Tpo Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of TPO mRNA CTD PMID:21515302 Tpo Rat valproic acid affects expression ISO RGD:733214 6480464 Valproic Acid affects the expression of TPO mRNA CTD PMID:17292431|PMID:17963808 Tpo Rat valproic acid increases methylation ISO RGD:735786 6480464 Valproic Acid results in increased methylation of TPO gene CTD PMID:29154799 Tpo Rat vemurafenib multiple interactions ISO RGD:735786 6480464 [BRAF protein mutant form affects the susceptibility to Vemurafenib] which affects the expression of TPO more ... CTD PMID:26751190 Tpo Rat vinclozolin decreases activity ISO RGD:735786 6480464 vinclozolin results in decreased activity of TPO protein CTD PMID:21809831 Tpo Rat vorinostat increases expression ISO RGD:735786 6480464 vorinostat results in increased expression of TPO mRNA CTD PMID:26751190 Tpo Rat vorinostat multiple interactions ISO RGD:735786 6480464 BRAF protein mutant form affects the reaction [vorinostat affects the reaction [[TSHB protein co-treated with more ... CTD PMID:26751190 Tpo Rat zineb decreases activity ISO RGD:735786 6480464 Zineb results in decreased activity of TPO protein CTD PMID:9248629 Tpo Rat ziram decreases activity ISO RGD:735786 6480464 Ziram results in decreased activity of TPO protein CTD PMID:9248629
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(S)-naringenin (EXP) 1,3-benzothiazole-2-thiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,4-Dihydroxybenzophenone (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,3',5-triiodo-L-thyronine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-Aminophenyl ether (EXP) 5-azacytidine (ISO) 6-propyl-2-thiouracil (EXP,ISO) acrylamide (EXP) all-trans-retinoic acid (ISO) amiodarone (EXP,ISO) amitrole (EXP,ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) asbestos (ISO) bathocuproine disulfonic acid (EXP) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) benzophenone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) Butylparaben (EXP) C60 fullerene (EXP) cadmium dichloride (ISO) carbaryl (ISO) CGP 52608 (ISO) copper atom (EXP) copper(0) (EXP) cyclosporin A (ISO) daidzein (EXP,ISO) decabromodiphenyl ether (EXP) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (ISO) doxorubicin (ISO) efavirenz (ISO) Ethylenethiourea (ISO) fulvestrant (ISO) genistein (EXP,ISO) glutathione (ISO) glyphosate (EXP,ISO) iodide salt (ISO) isoniazide (EXP) isoprenaline (EXP) mancozeb (EXP) melatonin (ISO) methapyrilene (ISO) methimazole (EXP,ISO) minocycline (EXP) mono(2-ethylhexyl) phthalate (ISO) Muraglitazar (EXP) N-acetyl-L-cysteine (EXP) N-Vinyl-2-pyrrolidone (EXP) nevirapine (ISO) nitrogen dioxide (ISO) o-anisidine (EXP) okadaic acid (ISO) oxymetholone (ISO) ozone (ISO) perchlorate (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (EXP) potassium iodide (EXP) pregnenolone 16alpha-carbonitrile (EXP) propanal (ISO) pyridine-2,3-diol (EXP) pyrrolidine dithiocarbamate (EXP) quercetin (EXP) resorcinol (EXP,ISO) resveratrol (EXP) salicylhydroxamic acid (EXP) silver atom (ISO) silver(0) (ISO) silver(1+) nitrate (ISO) sodium arsenite (ISO) sodium azide (EXP) sodium iodide (ISO) sodium nitrate (EXP) sodium perchlorate (EXP) Tesaglitazar (EXP) testosterone (ISO) thiram (ISO) thyroxine (EXP) triclocarban (EXP) triclosan (EXP,ISO) triphenyl phosphate (EXP) troglitazone (EXP) valproic acid (ISO) vemurafenib (ISO) vinclozolin (ISO) vorinostat (ISO) zineb (ISO) ziram (ISO)
1.
Nitric oxide/cGMP signaling inhibits TSH-stimulated iodide uptake and expression of thyroid peroxidase and thyroglobulin mRNA in FRTL-5 thyroid cells.
Bazzara LG, etal., Thyroid. 2007 Aug;17(8):717-27.
2.
Identification of five novel inactivating mutations in the human thyroid peroxidase gene by denaturing gradient gel electrophoresis.
Bikker H, etal., Hum Mutat. 1995;6(1):9-16.
3.
Complete nucleotide sequence of the cDNA for thyroid peroxidase in FRTL5 rat thyroid cells.
