Symbol:
Mpz
Name:
myelin protein zero
RGD ID:
3109
Description:
Involved in negative regulation of apoptotic process. Located in basolateral plasma membrane. Biomarker of diabetic neuropathy and sciatic neuropathy. Human ortholog(s) of this gene implicated in Charcot-Marie-Tooth disease (multiple). Orthologous to human MPZ (myelin protein zero); INTERACTS WITH (20S)-20-hydroxypregn-4-en-3-one; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
MPP; myelin peripheral protein; myelin protein P0; Myelin protein zero (Charcot-Marie-Tooth neuropathy 1B); P0
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MPZ (myelin protein zero) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mpz (myelin protein zero) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mpz (myelin protein zero) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MPZ (myelin protein zero) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MPZ (myelin protein zero) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mpz (myelin protein zero) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MPZ (myelin protein zero) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MPZ (myelin protein zero) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mpz (myelin protein zero) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TNNI1 (troponin I1, slow skeletal type) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Mpz (myelin protein zero)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MPZ (myelin protein zero)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mpz (myelin protein zero)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mpz
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 86,103,290 - 86,109,156 (+) NCBI GRCr8 mRatBN7.2 13 83,570,811 - 83,576,680 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 83,570,811 - 83,576,679 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 86,076,519 - 86,082,418 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 87,474,755 - 87,480,657 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 84,706,501 - 84,712,211 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 89,524,204 - 89,530,070 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 89,524,329 - 89,530,068 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 94,151,850 - 94,156,749 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 87,040,479 - 87,045,378 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 87,229,362 - 87,234,262 (+) NCBI Celera 13 83,202,202 - 83,207,991 (+) NCBI Celera Cytogenetic Map 13 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mpz Rat (20S)-20-hydroxypregn-4-en-3-one multiple interactions EXP 6480464 20-alpha-Dihydroprogesterone inhibits the reaction [Docetaxel results in decreased expression of MPZ mRNA] and 20-alpha-Dihydroprogesterone inhibits the reaction [Streptozocin results in decreased expression of MPZ mRNA] CTD PMID:17187935 and PMID:19335538 Mpz Rat (20S)-20-hydroxypregn-4-en-3-one increases expression EXP 6480464 20-alpha-Dihydroprogesterone results in increased expression of MPZ mRNA CTD PMID:16787508 Mpz Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MPZ mRNA CTD PMID:32741896 Mpz Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MPZ mRNA CTD PMID:32741896 Mpz Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mpz (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MPZ mRNA CTD PMID:26377647 Mpz Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MPZ mRNA CTD PMID:32109520 Mpz Rat 3alpha-hydroxy-5beta-pregnan-20-one increases expression EXP 6480464 Pregnanolone results in increased expression of MPZ mRNA CTD PMID:16787508 Mpz Rat 4,4'-diaminodiphenylmethane decreases expression ISO Mpz (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of MPZ mRNA CTD PMID:18648102 Mpz Rat 4,4'-sulfonyldiphenol increases methylation ISO Mpz (Mus musculus) 6480464 bisphenol S results in increased methylation of MPZ exon CTD PMID:33297965 Mpz Rat 4,4'-sulfonyldiphenol affects methylation ISO Mpz (Mus musculus) 6480464 bisphenol S affects the methylation of MPZ gene CTD PMID:31683443 Mpz Rat 5-aminolevulinic acid decreases expression EXP 6480464 Aminolevulinic Acid results in decreased expression of MPZ protein CTD PMID:18665889 Mpz Rat all-trans-retinoic acid decreases expression ISO Mpz (Mus musculus) 6480464 Tretinoin results in decreased expression of MPZ mRNA CTD PMID:37278767 Mpz Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] affects the expression of MPZ mRNA CTD PMID:35163327 Mpz Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MPZ mRNA CTD PMID:16483693 Mpz Rat arsenous acid increases expression ISO MPZ (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MPZ mRNA CTD PMID:27829220 Mpz Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of MPZ mRNA CTD PMID:36841081 Mpz Rat benzo[a]pyrene decreases expression ISO Mpz (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MPZ mRNA CTD PMID:22228805 Mpz Rat beta-lapachone increases expression ISO MPZ (Homo sapiens) 6480464 beta-lapachone results in increased expression of MPZ mRNA CTD PMID:38218311 Mpz Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MPZ mRNA CTD PMID:25181051 Mpz Rat bisphenol A increases expression ISO Mpz (Mus musculus) 6480464 bisphenol A results in increased expression of MPZ mRNA CTD PMID:32156529 Mpz Rat bortezomib decreases expression EXP 6480464 Bortezomib results in decreased expression of MPZ mRNA and Bortezomib results in decreased expression of MPZ protein CTD PMID:20830808 Mpz Rat bortezomib decreases expression ISO Mpz (Mus musculus) 6480464 Bortezomib results in decreased expression of MPZ mRNA CTD PMID:20830808 Mpz Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of MPZ mRNA CTD PMID:33453195 Mpz Rat carbamazepine affects expression ISO MPZ (Homo sapiens) 6480464 Carbamazepine affects the expression of MPZ mRNA CTD PMID:25979313 Mpz Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of MPZ mRNA CTD PMID:17452286 Mpz Rat cisplatin increases expression ISO MPZ (Homo sapiens) 6480464 Cisplatin results in increased expression of MPZ mRNA CTD PMID:27594783 Mpz Rat diarsenic trioxide increases expression ISO MPZ (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MPZ mRNA CTD PMID:27829220 Mpz Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of MPZ mRNA CTD PMID:17452286 Mpz Rat dicrotophos increases expression ISO MPZ (Homo sapiens) 6480464 dicrotophos results in increased expression of MPZ mRNA CTD PMID:28302478 Mpz Rat dorsomorphin multiple interactions ISO MPZ (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mpz Rat doxorubicin decreases expression ISO MPZ (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MPZ mRNA CTD PMID:29803840 Mpz Rat doxorubicin increases expression ISO Mpz (Mus musculus) 6480464 Doxorubicin results in increased expression of MPZ mRNA CTD PMID:36227756 Mpz Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of MPZ mRNA CTD PMID:24395379 Mpz Rat iron dichloride increases expression ISO MPZ (Homo sapiens) 6480464 ferrous chloride results in increased expression of MPZ mRNA CTD PMID:35984750 Mpz Rat linalool decreases expression EXP 6480464 linalool results in decreased expression of MPZ mRNA CTD PMID:20536181 Mpz Rat lipopolysaccharide multiple interactions ISO MPZ (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of MPZ mRNA CTD PMID:35811015 Mpz Rat lithium chloride multiple interactions ISO Mpz (Mus musculus) 6480464 Lithium Chloride inhibits the reaction [Paraquat results in decreased expression of MPZ mRNA] and Lithium Chloride inhibits the reaction [Paraquat results in decreased expression of MPZ protein] CTD PMID:27788593 Mpz Rat lithium chloride increases expression ISO Mpz (Mus musculus) 6480464 Lithium Chloride results in increased expression of MPZ mRNA and Lithium Chloride results in increased expression of MPZ protein CTD PMID:27788593 Mpz Rat N-Nitrosopyrrolidine increases expression ISO MPZ (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of MPZ mRNA CTD PMID:32234424 Mpz Rat nickel atom decreases expression ISO MPZ (Homo sapiens) 6480464 Nickel results in decreased expression of MPZ mRNA CTD PMID:24768652 and PMID:25583101 Mpz Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of MPZ mRNA CTD PMID:33484710 Mpz Rat panobinostat increases expression ISO MPZ (Homo sapiens) 6480464 panobinostat results in increased expression of MPZ mRNA CTD PMID:26272509 Mpz Rat panobinostat multiple interactions ISO MPZ (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MPZ mRNA CTD PMID:27188386 Mpz Rat paracetamol decreases expression ISO MPZ (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MPZ mRNA CTD PMID:29067470 Mpz Rat paraquat decreases expression ISO Mpz (Mus musculus) 6480464 Paraquat results in decreased expression of MPZ mRNA and Paraquat results in decreased expression of MPZ protein CTD PMID:27788593 Mpz Rat paraquat multiple interactions ISO Mpz (Mus musculus) 6480464 Lithium Chloride inhibits the reaction [Paraquat results in decreased expression of MPZ mRNA] more ... CTD PMID:27788593 Mpz Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] affects the expression of MPZ mRNA CTD PMID:35163327 Mpz Rat perfluorooctanoic acid increases expression ISO MPZ (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of MPZ mRNA CTD PMID:36326898 Mpz Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of MPZ mRNA CTD PMID:16787508 Mpz Rat progesterone multiple interactions EXP 6480464 Progesterone inhibits the reaction [Streptozocin results in decreased expression of MPZ mRNA] CTD PMID:17187935 Mpz Rat