Derwahl M, etal., Nucleic Acids Res 1989 Oct 25;17(20):8380.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Thyroid peroxidase: rat cDNA sequence, chromosomal localization in mouse, and regulation of gene expression by comparison to thyroglobulin in rat FRTL-5 cells.
Isozaki O, etal., Mol Endocrinol. 1989 Nov;3(11):1681-92.
7.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
8.
Intracellular trafficking of thyroid peroxidase to the cell surface.
Kuliawat R, etal., J Biol Chem. 2005 Jul 29;280(30):27713-8. Epub 2005 May 24.
9.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
13.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
14.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
15.
GOA pipeline
RGD automated data pipeline
16.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
Pretransplant positivity for circulating thyroid antibodies and graft survival in patients undergoing kidney transplant.
Rotondi M, etal., Horm Res. 2009;71(6):324-30. doi: 10.1159/000223416. Epub 2009 Jun 6.
19.
Effects of a dietary thermally oxidized fat on thyroid morphology and mRNA concentrations of thyroidal iodide transporter and thyroid peroxidase in rats.
Skufca P, etal., Ann Nutr Metab. 2003;47(5):207-13.
20.
Increased prevalence of thyroid peroxidase antibodies (TPO-Ab) in women with glomerulonephritis.
Westman KW, etal., Nephrol Dial Transplant. 1993;8(5):402-6.
Tpo Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 52,425,998 - 52,495,793 (-) NCBI GRCr8 mRatBN7.2 6 46,698,402 - 46,768,199 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 46,698,414 - 46,768,199 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 47,003,424 - 47,073,172 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 47,318,282 - 47,388,031 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 46,753,566 - 46,823,319 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 49,020,918 - 49,089,855 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 49,021,044 - 49,089,855 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 57,702,091 - 57,770,914 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 47,954,848 - 48,025,740 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 47,957,973 - 48,028,866 (-) NCBI Celera 6 45,906,515 - 45,971,940 (-) NCBI Celera RH 3.4 Map 6 299.2 RGD Cytogenetic Map 6 q16 NCBI
TPO Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 1,374,047 - 1,543,673 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 1,374,066 - 1,543,711 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 1,417,235 - 1,547,445 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 1,396,242 - 1,525,502 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 1,396,241 - 1,525,502 NCBI Celera 2 1,466,953 - 1,592,423 (+) NCBI Celera Cytogenetic Map 2 p25.3 NCBI HuRef 2 1,408,795 - 1,531,941 (+) NCBI HuRef CHM1_1 2 1,409,624 - 1,546,343 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 1,414,928 - 1,549,090 (+) NCBI T2T-CHM13v2.0
Tpo Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 30,104,658 - 30,182,983 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 30,104,658 - 30,182,623 (-) Ensembl GRCm39 Ensembl GRCm38 12 30,054,659 - 30,132,984 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 30,054,659 - 30,132,624 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 30,739,526 - 30,817,474 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 30,640,713 - 30,718,661 (-) NCBI MGSCv36 mm8 Celera 12 31,518,105 - 31,587,543 (-) NCBI Celera Cytogenetic Map 12 A2 NCBI cM Map 12 13.0 NCBI
Tpo Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955487 494,746 - 529,416 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955487 485,029 - 530,287 (-) NCBI ChiLan1.0 ChiLan1.0
TPO Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 125,044,194 - 125,171,557 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 125,048,171 - 125,175,534 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 1,364,083 - 1,491,284 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 1,334,608 - 1,493,308 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 1,335,556 - 1,493,055 (+) Ensembl panpan1.1 panPan2
TPO Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 773,790 - 810,044 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 773,790 - 810,043 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 760,899 - 796,526 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 830,903 - 866,744 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 831,063 - 866,737 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 755,185 - 790,848 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 775,417 - 811,064 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 775,279 - 810,948 (+) NCBI UU_Cfam_GSD_1.0
Tpo
TPO Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 132,384,583 - 132,409,208 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 132,384,677 - 132,409,750 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 141,795,655 - 141,820,693 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TPO Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 106,148,214 - 106,255,442 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 106,146,946 - 106,255,298 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 5,734,964 - 5,848,587 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tpo
.
Predicted Target Of
Count of predictions: 43 Count of miRNA genes: 38 Interacting mature miRNAs: 43 Transcripts: ENSRNOT00000006526 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
9590290 Uminl2 Urine mineral level QTL 2 3.96 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 6 38783989 83783989 Rat 8693632 Alc27 Alcohol consumption QTL 27 2.2 0.791 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 6 34323357 51121479 Rat 634318 Bw118 Body weight QTL 118 3.55 abdominal fat pad mass (VT:1000711) abdominal fat pad weight (CMO:0000088) 6 33309549 57730294 Rat 10401812 Kidm54 Kidney mass QTL 54 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 634307 Bp141 Blood pressure QTL 141 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 35230417 80230417 Rat 2292589 Emca10 Estrogen-induced mammary cancer QTL 10 0.048 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 16536140 61536140 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 10401800 Kidm49 Kidney mass QTL 49 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1300164 Rf15 Renal function QTL 15 3.12 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 54641141 Rat 1331779 Rf38 Renal function QTL 38 2.876 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 32074428 72227641 Rat 1354632 Scl29 Serum cholesterol level QTL 29 3.74 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 6 35098709 71636405 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 2293839 Kiddil2 Kidney dilation QTL 2 4.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 9590140 Scort4 Serum corticosterone level QTL 4 14.49 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 9590306 Scort18 Serum corticosterone level QTL 18 2.88 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 1578665 Bss16 Bone structure and strength QTL 16 4.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 6 11735669 72593685 Rat 2293841 Kiddil4 Kidney dilation QTL 4 4.4 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1641898 Colcr4 Colorectal carcinoma resistance QTL4 3.71 0.0007 intestine integrity trait (VT:0010554) well differentiated malignant colorectal tumor surface area measurement (CMO:0002077) 6 20338777 62613667 Rat 1578668 Bmd14 Bone mineral density QTL 14 3.8 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 11735669 72593685 Rat 6893340 Cm77 Cardiac mass QTL 77 0.26 0.57 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 33309549 81132889 Rat 70199 Coreg1 Compensatory renal growth QTL 1 11.8 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 6 35691618 57730540 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 1354664 Slep2 Serum leptin concentration QTL 2 4.49 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 6 16536140 71636405 Rat 1300143 Rf14 Renal function QTL 14 2.92 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 34434137 77102317 Rat
RH94606
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 6 299.2 UniSTS Cytogenetic Map 6 q16 UniSTS
Tpo
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 46,739,489 - 46,740,973 (+) MAPPER mRatBN7.2 Rnor_6.0 6 49,061,147 - 49,062,630 NCBI Rnor6.0 Rnor_5.0 6 57,742,206 - 57,743,689 UniSTS Rnor5.0 RGSC_v3.4 6 47,997,031 - 47,998,514 UniSTS RGSC3.4 Celera 6 45,943,229 - 45,944,712 UniSTS Cytogenetic Map 6 q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
1
8
24
24
26
7
6
7
6
42
27
11
1
34
19
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006526 ⟹ ENSRNOP00000006526
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 46,698,414 - 46,768,199 (-) Ensembl Rnor_6.0 Ensembl 6 49,021,044 - 49,089,855 (-) Ensembl
RefSeq Acc Id:
NM_019353 ⟹ NP_062226
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 52,425,998 - 52,495,793 (-) NCBI mRatBN7.2 6 46,698,402 - 46,768,199 (-) NCBI Rnor_6.0 6 49,021,032 - 49,089,855 (-) NCBI Rnor_5.0 6 57,702,091 - 57,770,914 (-) NCBI RGSC_v3.4 6 47,954,848 - 48,025,740 (-) RGD Celera 6 45,906,515 - 45,971,940 (-) NCBI
Sequence:
GCACAGCCTGCTTCTTCAGTGGAGGAAAAGAAAATGGTCAGAATGAGAACACTTGGAGCTATGGCAGTAATGCTGGTTGTGATGGGAACTGCAATTTTCCTCCCTTTCCTCCTGAGAAGCAGAGACAT
hide sequence
RefSeq Acc Id:
NP_062226 ⟸ NM_019353
- Peptide Label:
precursor
- UniProtKB:
F1LN48 (UniProtKB/TrEMBL), A6HB29 (UniProtKB/TrEMBL)
- Sequence:
MRTLGAMAVMLVVMGTAIFLPFLLRSRDILGGKTMTSHVINVVETSQLLVDNAVYNTMKRNLKKRGVLSPAQLLSFSKLPESTSGAISRAAEIMETSIQVMKREQSQFSTDALSADILATIANLSGCL
hide sequence
Ensembl Acc Id:
ENSRNOP00000006526 ⟸ ENSRNOT00000006526
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Tpo
Thyroid peroxidase
Symbol and Name status set to approved
70586 APPROVED