quercetin increases expression ISO MPZ (Homo sapiens) 6480464 Quercetin results in increased expression of MPZ mRNA CTD PMID:21632981 Mpz Rat resveratrol multiple interactions ISO MPZ (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of MPZ mRNA CTD PMID:23557933 Mpz Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO MPZ (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of MPZ mRNA CTD PMID:35811015 Mpz Rat SB 431542 multiple interactions ISO MPZ (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mpz Rat sirolimus increases expression ISO Mpz (Mus musculus) 6480464 Sirolimus results in increased expression of MPZ protein CTD PMID:20739560 Mpz Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of MPZ protein CTD PMID:29459688 Mpz Rat sodium arsenite decreases expression ISO Mpz (Mus musculus) 6480464 sodium arsenite results in decreased expression of MPZ mRNA CTD PMID:37682722 Mpz Rat sodium arsenite increases expression ISO MPZ (Homo sapiens) 6480464 sodium arsenite results in increased expression of MPZ mRNA CTD PMID:38568856 Mpz Rat streptozocin multiple interactions EXP 6480464 20-alpha-Dihydroprogesterone inhibits the reaction [Streptozocin results in decreased expression of MPZ mRNA] and Progesterone inhibits the reaction [Streptozocin results in decreased expression of MPZ mRNA] CTD PMID:17187935 Mpz Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of MPZ mRNA CTD PMID:17187935 Mpz Rat sunitinib multiple interactions ISO Mpz (Mus musculus) 6480464 Sunitinib inhibits the reaction [IL4 protein results in increased expression of MPZ protein] CTD PMID:36797997 Mpz Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MPZ mRNA CTD PMID:32741896 Mpz Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of MPZ mRNA CTD PMID:20830808 Mpz Rat thiram increases expression ISO MPZ (Homo sapiens) 6480464 Thiram results in increased expression of MPZ mRNA CTD PMID:38568856 Mpz Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of MPZ gene CTD PMID:27618143 Mpz Rat trichostatin A increases expression ISO MPZ (Homo sapiens) 6480464 trichostatin A results in increased expression of MPZ mRNA CTD PMID:24935251 and PMID:26272509 Mpz Rat trichostatin A multiple interactions ISO MPZ (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MPZ mRNA CTD PMID:27188386 Mpz Rat triphenyl phosphate affects expression ISO MPZ (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MPZ mRNA CTD PMID:37042841 Mpz Rat valproic acid affects expression ISO MPZ (Homo sapiens) 6480464 Valproic Acid affects the expression of MPZ mRNA CTD PMID:25979313 Mpz Rat valproic acid increases expression ISO MPZ (Homo sapiens) 6480464 Valproic Acid results in increased expression of MPZ mRNA CTD PMID:26272509 and PMID:29154799 Mpz Rat valproic acid multiple interactions ISO MPZ (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MPZ mRNA CTD PMID:27188386 Mpz Rat vincristine increases response to substance ISO Mpz (Mus musculus) 6480464 MPZ gene results in increased susceptibility to Vincristine CTD PMID:16676325 Mpz Rat vorinostat multiple interactions ISO MPZ (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MPZ mRNA CTD PMID:27188386
(20S)-20-hydroxypregn-4-en-3-one (EXP) 17beta-estradiol (EXP) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3alpha-hydroxy-5beta-pregnan-20-one (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aminolevulinic acid (EXP) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) arsenous acid (ISO) atrazine (EXP) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bortezomib (EXP,ISO) cadmium dichloride (EXP) carbamazepine (ISO) chlorpyrifos (EXP) cisplatin (ISO) diarsenic trioxide (ISO) diazinon (EXP) dicrotophos (ISO) dorsomorphin (ISO) doxorubicin (ISO) glycidol (EXP) iron dichloride (ISO) linalool (EXP) lipopolysaccharide (ISO) lithium chloride (ISO) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) nitrofen (EXP) panobinostat (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctanoic acid (EXP,ISO) progesterone (EXP) quercetin (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sirolimus (ISO) sodium arsenite (EXP,ISO) streptozocin (EXP) sunitinib (ISO) testosterone (EXP) thapsigargin (EXP) thiram (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vincristine (ISO) vorinostat (ISO)
1.
Two amino-acid substitutions in the myelin protein zero gene of a case of Charcot-Marie-Tooth disease associated with light-near dissociation.
Bienfait HM, etal., Neuromuscul Disord 2002 Mar;12(3):281-5.
2.
Diabetes-induced myelin abnormalities are associated with an altered lipid pattern: protective effects of LXR activation.
Cermenati G, etal., J Lipid Res. 2012 Feb;53(2):300-10. doi: 10.1194/jlr.M021188. Epub 2011 Dec 7.
3.
Cultured Schwann cells constitutively express the myelin protein P0.
Cheng L and Mudge AW, Neuron. 1996 Feb;16(2):309-19.
4.
Peripheral myelin protein 22 and protein zero: a novel association in peripheral nervous system myelin.
D'Urso D, etal., J Neurosci. 1999 May 1;19(9):3396-403.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
A dual tyrosine-leucine motif mediates myelin protein P0 targeting in MDCK cells.
Kidd GJ, etal., Glia. 2006 Aug 1;54(2):135-45.
8.
Mpz gene suppression by shRNA increases Schwann cell apoptosis in vitro.
Lei L, etal., Neurol Sci. 2010 Oct;31(5):603-8. doi: 10.1007/s10072-010-0341-2. Epub 2010 Jun 15.
9.
Isolation and sequence of a cDNA encoding the major structural protein of peripheral myelin.
Lemke G and Axel R, Cell 1985 Mar;40(3):501-8.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
An axonal form of Charcot-Marie-Tooth disease showing distinctive features in association with mutations in the peripheral myelin protein zero gene (Thr124Met or Asp75Val).
Misu K, etal., J Neurol Neurosurg Psychiatry 2000 Dec;69(6):806-11.
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
14.
GOA pipeline
RGD automated data pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Comprehensive gene review and curation
RGD comprehensive gene curation
18.
Electrical stimulation enhances peripheral nerve regeneration after crush injury in rats.
Zhang X, etal., Mol Med Rep. 2013 May;7(5):1523-7. doi: 10.3892/mmr.2013.1395. Epub 2013 Mar 26.
Mpz Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 86,103,290 - 86,109,156 (+) NCBI GRCr8 mRatBN7.2 13 83,570,811 - 83,576,680 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 83,570,811 - 83,576,679 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 86,076,519 - 86,082,418 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 87,474,755 - 87,480,657 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 84,706,501 - 84,712,211 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 89,524,204 - 89,530,070 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 89,524,329 - 89,530,068 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 94,151,850 - 94,156,749 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 87,040,479 - 87,045,378 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 87,229,362 - 87,234,262 (+) NCBI Celera 13 83,202,202 - 83,207,991 (+) NCBI Celera Cytogenetic Map 13 q24 NCBI
MPZ Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 161,303,600 - 161,309,968 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 161,304,735 - 161,309,968 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 161,274,525 - 161,279,758 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 159,541,151 - 159,546,377 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 158,087,599 - 158,092,817 NCBI Celera 1 134,341,666 - 134,346,903 (-) NCBI Celera Cytogenetic Map 1 q23.3 NCBI HuRef 1 132,631,395 - 132,636,601 (-) NCBI HuRef CHM1_1 1 162,670,753 - 162,675,990 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 160,441,004 - 160,447,413 (-) NCBI T2T-CHM13v2.0
Mpz Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 170,978,282 - 170,988,699 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 170,978,280 - 170,988,699 (+) Ensembl GRCm39 Ensembl GRCm38 1 171,150,713 - 171,161,130 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 171,150,711 - 171,161,130 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 173,080,844 - 173,091,254 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 172,987,388 - 172,997,798 (+) NCBI MGSCv36 mm8 Celera 1 173,598,959 - 173,609,357 (+) NCBI Celera Cytogenetic Map 1 H3 NCBI cM Map 1 79.05 NCBI
Mpz Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955468 13,041,011 - 13,047,284 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955468 13,041,911 - 13,047,026 (-) NCBI ChiLan1.0 ChiLan1.0
MPZ Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 88,543,449 - 88,573,944 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 88,233,764 - 88,264,228 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 136,691,245 - 136,720,958 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 140,603,609 - 140,631,273 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 140,626,039 - 140,631,273 (-) Ensembl panpan1.1 panPan2
MPZ Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 21,205,339 - 21,210,439 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 21,205,107 - 21,210,451 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 21,280,251 - 21,285,323 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 21,323,207 - 21,328,277 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 21,323,098 - 21,328,270 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 21,220,355 - 21,225,416 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 21,626,466 - 21,631,518 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 22,034,738 - 22,039,792 (+) NCBI UU_Cfam_GSD_1.0
Mpz
MPZ Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 89,169,311 - 89,179,925 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 89,174,107 - 89,179,556 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 97,031,478 - 97,036,934 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MPZ Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 2,662,163 - 2,668,393 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 2,665,737 - 2,668,393 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 1,720,210 - 1,725,435 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mpz
.
Predicted Target Of
Count of predictions: 110 Count of miRNA genes: 90 Interacting mature miRNAs: 101 Transcripts: ENSRNOT00000004279 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 738027 Lnnr6 Liver neoplastic nodule remodeling QTL 6 3.3 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 74862117 85581182 Rat 1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 4889606 Gluco63 Glucose level QTL 63 2.86 0.003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 80753256 106807694 Rat 8655945 Rf61 Renal function QTL 61 3.6 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 13 69060519 86800898 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 1331783 Bp221 Blood pressure QTL 221 3.72886 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 69060519 86800898 Rat 8655959 Pur32 Proteinuria QTL 32 8.4 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 74023918 97213863 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 1300166 Kidm6 Kidney mass QTL 6 3.93 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 13 69060519 86800898 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
RH129131
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 83,576,485 - 83,576,647 (+) MAPPER mRatBN7.2 Rnor_6.0 13 89,529,876 - 89,530,037 NCBI Rnor6.0 Rnor_5.0 13 94,157,377 - 94,157,538 UniSTS Rnor5.0 RGSC_v3.4 13 87,046,006 - 87,046,167 UniSTS RGSC3.4 Celera 13 83,207,797 - 83,207,958 UniSTS RH 3.4 Map 13 561.7 UniSTS Cytogenetic Map 13 q24-q25 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
105
59
58
27
25
27
6
184
97
85
43
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004279 ⟹ ENSRNOP00000004279
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 83,570,811 - 83,576,679 (+) Ensembl Rnor_6.0 Ensembl 13 89,524,329 - 89,530,068 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109813 ⟹ ENSRNOP00000095879
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 83,573,143 - 83,576,679 (+) Ensembl
RefSeq Acc Id:
NM_001314068 ⟹ NP_001300997
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 86,103,290 - 86,109,156 (+) NCBI mRatBN7.2 13 83,570,811 - 83,576,680 (+) NCBI Rnor_6.0 13 89,524,204 - 89,530,070 (+) NCBI Celera 13 83,202,202 - 83,207,991 (+) NCBI
Sequence:
CCACCTCTCAATTGCACATGCCAGGCTGCAATTGGTCACTGGCTCAGGACAGCCCCCTCATGCTGGGGATCCAGGGGATTTTAAGCAGGTTCCAGAAAACACCACTCAGTTCCTTGTCCCCCGCTCTC
hide sequence
RefSeq Acc Id:
NM_017027 ⟹ NP_058723
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 86,103,290 - 86,109,156 (+) NCBI mRatBN7.2 13 83,570,811 - 83,576,680 (+) NCBI Rnor_6.0 13 89,524,204 - 89,530,070 (+) NCBI Rnor_5.0 13 94,151,850 - 94,156,749 (+) NCBI RGSC_v3.4 13 87,040,479 - 87,045,378 (+) RGD Celera 13 83,202,202 - 83,207,991 (+) NCBI
Sequence:
CCACCTCTCAATTGCACATGCCAGGCTGCAATTGGTCACTGGCTCAGGACAGCCCCCTCATGCTGGGGATCCAGGGGATTTTAAGCAGGTTCCAGAAAACACCACTCAGTTCCTTGTCCCCCGCTCTC
hide sequence
RefSeq Acc Id:
NP_058723 ⟸ NM_017027
- Peptide Label:
isoform MPZ precursor
- UniProtKB:
P06907 (UniProtKB/Swiss-Prot), A6JFU2 (UniProtKB/TrEMBL), A0A8I6GLD0 (UniProtKB/TrEMBL)
- Sequence:
MAPGAPSSSPSPILAALLFSSLVLSPTLAIVVYTDREVYGAVGSQVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPSWKDGSIVIHNLDYSDNGTFTCD
hide sequence
RefSeq Acc Id:
NP_001300997 ⟸ NM_001314068
- Peptide Label:
isoform L-MPZ precursor
- Sequence:
MAPGAPSSSPSPILAALLFSSLVLSPTLAIVVYTDREVYGAVGSQVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPSWKDGSIVIHNLDYSDNGTFTCD
hide sequence
Ensembl Acc Id:
ENSRNOP00000004279 ⟸ ENSRNOT00000004279
Ensembl Acc Id:
ENSRNOP00000095879 ⟸ ENSRNOT00000109813
RGD ID: 13698996 Promoter ID: EPDNEW_R9519 Type: single initiation site Name: Mpz_1 Description: myelin protein zero SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 89,524,311 - 89,524,371 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Mpz
Myelin protein zero (Charcot-Marie-Tooth neuropathy 1B)
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_process
may be involved in organizing formation of the myelin sheath
728953
